A SQUARE FOR THE CITY/ UNA PIAZZA PER LA CITTA’ Images, studies and projects for Liria Square in Durres/ Immagini, studi e progetti per Piazza Liria a Durazzo by /a cura di Piero Rovigatti 1 7KLVERRNZDVSXEOLVKHGWKDQNVWR¿QDQFLDODVVLVWDQFHIURPWKH'$57 'HSDUWPHQWRI(QYLURQPHQW1HWZRUN WHUULWRU\ 8QLYHUVLW\RI&KLHWL3HVFDUDDQGWKH0XQLFLSDOLW\RI'XUUHVSURPRWHURIWKH,QWHUQDWLRQDO&RPSHWLWLRQIRU WKHUHYLWDOL]DWLRQRI/LULDVTXDUHLQ'XUUHVDQGXQGHUWKHDXVSLFHVRIWKH)RUXPRI$GULDWLFDQG,RQLDQDQG,1$5&+ (National Institute of Architecture).4XHVWDSXEEOLFD]LRQHqVWDWDUHDOL]]DWDJUD]LHDOFRQWULEXWR¿QDQ]LDULRGHO DART (Dipartimento Ambiente, Reti e Territorio) dell’Università di Chieti e Pescara e del Comune di Durazzo, orga­ nizzatore del Concorso Internazionale per la rivitalizzazione di piazza Liria, e sotto il patrocinio del Forum delle Città dell’Adriatico e dello Ionio e di INARCH (Istituto Nazionale di Architettura) The idea and project of the initiative, the editing of the publication are by Piero Rovigatti/ /¶LGHD]LRQHHLOSURJHWWRGHOO¶LQL]LDWLYDODFXUDHGLWRULDOHHJUD¿FDGHOODSXEEOLFD]LRQHVRQRGL3LHUR5RYLJDWWL 7KHOD\RXWDQGJUDSKLFVDUHE\,VLGD'XNDDQG0LFKDHOD5RGULJXH]L’impaginazione è a cura di Isida Duka e Mi­ chaela Rodriguez. The translation are of Antonella Rossetti/Le traduzioni sono di Antonella Rossetti. Web site by Pietro Balducci/Organizzazione e gestione del sito web a cura di Pietro Balducci. The texts of the volume, if not expressly stated in the text, are written by Piero Rovigatti/ I testi del volume, quando non espressamente indicato nel testo, sono di Piero Rovigatti. Writings and cognitive contributions by/ Scritti e contributi conoscitivi di: Vangjush Dako0DMRURI'XUUHVSindaco di Durazzo Adrian Cela'HSXW\PDMRURI0XQLFLSDOLW\RI'XUUHVVicesindaco di Durazzo Isida Duka, 3LDQL¿FDWULFHMXQLRUJunior Planner, 'XUUHV$OEDQLD Massimo Luciani, Forum of Adriatic and Ionian Cities/ Forum delle Città dell’Adriatico e dello Ionio, Pescara Rocco Maragna, architect/architetto, Toronto, Canada Alberto Monti, archaelogist/archeologo, Modena, Italy Beatrice Fumarola,,1$5&+,WDO\/ INARCH, Italy Piero Rovigatti8QLYHUVLW\RI&KLHWL3HVFDUD´'$57Università Chieti ­ Pescara”, DART, Italy Barbara Sassi, 3K', University of Parma Sara Santoro8QLYHUVLW\RI&KLHWL3HVFDU'HSDUWPHQWRI+LVWRU\Università Chieti ­ Pescara, Italy Luca Zevi,DUFKLWHFW,1$5&+architetto, INARCH, Roma, Italy Copyright MMX ARACNE editrice S.r.l. www.aracneeditrice.it info@aracneeditrice.it via Raffaele Garofalo, 133 A/B 00173 Roma (06) 93781065 ISBN 978 ­ 88 ­ 548 ­ 3341 ­ 8 I diritti di traduzione, di memorizzazione elettronica, di riproduzione e di adattamento anche parziale, con qualsiasi mezzo, sono riservati per tutti i paesi. Non sono assolutamente consentite le fotocopie senza il permesso scritto dell’Editore. I edizione:ottobre 2010 2 This volume collects the images, preparatory studies and projects products around the activities of the Inter­ QDWLRQDO&RPSHWLWLRQIRUWKHUHYLWDOL]DWLRQRIWKHVTXDUHLQ'XUUHV/LULDSURPRWHGE\,1$5&+DQGWKH)RUXP of Adriatic and Ionian, sponsored by the Town Council of the city between July 2, 2008 and January 28, 2009 under the rule of the new Plan Urban Integrated central area, which was approved in October 2007. 7KHFRPSHWLWLRQRUJDQL]HGLQWZRSKDVHV¿UVWVHHQLQDZLGHLQWHUQDWLRQDOSDUWLFLSDWLRQ SURMHFWSDUWLFL­ SDQWV LQWKHVHFRQGWKHGHYHORSPHQWRI¿YH¿QDOLVWVWKURXJKSDUWLFLSDWRU\DFWLYLWLHVDQGZRUNVKRSVZKLFK led to the selection of the winning project, currently being running. But the competition as a whole, was also an opportunity to gather around the theme of public space and, PRUHJHQHUDOO\WKHUHFRYHU\DQGXUEDQUHJHQHUDWLRQLQ'XUUHVLQ$OEDQLDDIWHUPDQ\\HDUVRIQHJOHFWDQG indifference, a vast area of experts, already working on site: archaeologists, urban planners, architects, en­ gineers of public administration. Proving that even in turbulent Albania’s transition to a market economy and uncontrolled building development you can try to think quality and urban livability as shared core values of a new urban season (P.R.). Questo volume raccoglie le immagini, gli studi preparatori e i progetti prodotti attorno all’attività del Concorso Internazionale per la rivitalizzazione di piazza Liria a Durazzo, promosso dall’INARCH e dal Forum delle Città dell’Adriatico e dello Ionio, bandito dall’Amministrazione Comunale della città tra il 2 luglio 2008 e il 28 gennaio 2009 sulla base delle norme del nuovo Piano Urbanistico Integrato dell’area centrale, approvato nell’ottobre 2007. Il Concorso, organizzato in due fasi, ha visto nella prima fase una vasta partecipazione internazionale (36 SURJHWWLSDUWHFLSDQWL QHOODVHFRQGDORVYLOXSSRGLFLQTXHSURJHWWL¿QDOLVWLDQFKHDWWUDYHUVRDWWLYLWjHVHPLQDUL partecipati, che hanno portato alla selezione del progetto vincitore, in corso di esecuzione. Ma il Concorso, nel suo complesso, è stata anche occasione per raccogliere attorno al tema dello spazio pubblico e, più in generale, del recupero e della rivitalizzazione urbana, a Durazzo e in Albania, dopo molti anni di incuria e indifferenza, una vasta area di esperti già impegnati in loco: archeologi, urbanisti, architetti, tecnici della pubblica amministrazione. A dimostrazione che anche nella turbinosa Albania della transizione all’economia di mercato e dell’incontrollato sviluppo edilizio è possibile provare a pensare alla qualità e alla vivibilità urbana come valori fondanti e condivisi di una nuova stagione urbana (P.R.). 3 Tourin, July, 2nd 2008, Auditorium Centro Congressi Il Lingotto, Conference Presenta­ tion of Liria International Competition at XXIII UIA World Congress of Architecture/ Tori­ no, 2 luglio 2008, Auditorium Centro Congressi Il Lingotto, presentazione del Concorso Interazionale per piazza Liria nell’ambito del XXIII Congresso Mondiale degli Architetti, UIA (M. Zaccarelli, A. Cela, L. Zevi, V. Dako, P. Rovigatti). 4 First phase projects/Progetti di prima fase: Linea d’ombra/ Portugal, Ivan de Sousa, Ines Antunes Temenos,WDO\8PEHUWR6LROD/XLJL0LODQR)HGHULFD9LVFRQWL5HQDWR&DSR]]L Cult|d|urres/ Portugal: Arch. Nadir Bonaccorso Piazza della Liberazione 0156SDLQ6DUD'DQLHOD5RGULJXH]1DYDUUR MSTO8,WDO\$OEDQLD/OXNDOOXNDQL/XFD*LDQQLQL9HUHQD(ZHUHW$OHVVDQGUR,QWHUODQGR New fragments,WDO\/RUHQ]R1HWWL*ORULD$9DOHQWH0DXUL]LR%UDGDVFKLD/XLJL*XDGDJQROR$OHVVDQGUR*XDGDQJROR)UDQFHVFR*LVPRQGL'3DVWRUH$6FDUFHOOL The missing link*HUPDQ\0DWWKLDV%DXHU%'$%MRUQ6RUHQ6LSSHO)LOLSHGH6RX]D:XOI.UDPHU6WHIDQ%DVVLQJ A square as bridge between history and the future/,WDO\3DROD5RVVL*LXVHSSH/RVXUGR$OIUHGR$PDWL$GD)RVFKL,ODULD*DURIROR$OHVVLR$QFLOODL'DULR/HPER Ilare Iliria,WDO\$UWXUR&XFFLROOD6DQWH&XWHFFKLD)UDQFHVFR)DUHOOD3DROR%HUORFR'RPLDQD6DQWRUR9LWR0DLXOODUL Piazza7Piazze,WDO\$OEDQLD*LDQ3DROR5RVFDQL6DEULQD&DQWDOLQL$GHODLGHGL0LFKHOH$QWRQLR7HUUDQRYD&ODXGLD&HFDPRUH/\VH+DQVHQ30ROLQDUL/0XOODGHPL Quantum,WDO\0LOHQD)DULQD0DULHOOD$QQHVH3LHUDQJHOR,]]R Suoli Sensibili/ Italy, Laura Mascino, Barbara Agnoletto, Giulia Lobba, Anna Paola Pola Durres, European Capital of Culture 2020,WDO\6LE\OOD=HFK5HJLQD/HWWQHU*LWWL'RUWVWDWWHU*DEULHOOH.UHPHU+HOPXW.RFK0DULR7HUF]L]5%XNRU New Sheshi i Lirise,WDO\)UDQFHVFR7HVWD)HGHULFD3RPSHLDQR)DELR'HOO¶,VROD Con sheshi Temporary,WDO\&DQDGD/RUHQ]R3LJQDWWL0RUDQR)HGHULFD2WWRQH0DUFR9RGRWWR50DVFDUXFFL(+DOGHQE\60DVXL&&HOOXFFL6*UXRVVR3/LJXRUL Forum,WDO\(WWRUH'H/HOOLV*LDQOXFD%X]]OL9HQDQ]LR3UR]]L-HVVLND5RPDQR$OHVVLD%ULJQDUGHOOR Carpets,WDO\$OEDQLD3LHU3DROR%DOERGL9LQDGLR0DQOLR9HQGLWWHOOL0DXUL]LR,PSHULR3DROR0LFDOL]]L$OIUHGR3DVVLHUL$&DUDFFLROR6&DSUD/5HEHFFKLQL6=KH]KD Sundials/ Albania, England: Christian Coop, Thoma Papa, Stuart Walker, Andrew Wells In between,WDO\$OEDQLD0DULQR0DULD*LDFRPD(OHG)DJX%HVQLN$OLDM6RWLU'KDPR'ULWDQ6KXWLQD Tone of thickness-DSDQ:DWDUX6DNDNL0XQHWDND.XERWD0HJXPL:DLGD Iliria Square86$6X]DQ&.HQ]OH.HQ/DZUHQFH Center Green3RUWXJDO,WDO\$OEDQLD-RDR$QWRQLR5LEHLUR)HUUHLUD1XQHV'RPHQLFR&RQDFL&ODXGLD/D6SDGD$OWLQ3UHPWL7DPDUD(IWKLPL Corpo presente,WDO\$OEDQLD*LQR0DODFDUQH'DYLGH*LRULR*LRYDQQL)XUODQ$OHVVDQGUR7RJQRQ$7ULYHOODWR0&DUD6)HUUR&6LPLRQL(6HPSULQL6*DEULHOOL MEDIterraneanSTRATA,WDO\%UD]LO(WWRUH9DGLQL&DUOR3R]]L0LOWRQ/LHEHQWULWWGH$OPHLGD%UDJD9LQFHQ]R6HSH0DVVLPR'¶$UFDQJHOR$OHVVDQGUR%XRQJLRYDQQL An Denken und Verwindung,WDO\5REHUWR)RUWH)UDQFHVFR&DPSDLROD0DXUL]LR&URFFR$QGUHD*XDUGR0/5RVDULR/HDQWH5REHUWR3RVWRULQR ICON/ Spain: Ignasi Riera Mas, Luis Alonso Calleja, Xavier Olivella, Cota Cero, Mauricio Ramirez, Joseph Lascurain, E. Regueiro Iliria Netsquare,WDO\/XFLD.UDVRYHF/XFDV0DUFR&ODXGLR&HFHUH7DQLD'DQHOX]0LFKHOD0DULFFKLR5REHUWR2FHUD(OLVD9ODGLOR Urban Kilim,WDO\$OEDQLD5RVVD$WHQD$ONHW0HVODQL.ORGLDQD(PLUL$UWLVW%ULNHQD6KNRGUD$UEHQ'HUYLVKDM(UYLQ3DFL Crescere a strati/ Italy: Santo Marra, Pietro Alessandro Latella, Giuseppa Polimeni Landscape levels,WDO\&DUPHOR%DJOLYR/XFD*DORIDUR)DEUL]LR*ORULRVR0DQXHOD*HQWLOH&KLDUD6FRFFR Folding,WDO\0LFKHOH&UR¶$ODLQ(QQLR$VFDUHOOL0+HOHQD0DUFKHWWL$OEHUWR&UR¶ Void6SDLQ')UDQFLVFR-DYLHU+LJXHUD<HOD'$OHMDQGUR3HUH]0DUWLQH]'HVLJQ7HDP+&3 $UTXLWHFWRV$VRFLDGRV Nell’ombra delle città*HUPDQ\2OLYHU*DFKZHW]0LFKDHO.OHLQ&KULVWLDQ+DLG1LFROH5DNHU'DQLHO=LPPHUPDQQ Freedom at the center,WDO\*LRYDQQL&D¿HUR0DULDOXLVD&LSULDQL&ODXGLD0RUUL%HUQKDUG1HXOLFKHGO(OLVD0RQWDOWL For AR/S/ ,WDO\/RUHQ]D%URQ]RQL)UDQFR3R]]L Rooits of memories/ Portugal: Miguel Meirinhos, Pedro Lopes, Pedro Oliveira Di natura urbana,WDO\)HGHULFR,DFKHOOD6WHIDQR)DYD)DELR'DLQHOOL0LUNR0DULQR Second phase projects/ Progetti di seconda fase: Linea d’ombra, Archh. I. de Sousa, I. Antunes Suoli Sensibili , Archh. L. Mascino, B. Agnoletto, G. Lobba, A. P. Pola Con sheshi Temporary$UFKK/3LJQDWWL)2WWRQH09RGRWWR(+DOGHQE\60DVXL&&HOOXFFL6*UXRVVR3/LJXRUL Sundials, Archh. C. Coop, Th. Papa, S. Walker, A. Wells Folding$UFKK0&Uz$&Uz($VFDUHOOL+0DUFKHWWL Winning project/ Progetto vincitore: Folding$UFKK0&Uz$&UzD'HVLJQ$JU$($VFDUHOOL$UFKHRORJLVW0+0DUFKHWWL 5 TABLE OF CONTENTS/ INDICE Invitation letter from the Major of the City/ Lettera di invito dal sindaco di Durazzo ........................................................................... 9 Massimo Luciani, )RUXPRI$GULDWLFDQG,RQLDQ&LWLHVForum delle Città dell’Adriatico e dello Ionio ...................................................... 10 I %HDWULFH)XPDUROD,1$5&+ 1$5&+1DWLRQDO,QVWLWXWHRI$UFKLWHFWXUHIstituto Nazionale di Architettura........................................... 11 Thanks/ Ringraziamenti ......................................................................................................................................................................... 12 7KHÀUVWSKDVHRIFRPSHWLWLRQ&RQGLWLRQVDQGGHPDQGIRULQWHUYHQWLRQ/ La prima fase del concorso. Condizioni e domanda di intervento :K\DFRPSHWLWLRQIRUWKHFHQWUDOVTXDUHRI'XUUHVPerché un concorso per la Piazza Centrale di Durazzo ............................. 17 1.2 Site and context description/ Descrizione del sito e del contesto ..................................................................................................19 1.3 Environmental, ecological and landscape conditions/ Condizioni ambientali, ecologiche e di paesaggio .................................... 24 +LVWRULFDODQGFXOWXUDOKHULWDJHEredità storiche e culturali ...........................................................................................................26 1.5 Site conditions and its own actual nature/ Condizioni d’uso e caratteri identitari attuali ................................................................31 1.6 Tried or previous planning solutions/ Soluzioni progettuali tentate o precedenti ...........................................................................34 1.7 Current normative conditions/ Condizioni normative attuali ..........................................................................................................40 1.8 Opportunities and risks/ Opportunità e rischi .................................................................................................................................48 1.9 Plan programme and site analysis/ Programma di progetto e analisi del sito ...............................................................................50 1.10 Budget and condition of programme realization/ Budget e condizioni di attuazione del programma ............................................51 1.11 Organization of the competition/ Organizzazione del concorso .....................................................................................................52 )LUVWSKDVHDGPLWWDQFHFRQGLWLRQVDQGLQTXLULHVPrima fase. Condizioni di accesso e richieste ................................................53 1.13 Second phase ­ admittance conditions and inquiries/ Seconda fase. Condizioni di accesso e richieste ......................................54 1.14 Evaluation procedures and jury of the competition/ Procedure di valutazione e Giuria di Concorso ............................................54 1.15 Administrative contract/ Contratto amministrativo .........................................................................................................................55 1.16 Calendar of the competition/ Calendario della competizione ........................................................................................................55 1.17 Support drawings/ (ODERUDWLJUD¿FLGLVXSSRUWR.............................................................................................................................56 1.18 Application forms for the competition/ Moduli di partecipazione ....................................................................................................57 2. First phase design solutions/ Risultati della prima fase 7KHH[SHULHQFHRI/LULDVTXDUHFRPSHWLWLRQLQWKHQHZXUEDQVHDVRQRI'XUUHVL’esperienza del concorso di Piazza Iliria nella nuova stagione urbana di Durazzo, A.Cela, P. Rovigatti .................................................................................................................61 2.2 36 planning ideas for the city and its square/ 36 progetti per la città e la sua piazza .....................................................................71 )LUVWSKDVH-85<¶667$7(0(17/ Valutazione della Giuria ..........................................................................................................74 3. Design solutions/ Materiali di concorso 3.1 Linea d’ombra/ Portugal ................................................................................................................................................................... 79 3.2 Temenos/ Italy .................................................................................................................................................................................. 82 3.3 Cult|d|urres/Portugal ........................................................................................................................................................................ 85 3.4 Piazza della Liberazione 015/ Italy, Spain ........................................................................................................................................88 3.5 MSTO8/ Italy, Albania ....................................................................................................................................................................... 91 3.6 New fragments/ Italy .........................................................................................................................................................................94 3.7 The missing link/ Germany .............................................................................................................................................................. 97 3.8 A square as bridge between history and the future/ Italy ............................................................................................................... 100 3.9 Ilare Iliria/ Italy ................................................................................................................................................................................ 103 3.10 Piazza7Piazze/ Italy, Albania ....................................................................................................................................................... 106 3.11 Quantum/ Italy .............................................................................................................................................................................. 109 3.12 Suoli Sensibili/ Italy ...................................................................................................................................................................... 111 'XUUHV(XURSHDQ&DSLWDORI&XOWXUH Italy .......................................................................................................................... 114 3.14 New Sheshi i Lirise/ Italy .............................................................................................................................................................. 116 3.15 Con sheshi Temporary/ Italy, Canada .......................................................................................................................................... 118 )RUXPItaly .................................................................................................................................................................................. 121 3.17 Carpets/ Italy, Albania .................................................................................................................................................................. 123 6 3.18 Sundials/ Albania, England .......................................................................................................................................................... 126 3.19 In between/ Italy, Albania ............................................................................................................................................................. 129 3.20 Tone of thickness/ Japan ........................................................................................................................................................... 132 3.21 Iliria Square/ USA ........................................................................................................................................................................ 135 3.22 Center Green/ Portugal, Italy, Albania .......................................................................................................................................... 138 3.23 Corpo presente/ Italy, Albania ...................................................................................................................................................... 141 0(',WHUUDQHDQ675$7$Italy, Brazil ............................................................................................................................................144 $Q'HQNHQXQG9HUZLQGXQJItaly ................................................................................................................................................ 147 3.26 ICON/ Spain ................................................................................................................................................................................. 150 3.27 Iliria Netsquare/ Italy .................................................................................................................................................................... 152 8UEDQ.LOLPItaly, Albania ............................................................................................................................................................ 155 3.29 Crescere a strati/ Italy .................................................................................................................................................................. 158 3.30 Landscape levels/ Italy .................................................................................................................................................................161 )ROGLQJItaly .................................................................................................................................................................................163 9RLGSpain ................................................................................................................................................................................... 166 3.33 Nell’ombra delle città/ Germany ................................................................................................................................................... 169 )UHHGRPDWWKHFHQWHU Italy ......................................................................................................................................................... 172 3.35 Roots of memories/ Portugal ........................................................................................................................................................175 'LQDWXUDXUEDQDItaly ..................................................................................................................................................................178 4. The second phase of competition/ La seconda fase del concorso 4.1 The project demand for the second phase of competition/ Le domande di progetto della seconda fase di concorso ...................182 7KHDQFLHQWPRQXPHQWVDURXQGWKHVTXDUH WKHFRQWULEXWLRQRIWKH,WDOLDQ$UFKDHRORJLFDO0LVVLRQLQ'XUUHV I monumenti antichi intorno alla piazza, B. Sassi ...................................................................................................................................................188 4.3 The preparatory seminars and outside visits/ I seminari preparatori e le visite sul campo ............................................................ 212 5. The 5 projects of second phase/ I 5 progetti della seconda fase 5.1 Linea d’ombra ................................................................................................................................................................................ 225 5.2 Suoli sensibili ................................................................................................................................................................................. 235 5.3 Con Sheshi Temporary .................................................................................................................................................................. 247 5.4 Sundials ......................................................................................................................................................................................... 259 )ROGLQJ 269 -XU\'HFLVLRQ/,OJLXGL]LR¿QDOHGHOOD*LXULD 281 7KH¿QDOGUDIWRIWKHVTXDUH,OSURJHWWRGH¿QLWLYRGHOODSLD]]D............................................................................................ 282 6. Balances, outcomes, prospects/ Bilanci, esiti, prospettive 6.1 A strategy for the city/Una strategia per la città, Luca Zevi ............................................................................................................. 298 0HPRULHVDERXW'XUUHVDQGKLVVTXDUHMemorie su Durazzo e la sua piazza, Rocco Maragna ................................................... 301 6.3 A letter to the city and his inhabitants/Una lettera alla città e ai suoi abitanti, Alberto Monti ...........................................................305 )URPWKHFRPSHWLWLRQVLWHWRDYLUWXDOPXVHXPRIXUEDQKLVWRU\DQGFXOWXUHRIWKHSURMHFW Dal sito del concorso al museo virtuale di storia urbana e di cultura del progetto.3LHUR5RYLJDWWL,VLGD'XND.............................309 6.5 Learning from this experience/Cosa apprendere da questa esperienza, Piero Rovigatti ................................................................311 Appendix Il senso delle memorie nelle città della transizione all’economia di mercato. Un’ipotesi di ricerca per le città costiere adriatiche Piero Rovigatti ...................................................................................................................................................................................... 319 %LEOLRJUDÀD.......................................................................................................................................................................................... 329 7 'XUUHV/LULD6TXDUHWRZQKDOODurazzo, piazza Liria, sede municipale Invitation letter from the Major of the City/ Lettera di invito dal sindaco di Durazzo 9DQJMXVK'DNR_0DMRURIWKHFLW\ The idea of collecting and selecting the best project proposals to begin the revitalization of the main square of my city intends to continue and give more substance to the care over the historic city and over the central city, begun with the formation and the passage of the new Urban Integrated Plan of the Old 7RZQRI'XUUHVDIWHUPDQ\\HDUVRIXUEDQGLVRUGHU and lack of administrative initiative about issues of UHFRYHU\DQGRIXUEDQTXDOLW\7KLVDFWLRQDOVR¿WVLQ a structured programme of urban regeneration of the city started from the most recent Municipal Admini­ strations, also thanks to the cooperation of numerous international bodies (European Union, World Bank, Cooperazione Italiana allo Sviluppo, MAE), and to WKHRSHUDWLRQRIVXSSRUWDQGVFLHQWL¿FUHVHDUFKLQ WKH¿HOGRIDUFKDHRORJLFDODQGXUEDQGHYHORSPHQW offered by some Italian Universities (working for several years at the University of Parma, the Univer­ sity of Bologna, and more recently at the University of Chieti and Pescara). In recent years the city has lost many of its public spaces and green areas, and generally reduced the urban quality that has always characterized the whole picture, common to many cities Adriatic seafood, open, friendly, comfortable. Today our interest and our efforts to return the issues of quality and livability of the city at the center of DGPLQLVWUDWLYHDFWLRQWRWKHEHQH¿WRILWVLQKDELWDQWV its visitors and of those stakeholders. The general assumption that drives the commitment of my admi­ nistration is to reestablish a new relationship with the XUEDQKLVWRU\RI'XUUHVUHVWDUWLQJZRUNRIUHJHQH­ UDWLRQDQGUHFRYHU\RIVLJQL¿FDQWFXOWXUDOKHULWDJHLQ my city still has. The redesign of the Central Square of the city ­ Iliria Square ­ always the heart of the city, and the symbo­ lic space of representation of his community, the main public place of collective life, is an exceptional opportunity to consolidate a process initiated and intended to give force and quality to the whole urban and metropolitan structure. 3UHFLVHO\WKURXJKWKLVDFWLYLW\WKH&LW\RI'XUUHV wants to communicate its new image of the city in motion, active and innovative, and at the same time attentive to the values of the past, of its history and of its memories, geared to the sustainability and to WKHRYHUDOOTXDOLW\RILWVGHYHORSPHQW)RUDOOWKHVH reasons, the city is getting into motion, and intends to remain active and vital. A recent motto we chose WRFKDUDFWHUL]HRXUHQHUJ\LVSUHFLVHO\³'XUUHVQHYHU stops!” L’idea di raccogliere e selezionare le migliori proposte progettuali per dare avvio alla rivitalizzazione della piazza principale della mia città intende proseguire e dare maggior corpo ad un’attività di attenzione alla città storica e all’area centrale della città, iniziata con la formazione e l’approvazione del nuovo Piano Urbanistico Integrato GHOOD&LWWj9HFFKLDGL'XUD]]RGRSRPROWLDQQLGLGLVRUGLQHXUEDQL­ stico e di assenza d’iniziativa amministrativa sui temi del recupero e della qualità urbana. Tale azione s’inserisce peraltro in un programma VWUXWWXUDWRGLULTXDOL¿FD]LRQHXUEDQDGHOODFLWWjDYYLDWRGDOOHSLUHFHQWL Amministrazioni Comunali, grazie anche alla cooperazione di numerosi organismi internazionali (Unione Europea, World Bank, Cooperazione Italiana allo Sviluppo, MAE), e all’attività di supporto e di ULFHUFDVFLHQWL¿FDLQFDPSRDUFKHRORJLFRHXUEDQLVWLFRRIIHUWDGDDOFXQH Università Italiane (già da alcuni anni l’Università di Parma, l’Università GL%RORJQDHSLUHFHQWHPHQWHO¶8QLYHUVLWjGL&KLHWLH3HVFDUD  Nei prossimi quattro anni che attendono la nostra azione amministrati­ va, vogliamo segnare un’inversione di tendenza rispetto ai modi e alle pratiche di trasformazione urbana che nei primi anni della transizione all’economia di mercato hanno contribuito ad alterare l’immagine com­ plessiva della mia città, e in particolare della sua area storica. In questi anni la città ha perso molti dei suoi spazi pubblici e delle sue DUHHYHUGLHSLLQJHQHUDOHKDULGRWWRODTXDOLWjXUEDQDFKHQHKD sempre caratterizzata l’immagine complessiva, comune a tante città adriatiche marinare, aperte, amichevoli, confortevoli. Oggi il nostro interesse e il nostro impegno sono di far tornare il tema della qualità e della vivibilità urbana al centro dell’interesse dell’ azione amministrativa, a vantaggio tanto dei suoi abitanti, che dei suoi visitatori e dei soggetti portatori di interesse. L’ipotesi generale che muove l’impegno della mia Amministrazione è DQFKHGLULVWDELOLUHXQQXRYROHJDPHFRQODVWRULDXUEDQDGL'XUD]]R riavviando un’opera di rivitalizzazione e recupero del considerevole patrimonio culturale di cui ancora la mia città è dotata. 'XUD]]RqODFLWWjFKHSRVVLHGHOHYHVWLJLDGLXQRGHLSLJUDQGLDQ¿WH­ atri romani dei Balcani, le mura ancora integre della cittadella bizantina e ottomana, un importante Museo archeologico, un esteso patrimonio di tracce e monumenti delle molte epoche che ne hanno segnato il FDPPLQR9RJOLDPRGXQTXHEDVDUHLOQRVWURLPSHJQRVXOODFRQGLYL­ sione di una visione al futuro della città, che non nega la possibilità di nuovi linguaggi dell’architettura, anche all’interno della città storica, ma è tuttavia fortemente orientata verso la sostenibilità ambientale e culturale dello sviluppo, anche in relazione alle nuove opportunità del turismo culturale, e dal punto di vista del miglioramento complessivo della qualità della vita dei suoi abitanti. La riprogettazione della Piazza Centrale della città – piazza Liria – cuore da sempre della città, spazio identitario e simbolico della sua co­ munità, principale luogo pubblico e della vita collettiva, costituisce una eccezionale occasione per consolidare un processo avviato e destinato a dare vigore e qualità all’intero organismo urbano e metropolitano. E’ DQFKHDWWUDYHUVRTXHVWDDWWLYLWjFKHOD&LWWjGL'XUD]]RYXROHFRPXQL­ care la sua nuova immagine di città in movimento, attiva e innovatrice, e assieme a ciò attenta ai valori del passato, della sua storia e delle sue memorie, orientata alla sostenibilità e alla qualità complessiva del suo sviluppo. E’ rispetto a tutto ciò che la città si è rimessa in moto, e intende mante­ nersi attiva e vitale. Perchè, come dice un recente motto che abbiamo VFHOWRSHUFDUDWWHUL]]DUHODQRVWUDDWWLYLWj³'XUD]]RQRQVLIHUPDPDL 9 Massimo Luciani )RUXPRI$GULDWLFDQG,RQLDQ&LWLHV Forum delle Città dell’Adriatico e dello Ionio ,O)RUXPGHOOH&LWWjGHOO¶$GULDWLFRHGHOOR,RQLRKDSDWURFLQDWR con grande condivisione il Concorso internazionale Piazza Liria GL'XUD]]R,O)RUXPGDDQQLqLPSHJQDWRQHOODFRVWUX]LRQH di relazioni, progetti ed eventi nel Bacino Adriatico­Ionico per lo sviluppo economico e sociale della Regione attraverso il confronto, il dialogo, la collaborazione e il consolidamento della UHWHGHOOHFLWWj$GLHFLDQQLGDOODVXDIRQGD]LRQHLO)RUXPVL trova di fronteuna realtà profondamente diversa. In questo decennio la Regione Adriatico­Ionica ha costruito i suoi assetti politici in una nuova cultura di pace che ha portato stabilita, democrazia e benessere. Sono nati nuovi organismi transna­ zionali che contribuiscono a consolidare la cooperazione e il confronto regionale. L’istituzione della Iniziativa Adriatico Ionica rappresenta l’elemento centrale di questa visione, supportata anche dalla formazione della Euroregione Adriatica. La sussidiarieta è la base della democrazia e della gover­ QDQFHHLO)RUXPGHOOH&LWWjGHOO¶$GULDWLFRHGHOOR,RQLRFUHGH fermamente nella collaborazione e nel dialogo permanente anche alla luce della nuova centralita che la UE sta dando alle strategie macroregionali. Questa iniziativa consolida i rapporti di collaborazione con le altre reti per favorire integrazioni e sinergie da utilizzare anche SHUO¶DFFHVVRDOOHRSSRUWXQLWjGL¿QDQ]LDPHQWRGHOO¶8QLRQH Europea, della Banca Mondiale e delle Agenzie delle Nazioni 8QLWH/D&LWWjGL'XUD]]RLQTXHVWLXOWLPLDQQLDOOD3UHVL­ denza della nostra Associazione, si è distinta per capacita di apertura e d’ impegno nella direzione della costruzione della comunita adriatica. La scelta di un concorso internazionale coglie l’importanza della valorizzazione delle risorse culturali, ambientali e paesag­ JLVWLFKHGL'XUD]]RHVLFRQLXJDFRQODYRORQWjGLFRQWUDVWDUH la speculazione e promuovere un programma armonico e coordinato di valorizzazione e promozione del proprio territorio. )DUFUHVFHUHODFRVFLHQ]DGHOO¶LPSRUWDQ]DGHOODSUHYHQ]LRQH dei rischi, della tutela dell’ambiente, promuovere una politica di sviluppo sostenibile, sono queste le fondamenta che garanti­ ranno un futuro alle prossime generazioni. Le città sono i luoghi del nostro tempo dove si producono lo sviluppo, la conoscenza e le relazioni. La qualità dello spazio pubblico urbano fa differenza nella competizione per attrarre nuove opportunita. La volonta di recuperare nel Progetto il rapporto con gli elementi storici ed archeologici, come le Terme 5RPDQHHLO)RURG¶HWj%L]DQWLQDqGLSDUWLFRODUHULOLHYRSHUOD YDORUL]]D]LRQHFXOWXUDOHGL'XUD]]RHSHUODVWHVVDULVFRSHUWD delle testimonianze storiche che legano le città dell’Adriatico con segni e monumenti appartenenti alla stessa matrice iden­ titaria.La rinascita di Piazza Liria produce anche una ricon­ nessione di elementi che fanno vivere nello spazio comune la società multiculturale e multireligiosa che oggi convive nella Città. I lavori che in questa pubblicazione sono presentati col­ JRQRTXHVWLLQGLUL]]LHSURLHWWDQR'XUD]]RLQXQDGLPHQVLRQHGL SLDOWDTXDOLWjXUEDQDODV¿GDSHUOHQXRYHFODVVLGLULJHQWLq quella di tenere la rotta indicata senza farsi condizionare dalle logiche speculative che potrebbero avere una forza dirompente in un contesto civile gracile e ancora in fase di consolidamento e formazione. 10 Beatrice Fumarola ,1$5&+1DWLRQDO,QVWLWXWHRI$UFKLWHFWXUH Istituto Nazionale di Architettura $'XUD]]RSULQFLSDOHSRUWRGHOO¶$OEDQLD3RUWDGHL%DOFDQL per il costituendo Corridoio Pana europeo 8, seconda città per numero di abitanti e testata territoriale di una estesa area PHWURSROLWDQDFKHFRPSUHQGHODFDSLWDOHGHOODQD]LRQH7LUDQD importante centro di servizi e di turismo balneare, potenziale meta di interesse culturale e archeologico­ il Concorso Interna­ zionale per la rivitalizzazione della Piazza Centrale nasce con l’esplicita intenzione della Amministrazione locale di “prosegui­ UHHUDIIRU]DUHXQ¶DWWLYLWjGLULTXDOL¿FD]LRQHHUHFXSHURXUEDQR della città rafforzata dall’approvazione del nuovo Piano per l’area centrale, avviata anche grazie anche alla cooperazione di numerosi organismi internazionali (Unione Europea, World Bank, Cooperazione Italiana allo Sviluppo, MAE), e all’attività GLVXSSRUWRHGLULFHUFDVFLHQWL¿FDLQFDPSRDUFKHRORJLFRH urbanistico di alcune Università Italiane” Ci sembra importante osservare come tutto ciò cambi un panorama precedente che aveva visto la città interessata da tumultuosi processi di di trasformazione urbana che, nei primi anni della transizione all’economia di mercato, avevano contribuito ad alterare l’immagine complessiva della città, e in particolare della sua area storica, comportando una riduzione degli standard e in generale della qualità e vivbilità urbana. Che tale azione possa essere basata “sulla condivisione di una visione al futuro della città, che non nega la possibilità e la sperimentazione di nuovi linguaggi dell’architettura, anche all’interno della città storica, ma è tuttavia fortemente orientata verso la sostenibilità ambientale e culturale dello sviluppo (...) nell’ottica del miglioramento complessivo della qualità della vita dei suoi abitanti”, è la scommessa che l’amministrazione locale GHOODFLWWjVWDDIIURQWDQGRHDFXL,1$5&+DQFKHDWWUDYHUVRLO patrocinio e la collaborazione data all’organizzazione di questo importante Concorso internazionale, vuole dimostrare tutta la tua condivisione e il suo appoggio. 11 Below: Gadget of Competition: bookmark/Materiali del Concorso: segnalibro Thanks/ Ringraziamenti 7KLVFRPSHWLWLRQLVERUQRIWKHLQLWLDOSURSRVDORIWKHQHZ0DVWHU3ODQIRUWKH2OG7RZQRI'XUUHVUHFHQWO\DSSURYHGE\WKHFRPSHWHQW Albanian authorities last October 26, 2007, readily accepted by Major of the city, and by numerous other Albanians and Italian institutions. 7KHEULHIRI&RPSHWLWLRQDQGWKHFROOHFWLRQRIVFLHQWL¿FGRFXPHQWDWLRQZDVWKHIUXLWRIDFROOHFWLYHZRUNZKLFKJDYHWKHLUXVHIXOFRQWULEXWLRQ many scholars Albanians and Italians, from national research institutions and academic. A special thanks goes to Sara Santoro, leader of WKH'XUUHV3URMHFW8QLYHUVLW\RI&KLHWL3HVFDUDWR$GULDQD*LXVWL3RO\WHFKQLFRI7RULQRWR$GULDQR&LDQL(PEDVV\RI,WDO\LQ7LUDQDWR 6HUPHW%HJDGLUHFWRURI1DWLRQDO%XLOGLQJ$UFKLYH5HSXEOLFRI$OEDQLDWRJHWKHUZLWKWKHSHUVRQDOLW\RIWKH0XQLFLSDOLW\RI'XUUHVDQGWKH 3URMHFWV2I¿FHIRUWKH2OG7RZQRI'XUUHVWKDWZLWKWKLVFRPSHWLWLRQLQDXJXUDWHVLWVDFWLYLWLHV $VWURQJWKDQNWRDOOWR0DULQ(GL9LNWRU/XFD$ODLQ-HDQ5RFFR$OEHUWRDSDUWLFXODUO\VWURQJWKDQNVWR,QD ;KDNRQLSUHFLRXVDQGYDOXDEOHFROODERUDWRURIVFLHQWL¿FWHFKQLFDOVHFUHWDULDWRIWKH&RPSHWLWLRQDQGDW%HDWULFH3LHWUR,VLGD0DULD)UDQ­ FHVFD$QWRQHOOD0LFKHODZLWKRXWZKRVHKHOSWKLVZRXOGKDYHQHYHUUHDOL]HG$VSHFLDOWKDQNVWRWKH0DMRURIWKHFLW\9DQJMXVK'DNR WKDWEHOLHYHGLQWKLVDGYHQWXUHUHVLVWLQJWRWKHVLUHQRIWKHDUFKLVWDUV\VWHPDVWURQJKXJWRWKH'HSX\0DMRU$GULDQ&HODP\SUHFLRXV IULHQG$QRWKHUVWHSZDVWDNHQLQWKHQHZXUEDQVHDVRQRIWKH'XUUHVFLW\ 35  Questo concorso è nato dalla proposta iniziale del nuovo Piano Urbanistico Integrato per la Città vecchia di Durazzo, recentemente appro­ vato dalle competenti autorità albanesi lo scorso 26 ottobre 2007, e prontamente accolta dal nuovo Sindaco della città Vangjush Dako, e GDQXPHURVHDOWUHLVWLWX]LRQLDOEDQHVLHLWDOLDQHFKH¿JXUDQRWUDLVRJJHWWLSDWURFLQDQWLO¶LQL]LDWLYD/DUHGD]LRQHGHO%DQGRHODUDFFROWDGHOOD GRFXPHQWD]LRQHVFLHQWL¿FDGLJDUDqVWDWDLOIUXWWRGLXQODYRURFROOHWWLYRDFXLKDQQRGDWRLOORURXWLOHDSSRUWRQXPHURVLVWXGLRVLDOEDQHVLH italiani, provenienti da istituzioni di ricerca nazionali e accademiche. Uno speciale ringraziamento va in particolare a Sara Santoro, diretto­ re della Missione Archeologica Italiana a Durazzo, Università di Chieti e Pescara, ad Adriana Giusti, Politecnico di Torino, ad Adriano Ciani, Ambasciata d’Italia a Tirana, e a Sermet Bega, direttore dell’Archivio delle Costruzioni di Tirana, assieme alle personalità del Comune e GHOO¶8I¿FLR6SHFLDOH3URJHWWLSHUOD&LWWj9HFFKLDGL'XUD]]RFKHFRQTXHVWRFRQFRUVRLQDXJXUDODVXDDWWLYLWj Un ringraziamento speciale è indirizzato a Marin, Edi, Viktor, Luca, Alain, Jean, Rocco, Alberto, e in particolare ad Ina Xhakoni, valida e SUH]LRVDFROODERUDWULFHGHOOD6HJUHWHULD7HFQLFR6FLHQWL¿FDGHO&RQFRUVRHDQFRUDD%HDWULFH3LHWUR,VLGD0DULD)UDQFHVFD$QWRQHOOD 0LFKDHODVHQ]DLOFXLDLXWRQLHQWHVDUHEEHVWDWRUHDOL]]DWR8QULQJUD]LDPHQWRLQ¿QHGHOWXWWRSDUWLFRODUHYDDO6LQGDFRGHOODFLWWj9DQ­ gjush Dako, che ha creduto a questa avventura, resistendo alle sirene dell’ Archi star system internazionale, e a Adrian Cela, vice sindaco della città, e mio prezioso amico. Un altro passo è stato forse compiuto nella nuova stagione urbana della città di Durazzo (P. R.) 12 Jury composition/Giuria Vangjush Dako0DMRURI'XUUHVSindaco di Durazzo +RQRUDU\&KDLUPDQRI-XU\Presidente onorario della Giuria Arch. Luca Zevi, ,1$5&+ ,VWLWXWR1D]LRQDOHGL$UFKLWHWWXUD5RPD ,WDOLD National Institute of Architecture), Roma (Italy) Arch. Alain Cousseran, $UFKLWHWWRGLSDHVDJJLR3DULJL )UDQFLD Landscape architect, Paris (France) Alberto Monti, Archeologo, Università di Parma, Italia/ Archaeologist, University of Parma, Italy Arch. Rocco Maragna, Architetto di paesaggio e urbanista, Toronto (Canada)/ Landscape architect and urban designer, Toronto (Canada) Eduard Muka, Artista, Accademia delle Belle Arti, Tirana (Albania)/ Artist, Academy of Visual Art, Tirana (Albania) Viktor Dhimiqi, $UFKLWHWWR$VVRFLD]LRQHGHJOL$UFKLWHWWLGL'XUD]]Rarchitect, Durres Architect Association Marin Biçoku, 'LSDUWLPHQWRGHOOH3ROLWLFKH8UEDQH0LQLVWHURGHL/DYRUL3XEEOLFL7UDVSRUWRH7HOHFRPPXQLFD]LRQL 0/377 $OEDQLD Department of Policies and Urban Plannig, Ministry of Public Work, Transport and Telecommunication (MPWTT), Albania 7HFKQLFDODQG6FLHQWLÀF&RPPLWWHH&RPPLVVLRQH7HFQLFR6FLHQWL¿FD Ing. Adrian Cela 9LFHVLQGDFRGL'XUD]]RDepuy major of Municipality of Durres (Albania) Arch. Ina Xhakoni, 0XQLFLSLRGL'XUD]]R $OEDQLD Municipality of Durres (Albania) Prof. Piero Rovigatti, Università di Chieti e Pescara, Italia/ University of Chieti and Pescara, Italy 13 Durazzo, foto aerea, IGM, 1928/ Durres, aerial photo, source: IGM 1928 1 7KHÀUVWSKDVHRIFRPSHWLWLRQ Conditions and demand for intervention/ La prima fase del concorso. Condizioni e domanda di intervento 'XUUHVDHULDOSKRWRDurazzo, foto aerea, 2005. In rosso: localizzazione di piazza Liria 1.1 Why a competition for the central square of Duress/ Perché un concorso per la Piazza Centrale di Durazzo The selection of the central square of the city – Iliria Square/ )UHHGRPVTXDUHDVPDWWHURIWKHFRPSHWLWLRQFRPHVIURP the role and the importance of the place, from its relation with the interventions of urban revitalization carried out by local administrations, but especially from the complexity and exemplariness of the themes that this urban site presents. All the themes that may be found in the city are there in the square. So, the plan of the square represents an extraordinary chance to put into opportunities and exemplary actions these themes, to try out innovative solutions respecting the fundamental urban values of the city, addressed towards the new and symbolic demands looking forward to a reply from the project. Until now lots of these themes have been obstacles or impediments to development. The presence of important archaeological monuments, often emerged during the construction of new residential buildings, or even of some important urban facilities­ as Roman Baths risen during the construction of the new Pa­ ODFHRI&XOWXUHRURIWKHUHPDUNDEOH)RURRIWKH%\]DQWLQH age­ has been considered until now a reason of risk for the pursuit of speculation rather than an opportunity to increase the culture and the economy of the city. The presence of collective functions typical of a main space, replaced urban practices in a residential area. Because of the large number of cars in the town­ a new city life matter in DQHPHUJHQWFRXQWU\QRZDGD\VWKHUHLVDFRQÀLFWEHWZHHQ SHGHVWULDQDQGFDUWUDI¿FLQWKLVDUHD Moreover the square represents inevitably a space of functional and symbolic representation of a multicultural and multireligious society in which there are traces of a rich and complex past and present that is an expression of a various and well­organised community both in life styles and in individual and collective behaviours. The main task of competitors is treating these themes, DSSDUHQWO\FRQÀLFWXDODQGLPDJLQJLQQHZWHUPVDSODFHLQ which the expectations of the local and outer community are really strong for the importance of the place itself and for the meaning that Iliria square has always had towards the city. La scelta del sito della Piazza centrale della città – piazza Liria/piazza della Libertà – come tema di concorso d’archi­ tettura deriva dal ruolo e dall’importanza del luogo, dalla sua relazione con gli interventi di rivitalizzazione urbana realizzati RPHVVLLQHVVHUHGDOOH$PPLQLVWUD]LRQLORFDOLSLUHFHQWL ma anche e soprattutto dalla complessità e esemplarità dei temi che tale sito urbano mette sul tappeto. Tutti i temi che SUHVLHGRQRDGRJQLLQWHUYHQWR¿VLFRFRQWHPSRUDQHRQHOODFLWWj sono presenti nella Piazza. Il progetto della Piazza costituisce dunque una formidabile occasione per tradurre in opportu­ nità e azioni esemplari tali temi, per sperimentare soluzioni innovative nel rispetto dei valori urbani fondamentali della città, declinati verso le nuove domande d’uso e simboliche che attendono oggi risposta dal progetto. Molti di questi temi VRQRVWDWLYLVVXWL¿QRDGRJJLFRPHYLQFROLRLPSHGLPHQWR allo sviluppo. La presenza di rilevanti monumenti archeologici, VSHVVRDI¿RUDWLQHOFRUVRGHOODFRVWUX]LRQHGLQXRYLHGL¿FL residenziali, o anche di importanti attrezzature urbane – è il FDVRGHOOH7HUPH5RPDQHDI¿RUDWHQHOFRUVRGHOODFRVWUX]LRQH del nuovo Palazzo della Cultura, o dello stesso, notevole, )RURG¶HWj%L]DQWLQDqVWDWD¿QRDGRUDFRQVLGHUDWRFRPH motivo di rischio rispetto al perseguimento di obiettivi di natura spesso speculativa, piuttosto che un’occasione per la valorizzazione culturale e dunque economica della città. La presenza di funzioni collettive, proprie di uno spazio centrale, VLqVRYUDSSRVWDDJOLXVLSLSURSULDPHQWHXUEDQLHGLTXDU­ tiere, di una zona comunque ad elevata densità residenziale. /DFUHVFLWDGHOWUDI¿FRXUEDQRHORVYLOXSSRGHOODPRELOLWj privata in città – esperienza relativamente nuova in un paese GLUHFHQWHWUDQVL]LRQH±FRQÀLJJHRJJLFRQXQXVRSHGRQDOHH tradizionalmente lento di questo tradizionale spazio pubblico urbano. Una condizione d’uso che tende, peraltro, ad assu­ mere sempre maggiore rilevanza con la scoperta della città da parte del turismo nazionale e internazionale e la crescita dei visitatori e delle presenze. A tali temi può ancora essere aggiunto quello che deriva dalla condizione di una piazza che è inevitabilmente spazio di rappresentazione funzionale e sim­ bolica di una societas multiculturale, oltreché multi religiosa, dove si affacciano le tracce di un passato e di un presente ricco e complesso, espressione di una comunità varia e arti­ colata, tanto negli stili di vita che nei comportamenti individuali e collettivi. Come svolgere assieme questi temi, in apparenza FRQÀLWWXDOLqLOFRPSLWRSULQFLSDOHFKHDWWHQGHDLSDUWHFLSDQWL al concorso, oltre a quello di immaginare in termini nuovi uno spazio su cui è forte l’attesa della comunità locale ed esterna, proprio per il valore del luogo in se e per il senso che Piazza Liria ha sempre avuto nei confronti della città. 17 'XUUHVSRVWFDUGHDUO\;;VHF Souvenir d’Albania, Durazzo, cartolina postale di inizio secolo (s.d.) The city after the earthquake of 1926 / La città dopo il terremoto del 1926 The main urban street after the earthquake of 1926 / Il corso urbano principale dopo il terremoto del 1926 The mail urban street after the rebuiling post eartquake / Il corso urbano dopo le ricostruzioni post terremoto, (s.d.) 18 1.2 Site and context description/ Descrizione del sito e del contesto +LVWRULFDOUHFRUGV A short historical description of the square will be useful to highlight the themes and the reasons for the project.The square as a public VSDFHZKLFKLVDZHVWHUQLGHDXQNQRZQWRDFLW\ZLWKD¿YHFHQWXULHV eastern identity, due to the long Ottoman domination, arises at the VDPHWLPHDVWKH¿UVWXUEDQGHPROLWLRQVWKDWDQQRXQFHVWKHPRGHUQ plan of the city –attested by the town planning which was designed by the Italian architect Leone Carmignani in 1942, after the disastrous earthquake in 1926.The new square occupies to a large extent, a past operating condition, the small widening situated just to the outside of the Ottoman walls perimeter, in a north position, (the Ottoman walls were a further reduction of the Byzantine walls perimeter, that was VPDOOHUWKDQWKH5RPDQDQG+HOOHQLVWLFSUHH[LVWHQWZDOOV 7KHUHVXOW is a really large space, without buildings, that soon becomes the meeting place of the new urban main street, the existing trading route, and that will hold the new shops as a replacement for the old structu­ res (the two traditional Bazaar) collapsed after the earthquake. In the past, as represents one of the few maps previous to the Italian survey DIWHUWKHHDUWKTXDNH /+HX]H\+'DXPHW$UFKDHORJLFDO Mission of Macedonia, Paris 1876), the square was a very large area ZLWKRXWEXLOGLQJVEHWZHHQWKHIRUWL¿HGYLOODJHLQWKH2WWRPDQZDOOV and the Turkish castle, built above the previous Byzantine and maybe FODVVLFDOIRUWL¿FDWLRQV7KHVTXDUHZDVLQIURQWRIWKH%LJ*DWHRQH of the main gates of a defensive system that the map still represents in the beginning of the XIX century. After the 1926 earthquake there was a boom of new streets and buildings that changed the Ottoman structure according to the past urban rules and to a plan of streets forming urban blocks that ignore the previous geometries and town la­ yout.In the surrounding of the square, attentively analysed by the town planning through some projects of open space setting and architec­ WXUDOGH¿QLWLRQRIWKHPDLQEXLOGLQJVVXFKDVWKH0RVTXHDQDUFDGH DURXQGWKH:HVWHUQVLGHRIWKHVTXDUHWKHSRVWRI¿FHWKHVHDWRIWKH 6WRFN([FKDQJHQHYHUFDUULHGRXWULVHWKH¿UVWFROOHFWLYHVWUXFWXUHV that will characterize the new square as a central place of the city. The Mosque designed by Leone Carmignani comes alongside the pre­ existent town hall, an Italian project of the beginning of the Thirties, nowadays the Municipal administration seat.Later, in the Communist age, in the north­eastern side of the square, rise the Palace of the Party (nowadays the Palace of the Prefecture) and the Palace of Cenni storici 8QDYHORFHVWRULDGHOODSLD]]DqLQJUDGRSLGL ogni altra descrizione di mettere in luce i temi e i motivi di interesse che attendono di essere oggi interpretati dal progetto. L’invenzione della Piazza, come invenzione di uno spazio pubblico di matrice occidentale, inedi­ to in una città che per oltre cinque secoli mantie­ ne un carattere sostanzialmente orientale, frutto di una lunga dominazione ottomana, avviene in contemporanea ai primi lavori di sventramento urbano che anticipano il nuovo disegno moderno della città – consacrato dal Piano Regolatore Ge­ nerale dell’architetto italiano Leone Carmignani, nel 1942 – e che si trova a dare ragione dei primi interventi di riorganizzazione urbana della città realizzati dopo il disastroso terremoto del 1926. La nuova Piazza si trova così ad occupare, esten­ dendolo a dismisura, almeno per le normali condi­ zioni operative del tempo, il piccolo slargo posto appena al di fuori del perimetro delle mura otto­ mane,– un ulteriore restringimento del perimetro GLPXUDEL]DQWLQHJLjSLVWUHWWRGHOOHSUHHVLVWHQWL mura d’età romana ed ellenistica – a nord. Si crea così uno spazio di notevoli dimensioni, QRQGH¿QLWRGDHGL¿FLFKHSUHVWRGLYHQWDLOSXQWR GLFRQÀXHQ]DGHOQXRYRFRUVRXUEDQRO¶DWWXDOH via del Commercio, su cui si affacceranno le nuove botteghe in sostituzione delle vecchie costruzioni che componevano i due tradizionali Bazar, crollate grazie al sisma. In passato, infatti, il sito della Piazza si caratterizzava, nella rappre­ sentazione di una delle poche mappe precedenti ai rilievi italiani del posto terremoto del ’26, (L. +HX]H\+'DXPHW$UFKHRORJLFDO0LVVLRQRI macedonai, Paris, 1876), come un’ampia aerea LQHGL¿FDWDDQWLVWDQWHLOERUJRIRUWL¿FDWRVWUHWWR nelle mura ottomane, e il castello turco soprastan­ WHHUHWWRVXOODEDVHGLSUHFHGHQWLIRUWL¿FD]LRQL bizantine e forse classiche, davanti ad una delle porte principali (La Grande Porta) di un sistema difensivo che la mappa rivela ancora perfetta­ mente in piedi alle soglie del XIX secolo. $OODGHPROL]LRQHGHJOLHGL¿FLGDQQHJJLDWLGDO sisma del ’26 fa dunque seguito lo sviluppo di QXRYHVWUDGHHGLQXRYLHGL¿FLFKHWHQGRQRDWUD­ sformare il tessuto ottomano della città secondo i 19 On the top: The square before the costruction of the mosque/ In alto: veduta della piazza Liria prima della costruzione della moschea Above: he Big Mosque turned into a cultural centre during the communist age/ In basso: la Grande Moschea convertita in un centro culturale durante il periodo comunista 20 crismi dell’urbanistica razionale del tempo, secondo un disegno di strade che articolano tale tessuto in isolati urbani, incuranti delle geometrie e degli assetti precedenti. Attorno alla piazza, cui il nuovo Piano Regolatore dedica una attenzione particolare, con ben calibrati progetti di sistema­ ]LRQHGHOORVSD]LRDSHUWRTXDQWRGLGH¿QL]LRQH DUFKLWHWWRQLFDGHLQXRYLHGL¿FLSLUDSSUHVHQWDWLYL – un portico che cinge tutta la piazza sul lato occi­ GHQWDOHODSUHYLVLRQHGHOO¶8I¿FLR3RVWDOHODVHGH della Borsa, tutti peraltro mai realizzati – sono già VRUWLLSULPLHGL¿FLFROOHWWLYLFKHFDUDWWHUL]]HUDQQR la nuova piazza come luogo centrale della città: tra questi la moschea, e il preesistente Palazzo Comunale, ancora oggi sede dell’Amministra­ zione comunale, realizzato su progetto italiano all’inizio degli anni ’30. Successivamente, in piena età comunista, sorgeranno ancora, sul versante Nord Orientale, il Palazzo del Partito (ora Palazzo della Prefet­ tura), e il nuovo Palazzo della Cultura, sul fronte 1RUGGHOOD3LD]]D$OFXQLHGL¿FLSUHHVLVWHQWL conosceranno durante gli anni del Regime alcune trasformazioni. Singolare, tra questi, la sorte della moschea, trasformata in Centro Culturale da un intervento che opera, nel 1967, ben poche demo­ lizioni (il minareto), e camuffa la cupola originaria, senza alterarla all’interno, attraverso elementi di facciata che verranno poi demoliti, quando verso LO¿QLUHGHOUHJLPHO¶HGL¿FLRYHUUjULFRQGRWWRDOOH sue funzioni originarie di luogo di culto, dopo i danneggiamenti parziali del terremoto del 1979, e grazie all’aiuto di fondi egiziani (1993). Gli interventi di demolizione e ricostruzione, in tutti questi anni, svelano anche le tracce di anti­ che rovine e di antichi assetti urbani. Condizione QRUPDOHTXHVWDLQXQDFLWWjFKHVLqSLYROWH costruita e ricostruita su se stessa, dopo terremoti HPDUHPRWLFDWDVWUR¿FL7UDTXHVWHWUDFFHOHSL rilevanti sono quelle relative al ritrovamento di un’antica basilica Paleocristiana, i cui resti appa­ iono proprio in corrispondenza della costruzione GHOODQXRYDPRVFKHDODVFRSHUWDGHOOH7HUPH Romane, nei lavori di fondamenta del nuovo Pa­ OD]]RGHOOD&XOWXUDHORVSOHQGLGR)RUR%L]DQWLQR DQFRUDLQUHOD]LRQHDOODVWHVVDFRVWUX]LRQH'LOuD poco, alla metà degli anni ’60, poco distante dalla SLD]]DDI¿RUDLQFLUFRVWDQ]HIRUWXLWHLOJUDQGH DQ¿WHDWURURPDQRXQRGHLSLJUDQGLGLWXWWLL Balcani, l’unico rinvenuto in Albania, su cui da subito si concentrano le attenzioni degli archeolo­ JLDOEDQHVLHO¶LQWHUHVVHGHOODFRPXQLWjVFLHQWL¿FD LQWHUQD]LRQDOH6XO¿QLUHGHJOLDQQL¶QHOOXQJR declino del regime, il quadro della Piazza è ora LQJUDQSDUWHGH¿QLWR3RFKLLQWHUYHQWLGH¿QLUDQQR alcuni sostanziali cambiamenti sul fronte occi­ dentale, anche grazie al recupero della Moschea *UDQGHHSRFRSLVXSHUODFRVWUX]LRQHGHOOD VHGHGHOOD3UHIHWWXUDXQJUDQGHHGL¿FLRLQVWLOH UD]LRQDOLVWDFKHSUHQGHUjLOSRVWRVXO¿QLUHGHJOL Culture in the northern side.Some pre­existent buildings change du­ ring the years of the regime, such as the Mosque turned into a cultural centre in 1967 thanks to few demolitions (the Minaret) and the camou­ ÀDJHRIWKHRULJLQDOGRPHZLWKRXWDQ\LQQHUDOWHUDWLRQVWKURXJKVRPH façade components later demolished at the end of the communist regime and after the 1979 earthquake. The Mosque recovers in this way its original function as a religious place even thanks to Egyptian funds (1993). 'XULQJDOOWKHVH\HDUVWKHLQWHUYHQWLRQVRIGHPROLWLRQDQGUHFRQ­ struction have brought to light the traces of ancient ruins and town OD\RXW7KHPRVWLPSRUWDQWDPRQJWKHPDUHWKRVHDERXWWKH¿QGRI DQDQFLHQWHDUO\&KULVWLDQ%DVLOLFDLWVUHPDLQVDSSHDUSUHFLVHO\DW the time of the construction of the new Mosque and of the discovery of Roman Baths, during the foundation works for the new Palace RI&XOWXUHDQGLQWKHPDJQL¿FHQW%\]DQWLQH)RURVWLOOUHODWHGWRWKH same construction.Soon after, in the mid­sixties, appears by fortuitous events and not far from the square, the Great Roman Amphitheatre, one of the biggest in the Balkans, the only one in Albania, source of LQWHUHVWRIPDQ\$OEDQLDQDUFKDHRORJLVWVDQGRIWKHVFLHQWL¿FDQG international community.The description of the square is now largely GH¿QHG2QO\IHZLQWHUYHQWLRQVZLOOFKDQJHWKHZHVWHUQVLGHRIWKH square such as the recovery of the big Mosque and the construction RIWKHVHDWRI3UHIHFWXUHDELJHGL¿FHLQDUDWLRQDOLVWVW\OHWKDWDWWKH end of the eighties will replace the wide public garden which was in a position of slight slope between the Mosque and the area occupied in those years by the new Palace of Culture.These building interven­ tions characterize the surrounding of the square through the location of big and functional containers commonly used and consistent with the function and the symbolic and representative meaning of the main SXEOLFVSDFHRIWKHWRZQ'XULQJWKH\HDUVRIJURZWKDQGVSHFXODWLYH building development, a big tower used as house residences and RI¿FHVXSVHWVWKHGLPHQVLRQDODQGSURVSHFWLYHVFKHPHV XQWLOWKHQ controlled by the previous interventions) invading the space to the right of the town hall previously occupied by some modest buildings. The history of the square describes a space still incomplete especially in the eastern side, nevertheless rich in memories, stories and impor­ WDQWSUHVHQFHVLQWKHXUEDQDQGPRQXPHQWDO¿HOG$OOWKHPDLQXUEDQ IXQFWLRQVJLYHRQWRWKHVTXDUH±WKH7RZQ+DOOWKHELJ0RVTXHWKH Palace of Culture, the Prefecture­ and the most important historical PRQXPHQWVRIWKHFLW\DUHDSSUR[LPDWHO\LQFRQWDFWZLWKLWVXFKDVWKH mentioned great Roman Amphitheatre whose access is by a staircase WKDWVWDUWVIURPLWVRZQVRXWKZHVWHUQVXPPLWWKHUHPDLQVLQVLWXRI the Ottoman walls (it would be interesting the reconstruction of its Big Gate) that preceeded the Castle, no more there in the square (only IHZUHPDLQVWRWKHOHIWRIWKH7RZQ+DOONQRZQDVWKH&ORFNWRZHU  but that still has a monumental importance over the boundary of the VTXDUH$QGWKHQWKH%\]DQWLQH)RUREHKLQGWKH3DODFHRI&XOWXUH and on the other side, near to the port, along the actual main street, WKHROGWUDGLQJURXWHWKHUHDUHWKHDQFLHQW+DPPDQWKH%LJ9HQHWLDQ 7RZHUDQGWKHZDOOV±URPDQPD\EH+HOOHQLVWLFDQGWKHQ%\]DQWLQH anni ’80, dell’ampio giardino pubblico che occupa­ va lo spazio in leggero declivio tra la Moschea e l’area occupata in quegli anni dal nuovo Palazzo della Cultura. Si tratta di interventi edilizi che caratterizzano l’intorno della Piazza attraverso la collocazione di grandi contenitori funzionali di uso pubblico, coerenti con la funzione e il connotato simbolico e rappresentativo del principale spazio collettivo della città. Negli anni della crescita e dello sviluppo speculativo edilizio della città, una JUDQGHWRUUHSHUDELWD]LRQLHGXI¿FLVELODQFLDL UDSSRUWLGLPHQVLRQDOLHSURVSHWWLFL¿QRDGDOORUD sostanzialmente controllati dagli interventi rea­ lizzati, occupando lo spazio a destra della sede FRPXQDOHSUHFHGHQWHPHQWHRFFXSDWRGDHGL¿FL di modeste dimensioni. Ancora prima di questi interventi, sono numerose le nuove costruzioni che alterano in maniera spesso sostanziale l’intero skyline della città, pur interessando aree distanti dall’intorno della piazza, peraltro in palese contraddizione con una norma di tutela di livello QD]LRQDOHFKHULFRQRVFH'XUD]]RFRPH³FLWWjPX­ seo”, e buona parte del suo centro urbano come DUHDGLWRWDOHLQHGL¿FDELOLWj0ROWRUHFHQWHPHQWH la controversa e faticosa approvazione del nuovo 3LDQR8UEDQLVWLFR,QWHJUDWRSHUOD&LWWj9HFFKLD ristabilisce condizioni di certezza urbanistica e di tutela dell’area monumentale, ristabilendo normali condizioni di governo urbanistico dell’intera area centrale. La storia della Piazza ci consegna oggi uno spazio ancora incompiuto, soprattutto sul versante orientale, e tuttavia particolarmente denso di memorie e di storie, oltreché di pre­ senze di rilevanza urbana e monumentale. Tutte le funzioni urbane principali si affacciano sulla piazza – la Sede Municipale, la Moschea Grande, il Palazzo della Cultura, la Prefettura – e tutti i principali monumenti storici della città sono a diretto contatto con essa, o distano dalla piazza distanze assi modeste. È il caso del citato, gran­ GHDQ¿WHDWURURPDQRGDFXLVLDFFHGHSHUXQD scalinata che parte proprio dal suo vertice Sud RFFLGHQWDOHGLFLzFKHULPDQHin situ, delle mura ottomane che anticipano il Castello, a cui risale proprio seguendone il tracciato, scomparso sul lato della Piazza (ne restano solo poche tracce a sinistra del Palazzo Comunale, note come “la torre dell’orologio”), ma che poi riacquista FRQVLVWHQ]DPRQXPHQWDOHROWUHLOFRQ¿QHGHOOD SLD]]D(SRLDQFRUDLO)RUR%L]DQWLQRDOOHVSDOOH del Palazzo della Cultura, e dall’altra parte, verso il porto, lungo l’attuale corso principale, già via GHO&RPPHUFLRO¶DQWLFR+DPPDQODJUDQGH7RUUH 9HQH]LDQDHGLQXRYROHPXUD±JLjURPDQH forse ellenistiche, poi bizantine e ottomane, che FKLXGRQROD&LWWj9HFFKLDGLFXL3LD]]D/LULD costituisce oggi il cuore. La piazza appare oggi come un grande spazio, frammentato, denso e incompiuto, forse anche incompleto, rispetto alla necessità di funzioni che oggi si chiedono ad una grande piazza contemporanea. 21 'XUUHVSRVWFDUGHDUO\;;FHQWXU\ Durazzo, cartolina dei primi del secolo (s.d.) 'XUUHVSRVWFDUGHDUO\;;FHQWXU\VTXDUHYLHZ Durazzo, cartolina dei primi del secolo (s.d.), veduta della piazza/ 'XUUHVSRVWFDUGHDUO\;;FHQWXU\LQHYLGHQFH³.LQHPD*ORULD Durazzo, cartolina, in evidenza l’insegna del Kinema Gloria ³'XUD]]RSLD]]D0XQLFLSDOH´ VG Durres, post card, main square. 22 and Ottoman that enclose the old town whose heart is Iliria Square. Nowadays the square appears as a great space, fragmented, dense and incomplete, compared to the need of functions today required to a large contemporary square: a space designed by history, through a non­linear course, which is waiting for a new project able to increase the value of past identities, through the creative invention of a new image and of a new urban landscape. The square represented in a map after the earthquake of 1926 (T. Papa)/ /D3LD]]DGRSRLOWHUUHPRWRGHO HODERUD]LRQHJUD¿FD73DSD The square represented in a map after the earthquake of 1926 (T. Papa)/ /D3LD]]DGRSRLOWHUUHPRWRGHO HODERUD]LRQHJUD¿FD73DSD 23 1.3 Environmental, ecological and landscape conditions/ Condizioni ambientali, ecologiche e di paesaggio The area is almost level, apart from the western side, in slight slow. In fact in this point there is a climb of the hilly front that leads to the KLJKHUDOWLWXGHSDUWRIWKH3URPRQWRU\RI'XUUHVWKDWLQWKHQRUWKHUQ side has higher levels. This side is characterized by a thin vegetation composed of typical local essences, characteristics of the Mediterranean landscape. The square has also in its inner side a sparse planting. The edges of streets are decked out with privets and ilexes and other vegetal arboreal and endemic species. In the surrounding of the Palace of Culture there is a vegetation com­ posed of ornamental hedges (laurels, butter­bushes, privets and other essences)and some forest trees (mainly ilexes).The square is divided in two parts by a wide space shaded by some high cedars of Leba­ non, in good vegetative conditions. Thanks to its vegetal heritage, the square has also a potential role of ecological reconnection between the hilly slopes, in the east, and the areas that occupy the alluvial plain, as far as the harbour basin and the coastal trip, occupied in the SDVWE\DÀRULGSLQHIRUHVWWKDWVKRXOGEHUHYLYH L’area si presenta sostanzialmente in piano, tranne che per il suo lato occidentale, in leggero GHFOLYLR'DWDOHERUGRSDUWHLQIDWWLODULVDOLWD del fronte collinare che poi conduce alla quota PDJJLRUHSDUWHGHO3URPRQWRULR'XUD]]LDQR che presenta quote maggiori nello sviluppo del sistema collinare a Nord. Tale fronte si caratte­ rizza per la presenza di una discreta copertura vegetale, formata da essenze tipiche del luogo, caratteristiche del paesaggio costiero mediterra­ neo. La piazza presenta anche al suo interno una modesta copertura arborea. I bordi delle strade VRQRRUQDWLGD¿ODULGLOLJXVWULHGDOHFFLHGDDOWUH specie vegetali arboree endemiche. Attorno al Palazzo della Cultura è presente una vegetazione fatta di siepi ornamentali (allori, pitosfori, ligustri, altre essenze) e alcuni alberi ad alto fusto (in prevalenza lecci). La Piazza e’ inoltre suddivisa in due da un ampio spazio ombreggiato da alcuni alti cedri del Libano, in buone condizioni vegeta­ tive. In relazione al proprio patrimonio vegetale, la piazza svolge anche un potenziale ruolo di riconnessione ecologica tra le pendici collinari su cui risale la città, verso est, e i quartieri che RFFXSDQRODSLDQDDOOXYLRQDOH¿QRDOEDFLQR portuale e alla fascia costiera, un tempo occupata GDXQDÀRULGDSLQHWDFKHPHULWHUHEEHGLHVVHUH in qualche modo ripristinata. Aerial views, 2005/ Foto aeree, 2005 Aerial view, IGM 1928/ Foto aerea, IGM, 1928 Up: Central area, aerial view, 1918 Sopra: area centrale, foto aerea, 1918 On the right: Central area, aerial view, 2005/ A destra: area centrale, foto aerea, 2005/ 1.4 Historical and cultural heritage/ Eredità storiche e culturali Classic Age 7KHFLW\RI'XUUHVKDVVHYHUDOZLWQHVVWRWKH&ODVVLFDJH7KHPRVW important among them are the mentioned Roman Amphitheatre, the 2WWRPDQ9HQHWLDQ%\]DQWLQH5RPDQDQG+HOOHQLVWLF:DOOV7KHWRZQ even for the recent building activity, is always involved in important ar­ FKDHRORJLFDO¿QGV7KHVTXDUHSUHVHQWVODUJHWUDFHVRIWKLVKHULWDJH On the website of the Competition there are a lot of information about the monumental importance of this heritage, the current and potential XUEDQLPSRUWDQFHDQGWKHFXOWXUDODQGVFLHQWL¿FYDOXH7KHVHLQIRU­ mation derive from the considerable investigation work carried out by the Archaeological Italian Mission, University of Parma, represented in the Map of the Archaeological Risk of the Town and in the detailed provisions of preservation and enhancement introduced in the new Plan for the Central Area. All the materials about these investigation and normative instruments are available on the website of the Competition. Byzantine and Ottoman Age Even this historical period is well represented in the square. Behind WKH3DODFHRI&XOWXUHWKHUHLVWKHDQFLHQW0DFFHOOXP ,99,FHQWXU\ D& WKHWUDFHVRILWVFRORQQDGHRIPHWUHVUDGLXVDUHVWLOOWKHUHLW has been recently recovered and partly reconstructed with the founda­ WLRQVRIWKHUDGLDOVSDFHVXVHGLQWKHSDVWDVVKRSV7KHÀRRULQJ still present, is marble made, but the street around it and the new UHVLGHQWLDOEXLOGLQJVPDNHGLI¿FXOWWKHSHUFHSWLRQDQGWKHYLVLWRIWKH HGL¿FH7KH%\]DQWLQHZDOOVEHWZHHQWKH3DODFHRI&XOWXUHDQGWKH Roman Amphitheatre are the other important element of this period, even thanks to its current condition of decay and potential recovery, alongside with the area of the ancient Byzantine castle, whose towers are still preserved except one: this area is today invaded by buildings erected without planning permission on the promontory that goes up WRWKHWZHQWLHWK±FHQWXU\.LQJ=RJ¶V9LOOD Twentieth century heritage Iliria square has also some traces of the recent architectural history because of the works of Italian and Albanian architects in the 20’s. The Palace of the Municipality “Bashkia” was built in 1930. The buil­ ding is situated in the western side of the square and shows a three 26 Età classica /DFLWWjGL'XUD]]RSUHVHQWDQXPHURVHWHVWLPR­ nianze dell’età classica. Tra queste destano particolare attenzione i già FLWDWLDQ¿WHDWURURPDQRHLYDVWLWUDWWLGLPXUD ottomane, veneziane, bizantine, gia’ romane e HOOHQLVWLFKH/DFLWWjDQFKHLQUDJLRQHGHOODSL recente attività edilizia, e’ peraltro continuamente interessata da ritrovamenti di rilevante interesse archeologico. La piazza presenta vaste tracce di tale patrimonio. Sul sito del concorso sono presenti molte informazioni relative alla consi­ stenza monumentale di tale patrimonio, alla loro rilevanza urbana attuale e potenziale, nonché al VXRYDORUHFXOWXUDOHHVFLHQWL¿FR7DOLLQIRUPD]LRQL derivano dal considerevole lavoro di indagine svolto dalla Missione Archeologica Italiana dell’Università di Parma, tradotto nella Carta del 5LVFKLR$UFKHRORJLFRGHOOD&LWWjHQHOOHVSHFL¿FKH normative di tutela e valorizzazione introdotte nel nuovo Piano per l’Area Centrale. Tutti i materiali conoscitivi relativi a tali strumenti di indagine e normativi sono a disposizione dei concorrenti tramite il sito del Concorso. Età bizantina e ottomana Anche questo periodo storico è ben rappresenta­ WRQHOORVSD]LRGHOODSLD]]D'LHWURLO3DOD]]RGHOOD &XOWXUDqVLWXDWRLQIDWWLO¶DQWLFR0DFHOOXP ,99, sec d.C.), di cui permane tuttora la traccia del bel colonnato di raggio pari a 18 m, recentemente re­ staurato e in parte ricostruito, con le fondamenta degli ambienti radiali adibiti in passato a botteghe. La pavimentazione, oggi ancora presente, è in marmo, ma la permanenza della strada che lo ODPELVFHHGHLQXRYLHGL¿FLUHVLGHQ]LDOLDQFKHGL UHFHQWLVVLPDFRVWUX]LRQHUHQGRQRGLI¿FLOLODSHU­ FH]LRQHGHOO¶LQWHURHGL¿FLRHODVXDVWHVVDYLVLWD Il tratto di mura d’età bizantina che dall’attuale Palazzo Comunale risale quasi tangente all’An­ ¿WHDWURURPDQRqO¶DOWURHOHPHQWRGLLQWHUHVVHGL tale periodo che merita di essere ricordato, anche in relazione alla sua attuale condizione di degrado e di necessario recupero, assieme all’area dell’antico castello bizantino, di cui riman­ gono ancora, ben conservate, almeno tre delle $PSKLWHDWUHDQG%\]DQWLQH)RUXPDHULDOYLHZ L’Amphiteatro e il Foro Bizantino, foto aerea, 2005 9LHZRI$PSKLWHDWUR9HGXWDGHOO¶DQ¿WHDWUR 0DFHOOXP,99,FHQ%& /Macellum IV­VI sec. a.c 27 arches porch, a double height open arcade and a little church tower on the angle iron towards “RR. Tregtare”. Nowadays it is the admini­ VWUDWLYHVHDWDQGWKHFRXQFLOKDOORIWKHPXQLFLSDOLW\RI'XUUHVHYHQ though there will be a relocation of some functions and the elevation RIWKHHGL¿FHWRDVSDFHRIUHSUHVHQWDWLRQDQGSROLWLFDOGLVFXVVLRQ quattro torri che ne formavano l’ossatura, oggi invaso da costruzioni abusive, e che si erge sul SULPRSLDQRURGHOSURPRQWRULRFKHSRLULVDOH¿QR DOFROOHGHOOD9LOODQRYHFHQWHVFDGL5H=RJ The “Big Mosque”, nowadays cultural monument, in conformity with the Albanian preservation act, evokes the original shapes. The 0RVTXHFRPHVRXWLQDOOWKHSKRWRJUDSKLFUHSUHVHQWDWLRQRIWKH¿UVW decades of the century, and even in the perspectives of the square carried out by Italian and Albanian architects responsible for the 1942 town planning. It is situated on the south­western corner of the square above the structure of the original building which was turned into the Palace of Culture during the communist regime and seriously GDPDJHGE\WKHHDUWKTXDNH7KHH[LVWLQJHGL¿FHKDVDPDUEOH façade, a podium covered with opus incertum and a porch composed of bicolour columns and pillars. It is a landmark for a lot of Moslems but even for all the citizens. Thanks to its shapes and proportions and its particular orographic position, the Mosque dominates both the squa­ re and the urban main street, which from the Adriatic gate (the entrance in the port planned in 1942 plan) leads to the centre of Iliria square. Piazza Iliria presenta anche tracce di interesse GHOODVWRULDDUFKLWHWWRQLFDSLUHFHQWHGHOODFLWWj FRPHULVXOWDWRGHOODSUHVHQ]DDWWLYDD'XUD]]RGL architetti italiani e albanesi già a partire dai primi anni ’20. Up: The Big Mosque/ In alto: La Grande Moschea Below: Aleksander Moisiu Teather, The Palace of Culture (Aleksander Moisiu theatre)/ In basso: Il Palazzo della Cultura (Teatro Aleksander Moisiu) Eredità del Novecento Il Palazzo del Municipio “Bashkia” è stato realiz­ zato nel 1930. Situato nel lato ovest della piazza O¶HGL¿FLRqFRPSRVWRGDXQLQJUHVVRFHQWUDOH a tre arcate, sormontato da loggiato a doppia altezza e un piccolo campanile sul cantonale verso RR. “Tregtare“. Attualmente ospita la sede DPPLQLVWUDWLYDGHO&RPXQHGL'XUD]]RDVVLHPH alla sala consiliare, anche se è in discussione la probabile delocalizzazione di alcune funzioni, e O¶HOHYDPHQWRGHOO¶HGL¿FLRDVSD]LRGLUDSSUHVHQ­ tanza e di discussione politica. La “Grande Moschea”, attualmente monumento culturale, secondo la legislazione di tutela alba­ nese, riecheggia nelle fattezze attuali le forme originarie. La Moschea compare in quasi tutte le UDSSUHVHQWD]LRQLIRWRJUD¿FKHGHLSULPLGHFHQQL del secolo, e anche nelle prospettive della piazza realizzate dagli architetti italiani e albanesi autori del Piano Regolatore Generale del 1942. Situata nell’angolo sud – ovest della Piazza, su un terrazzo sopraelevato alla quota dello spazio centrale, è stata in parte restaurata nel 1993, FRQIRQGLHJL]LDQLVRSUDOHVWUXWWXUHGHOO¶HGL¿FLR originario manomesso negli anni del regime comunista (era stata trasformata in Palazzo della Cultura) e seriamente lesionato dal terremoto del 1979. L’edifcio attuale presenta la facciata in marmo, con basamento rivestito in pietra ad opus incertum, porticato composto da colonne e pilastri a fasce bicolore, ritmo ascensionale GHJOLHOHPHQWLVRYUDSSRVWL¿QRDOODFXSRODÊXQ punto di riferimento per molti religiosi musulmani, PDDQFKHSHUWXWWLLFLWWDGLQL'RPLQDFRQOHVXH forme e le sue proporzioni, e anche in ragione GHOODVXDSDUWLFRODUHFROORFD]LRQHRURJUD¿FD tanto la piazza quanto la prospettiva dell’attuale corso urbano principale della città, che dalla Porta Adriatica (l’ingresso al porto disegnato dal Piano del ’42) conduce proprio al centro di piazza Iliria. l Palazzo della Cultura (Teatro Aleksander Moisiu) /¶HGL¿FLRKDSUHVRLOQRPHGHOSLJUDQGHDUWLVWD di fama mondiale, in parte originario della città, Aleksander Moisiu, celebrato e onorato dalla città in vario modo. Anche la recente, nuova Università pubblica prende il suo nome, e a lui sono dedica­ te alcune interessanti sale del limitrofo Museo The Palace of Culture (Aleksander Moisiu theatre) The building is called after the most important and well known Albanian actor, Aleksander Moisiu, greatly renow­ ned in the town (also the new public university and the ethnographic museum, rich in images and historical relics, are named after him). The theatre or Palace of Culture, so called by the citizens, is situated in the northern side of the )UHHGRP6TXDUH³6KHVKLL/LULVH´7KHWKHDWUHUHFHLYHVD lot of artists but even common people. Nowadays lots of its spaces are used for conferences and other collective activities. Its construction was already planned in the 1942 Town Planning by the Italian architect Leone Carmignani. The theatre was built in 1963 in the site ZKHUHWKHSODQVKRXOGKDYHEHHQD3RVW2I¿FH7KH building yard brought to light the Roman Baths and part RIWKH%\]DQWLQH)RUR,QWKH0XQLFLSDO$GPLQLVWUD­ WLRQVWDUWHGWKH¿UVWUHFRYHU\ZRUNVRIWKHEXLOGLQJ,WLVD UDWLRQDOLVWSURSRUWLRQDWHDQGFRPSDFWHGL¿FH7KHIDoDGH presents a porch that starts from a monumental staircase and becomes a double­height open arcade with glass walls. The Prefecture This is a recent building. It was built at the end of the Communist regime and it is situated in the north western side of the square. The architectural style is the same of the mentioned Palace of Culture. Nowadays it is the seat of Re­ JLRQDO2I¿FHVDQGRIWKHPDLQSROLWLFDOSDUWLHVRIWKHWRZQ Above: the Prefecture/ In basso: la Prefettura (WQRJUD¿FRGHQVRGLLPPDJLQLHFLPHOLVWRULFL Il teatro o Palazzo della Cultura, come abitualmente i cittadini lo chiamano, è collocato nel lato nord della Piazza della Liber­ ta “Sheshi i Lirise”. Il teatro è un luogo non solo di passaggio di molti artisti ma anche di grande frequentazione pubblica. Molti dei suoi spazi attualmente vengono utilizzati per confe­ renze e altre attività collettive. La sua costruzione era stata già prevista nel Piano Regolatore del 1942 sotto la cura dell’ar­ chitetto italiano, Leone Carmignani. Il teatro venne costruito QHOQHOVLWRGRYHLOSLDQRGHOSUHYHGHYDXQHGL¿FLR postale. Il cantiere fu occasione per scoprire le terme romane HSDUWHGHO)RUR&LUFRODUHEL]DQWLQRDGLDFHQWHDOO¶HGL¿FLR Nel 2005 l’Amministrazione comunale ha dato avvio a primi ODYRULGLUHFXSHURHUHVWDXURGHOO¶HGL¿FLR4XHVWRVLSUHVHQWD FRPHXQHGL¿FLRGLIRUPHUD]LRQDOLVWHEHQSURSRU]LRQDWRH compatto, ancorato nelle fondamenta da pilastri che risalgono proprio dall’area archeologica delle antiche terme, riportata a vista. La facciata è scandita da un portico colonnato, che parte da una scalinata monumentale, e prosegue in forma di loggiato a doppia altezza, interamente vetrato scandito da piastrini in cemento armato. La sede della Prefettura 4XHVWRqO¶HGL¿FLRGLSLUHFHQWHFROORFD]LRQH5HDOL]]DWR YHUVROD¿QHGHOUHJLPHFRPXQLVWDRFFXSDXQDSRVL]LRQHLQ rilievo sul lato nord occidentale della piazza. Lo stile architet­ tonico rimanda a quello del citato Palazzo della Cultura. Attual­ PHQWHqVHGHGHJOLXI¿FLUHJLRQDOLHGHOOHVHGLGHLPDJJLRUL partiti politici della città. ³3ODQGH'XUD]]R´/+HX]H\+'DXPHW0LVVLRQH$UFKHRORJLFDGL0DFHGRQLD3DULJL 1876, L.Heuzey, H Daumet, Archaeologic Mission of Mace­ donia, Paris 1.5 Site conditions and its own current nature/ Condizioni d’uso e caratteri identitari attuali Land use and buildings employment The square, the main space of the town, has a social cultural and administrative role. It forms a rectangle and it is surrounded by a lot of institutional cultural and residential buildings. In the square there are also some important archaeological remnants. The following list is an inventory of these elements: Institutional and cultural buildings 7KH7RZQ+DOO EXLOWLQ ­ The big Mosque (recovered in 1993) ­ The Prefecture ­ The Palace of Culture “Aleksander Moisiu” (built in 1963) Archaeological sites ­ The Amphitheatre ­ Byzantine Walls ­ The big Mosque 7KH)RUR Decay and transformation process The area is not characterize by particular process or conditions of decay, except for some perimetric parts. The public space shows normal conditions thanks to maintenance activities of the streets of WKHSHGHVWULDQVSDFHVDQGRIÀRZHUEHG7KHLPSURYDEOHQLJKWOLJKWLQJ of the square gives to the place an acceptable view compared to the other public spaces of the town. The western side of the square, in front of the Mosque and the Prefecture presents some green areas in good conditions that should be used in a different and suitable way. In the northern side, behind the Palace of Culture and near to the archa­ HRORJLFDODUHDVRIWKH%\]DQWLQH)RURDQG5RPDQ%DWKVWKHFRQGL­ tion of the spaces is very different. The archaeological space and its monumental value are strongly damaged by the decay and the lack of maintenance of the areas and the new structures that changed the image and the functions of the public space, invaded by new activities (café, restaurants, local street market). This situation involves even WKHQRUWKHDVWHUQVLGHRIWKHVTXDUHKHUHWKHUHLVDORZTXDOLW\RIWKH buildings (small and in a very poor condition) and the lack of boundari­ es. This border should have been used, as indicated in the 1942 Town Planning, for the construction of a long porch building that should have had the function of closing the space in that side of the square. 8VLGHOVXRORHGHVWLQD]LRQLGHJOLHGLÀFL /D3LD]]DLOSXQWRIRFRODUHGHOODFLWWjGL'XUD]]R ha un ruolo sociale, culturale e amministrativo di rilevante importanza. Con la sua forma rettan­ golare racchiude attorno a se una vasta serie di HGL¿FLLVWLWX]LRQDOLFXOWXUDOLHUHVLGHQ]LDOL,QROWUH nel contesto della Piazza sono presenti una serie di elementi archeologici di grande interesse. Una descrizione in chiave storica di questi ele­ menti è stata già sviluppata nei punti precedenti. Si riassumono qui tali elementi in forma di inven­ tario, anche allo scopo di indicarne la funzione di SRVVLELOLPHWHGLWUDI¿FRHGLIUHTXHQ]HG¶XVR (GL¿FLLVWLWX]LRQDOLHFXOWXUDOL ­ Il Palazzo Municipale (realizzato nel 1930) ­ La Grande Moschea (restaurata nel 1993) ­ La Prefettura ­ Il Palazzo della Cultura “Aleksander Moisiu” (realizzato nel 1963) Siti Archeologici $Q¿WHDWUR ­ Il tratto delle muri di età Bizantina ­ La Grande Moschea )RUR&LUFRODUH Degrado e processi di trasformazione L’area nel suo complesso non appare interessata da particolari processi o condizioni di degrado, se non per alcune sue parti perimetrali. In generale lo spazio pubblico presenta condizioni normali, legate ad attività di manutenzione che sembrano interessare con buona frequenza tanto le pavimentazioni stradali che gli spazi pedonali e le aiuole, sempre ben mantenute. La stessa, normale condizione di illuminazione notturna della Piazza, per quanto altamente mi­ gliorabile e perfettibile, conferisce al luogo, anche di notte, un carattere ancora accettabile, soprat­ tutto in relazione alle condizioni normali degli altri spazi pubblici della città. Il bordo occidentale della piazza, innanzi alla moschea e al Palazzo della Prefettura, presenta ugualmente spazi di verde in generale in buone condizioni, che forse PHULWHUHEEHURVRORGLHVVHUHSLRSSRUWXQDPHQWH disegnati per un loro migliore utilizzo pubblico. 'LYHUVDqLQYHFHODFRQGL]LRQHGHJOLVSD]LGL 31 Nowadays there are some lots without buildings abandoned and un­ derutilized. The recent reinstatement of the regulation of the urbanistic standard, before the new Urban Plan for the Central Area, makes the SURMHFWVRIWKLVDUHDPRUHGLI¿FXOW7KHDUHDEHWZHHQWKHELJ0RVTXH DQGWKH%\]DQWLQHZDOOVLQWKHSDVWSDUWRIDSDUNWKDWJRHVXSWR.LQJ =RJ¶V9LOODRQWKHKLJKHVWSRLQWRIWKH3URPRQWRU\RI'XUUHVLVWRGD\ abandoned and has been invaded by new activities and residences. ,QWKH¿UVWVWDJHRIWKH&RPSHWLWLRQWKHUHFRQVWUXFWLRQRIWKHSDUNQHDU to the walls should be an issue to be evaluated. Population and uses. +RZWKHLQKDELWDQWVSHUFHLYHWKHVSDFH,QWKHIROORZLQJVFKHPHWKHUH are some important and secondary urban routes of the square. This analysis is only a short survey that should be examined according to the times and the population of the town. The main urban routes are LQWKHZHVWHUQVLGHRIWKHVTXDUHWKLVLVEHFDXVHRIWKHSUHVHQFHRI WKHPDLQXUEDQEXLOGLQJV 3UHIHFWXUH0RQVTXH7RZQ+DOO DQGRIWKH meeting point that these routes have with the other ways of the town: the trading route, from the south to the north towards the city center, DQGWKHVHFRQGDU\ZD\VWKDWGLVWULEXWHWKLVÀRZLQWKDWRWKHULPSRUWDQW streets of the city center. The secondary routes link the less important facilities of the town: W.C., pedestrian ways, public gardens, fountain and library. Even the location of the places where people stop are very LPSRUWDQWLQWKLVDQDO\VLVDQGZLOOGH¿QHDQLVVXHIRUWKHSURMHFW 32 bordo a nord, alle spalle del Palazzo della Cultura HDQFKHQHOVXRLQWRUQR ¿QRDOOHDUHHDUFKHR­ ORJLFKHGHO)RUR%L]DQWLQRHGHOOHDQWLFKH7HUPH Romane. Qui la qualità dello spazio archeologico e il suo valore documentale è fortemente inquina­ ta tanto dal degrado e dall’assenza di manuten­ zione delle aree, quanto dall’impatto fortemente negativo delle nuove costruzioni, che alterano l’immagine complessiva e anche la funzionalità dello spazio pubblico, che tende ad essere invaso dal prolungamento delle nuove attività (bar, ristoranti, mercatini informali). Analogo situazione FULWLFDULVHQWHLOERUGRQRUGRULHQWDOHGHOODSLD]]D TXLSHVDODVFDUVDTXDOLWjHGLOL]LDGHJOLHGL¿FL presenti (bassi e di pessime condizioni d’uso) e l’assenza stessa di un limite costruito (sia esso YHUGHRFDUDWWHUL]]DWRGDHGL¿FL (¶LOERUGRGRYH il citato PRG del ’42 prevedeva la costruzione di XQOXQJRHGL¿FLRSRUWLFDWRSURSULRFRQODIXQ]LRQH GLFKLXGHUHHGH¿QLUHFRPHVSD]LRFRQFOXVROD piazza in quella direzione. Attualmente sono SUHVHQWLDOFXQLORWWLLQHGL¿FDWLLQFRQGL]LRQHGL abbandono o sottoutilizzo. Il recente ripristino GHOOHQRUPHGLLQHGL¿FDELOLWjDVVROXWDQHOO¶DUHD antecedenti al nuovo Piano Urbanistico dell’area centrale e mai abolite dal Governo Centrale (il centro della città è soggetto dal 1962 ad una norma che ne riconosce il valore di “Città Museo”) UHQGHODGH¿QL]LRQHSURJHWWXDOHGLWDOHOLPLWHXQD 'XUD]]RLPPDJLQLDWWXDOLGHOO¶DUHDFHQWUDOH Durres, current images of the central area GHOOHRSHUD]LRQLSLFRPSOHVVHGHOFRQFRUVRVX cui è forse necessaria la maggiore invenzione e creatività da parte dei partecipanti al Concorso. 9ROHQGRHVWHQGHUHO¶DWWHQ]LRQHGHOO¶LQWHUYHQWR anche alle aree tra la Grande Moschea e il tratto di mura bizantine in risalita verso il Castello, si può ancora notare che tutta quest’area, in passato parte di un unico parco che approdava ¿QRDOOHSHQGLFLGHOOD9LOODGL5H=RJVXOSXQWR SLDOWRGHOWUDWWRPHULGLRQDOHGHO3URPRQWRULR 'XUD]]LQRqRJJLLQFRQGL]LRQLGLSDU]LDOHDEEDQ­ dono, e presenta diverse condizioni di invasione GLQXRYHDWWLYLWjHDELWD]LRQL8QDULÀHVVLRQHLQ tema di prima proposta (prima fase del concorso) potrebbe peraltro vertere proprio sull’ipotesi di ri­ costituzione del parco delle Mura (misura peraltro auspicata dal nuovo Piano per l’Area Centrale, e oggetto di un progetto pilota del nuovo strumento urbanistico), anche nell’idea di demolizione e permuta di proprietà di tali presenze invasive. Popolazioni e usi prevalenti. Come gli abitanti percepiscono lo spazio Nello schema allegato vengono ricostruiti i per­ corsi urbani principali e secondari che interessa­ no la piazza nel suo complesso. Tale analisi ha naturalmente soltanto il senso di una primissima indicazione di indagine, che merita di essere approfondita in ragione dei tempi e delle stagioni della città, nonché delle diverse popolazioni che la abitano, la vivono, la frequentano. E’ interes­ sante osservare, da tale schema, come i percorsi urbani principali tendano a preferire la frequen­ tazione del bordo occidentale della piazza. Tale preferenza deriva da due condizioni: la presenza delle principali attrezzature urbane (Prefettura, Moschea, Palazzo Comunale) sul quel fronte, e l’elemento di giunzione che tale “passeggiata” offre con le altre percorrenze principali della città. La prima, attuale via del Commercio, che assorbe LÀXVVLFKHULVDOJRQRGDOZDWHUIURQWPHULGLRQDOH (il grande parco costiero), da Sud a Nord, verso il centro della città, e le due secondarie, che LUUDGLDQRHGLVWULEXLVFRQRWDOHÀXVVRVXOOHGXH principali arterie del centro urbano, a partire dallo VQRGRFRVWLWXLWRGDO3DOD]]RGHOOD&XOWXUD'D notare ancora come i percorsi secondari tendano a caratterizzare il collegamento con i cosiddetti riferimenti minori di tale lettura: i bagni, la passeg­ giata pedonale e i giardini pubblici, la fontana e la biblioteca. Un ulteriore suggerimento di indagine è quello GLJXDUGDUHQRQVROWDQWRDLÀXVVL SHGRQDOLH carrabili) della piazza, ma anche ai luoghi di sosta e di diverse attività. La collocazione di tali luoghi, rilevanti rispetto all’indagine sui modi d’uso col­ lettivi e individuali della piazza e dei suoi dintorni, risente delle condizioni climatiche e della diversa ombreggiatura, condizioni queste che devono essere assunti come tema rilevante di progetto. 33 1.6 Tried or previous planning solutions/ Soluzioni progettuali tentate o precedenti The incomplete space of Iliria Square has a broad range of planning proposals, partly carried out. The square was built after the events and the demolitions of the 1926 earthquake, and has had its really settlement with the 1942 Town Planning. On the website are available the complete projects and its descriptions and comments according to the following list: a. The solutions of the 1942 Town Planning b. The solutions proposed in 1963 c. The proposals of the Competition for the central area d. The solutions proposed in the Central Area Plan in 2007 e. The recovery project of the Palace of Culture “Aleksander Moisiu” in 2005 The last one can be an interesting starting point for the future planning proposals. 9LHZRI'XUUHV\HDUVµIURP6RNRO.RNRPDQLSHUVRQDODUFKLYHDurres anni ‘70, fonte: Sokol Kokomani, archivio personale ,QWKHSDJHRQULWuJKWXS0DVWHU3ODQRI'XUUHVDUFK/HRQH&DUPLJQDQL above, Picture of Central square project/ Nella pagina a destra: Piano Regolatore Generale di Durazzo, 1942, arch. Leone Carmignani; sotto, immagini del progetto della piazza centrale Lo spazio, come detto in precedenza, inconcluso e incompiuto di piazza Iliria, presenza al contrario un ricco repertorio di soluzioni progettuali tentate, realizzate solo in parte a partire proprio dagli anni della sua nascita. E’ stato ricordato come la piazza nasca in relazione agli eventi e DOOHGHPROL]LRQLGHOWHUUHPRWRGHOHWURYLGH¿QL]LRQH soprattutto nella redazione del Piano Regolatore Generale del 1942. Sul sito del concorso è disponibile il regesto pressoché completo dei progetti, secondo il seguente elenco, e le relative descrizioni d’autore (quando disponibili) e commenti: a. Le soluzioni del Piano del 1942 b. Le soluzioni proposte nel 1963 c. Le proposte del Concorso per l’area centrale d. Le soluzioni proposte nel Piano per l’Area Centrale del 2007 e. Il progetto di restauro del Palazzo della Cultura “Aleksander Moisiu”­ 2005 Ad esso si rimanda per una valutazione critica e creativa di tale interessante regesto di proposte e di idee progettuali. 1.6.1 The solutions of the 1942 Town Planning/ Le soluzioni del Piano del 1942 Arch. L.Carmignani “La già importante presenza di un centro amministrativo vede consolidato nel progetto di piano urbanistico il ruolo della piazza del Municipio, che si fa in due grazie alla nuova architettura posta al suo centro per ospitarvi la Borsa e la )HGHUD]LRQHGHO3DUWLWR/HSDUWLGHOODSLD]]DVDUDQQRFLQWH GDHGL¿FLVLJQL¿FDWLYLFRPHOHSRVWHHWHOHJUD¿ VXOVLWR verrà successivamente realizzato il Palazzo della Cultura), XQDOEHUJREDQFKHDVVLFXUD]LRQLXI¿FLJLDUGLQLSHQVLOL la moschea. Importante elemento di raccordo formale è il SRUWLFDWRORVWHVVRQXRYRHGL¿FLRFHQWUDOHqLQWHUDUPHQWH sopraelevato su portici per facilitare la comunicazione tra le due parti della piazza. Queste assumono caratteri diversi: ODSULPDGLVPLVWDPHQWRGHOWUDI¿FRODVHFRQGDGLSHGR­ nalizzazione per grandi eventi e manifestazioni pubbliche. Come elemento monumentale è prevista una statua rappre­ sentante Skanderberg, eroe nazionale albanese.” (C. Pozzi, La città del Novecento, studi di settore per il 3LDQRGHOO¶$UHD&HQWUDOHGL'XUD]]R  35 1.6.2 The solutions proposed in 1963/ Le soluzioni proposte nel progetto del 1963 “L’amministrazione socialista conferma il ruolo determinante per il centro amministrativo della città, con un progetto che riecheggia quello interno al Piano del 1942, aggiornandone le destinazioni d’uso e il OLQJXDJJLRDUFKLWHWWRQLFR9LHQHFRQIHUPDWRLOWHPDGLXQSRUWLFDWR³XQL¿FDQWH´LOQXRYRVLVWHPDLQVHGLDWL­ YRFDUDWWHUL]]DWRGDOFRQWUDSXQWRWUDLOULWPRGLHGL¿FLDOWLHODSDXVDGLYROXPLFRPSDWWLDGHVWLQD]LRQHFRO­ lettiva. Il Palazzo della Cultura, che sorge grosso modo sul sito precedentemente previsto per le Poste e 7HOHJUD¿DVVXPHXQUXRORFDUGLQHLQUHOD]LRQHDOFRQWUDSSRVWR0XQLFLSLR,OFDQWLHUHSHUODUHDOL]]D]LRQH GHOO¶HGL¿FLRFRVWLWXLVFHXQDGHWHUPLQDQWHRFFDVLRQHSHUODVFRSHUWDGHLUHVWLGHOODFLWWjURPDQDLQYHVWHQ­ do in particolare l’area delle Terme e collocandosi in adiacenza al sito del Macellum. Questa contigenza SRUWHUjDOODFDPSDJQDGLVFDYRGHOO¶$Q¿WHDWUR1RQRVWDQWHLOYDORUHGHLULWURYDPHQWLLOSURJHWWRQRQ VXELVFHPRGL¿FKHHODVWUXWWXUDGHOO¶HGL¿FLRVLDSSRJJLDLQSLSXQWLDVWUHWWRFRQWDWWRFRQJOLDQWLFKLUHVWL´ Project for Liria Square, National Institute of Architecture, Republic of Albania, 1963/ Progetto per il complesso urbano di piazza Liria, Istituto Nazionale di Architettura, Repubblica d’Albania, 1963 1.6.3 The solutions proposed in the Central Area Plan in 2007/ Le soluzioni proposte per la piazza nel Piano per l’Area Centrale del 2007 Progetto dell’asse urbano corso Epidamnos Il progetto assume come tema il ridisegno e la valorizzazione dell’asse storico e del tessuto urbano consolidato circostante. La conoscen­ ]DGHOODVWUDWL¿FD]LRQHGHOODFLWWjqGXQTXHXQSXQWRGLSDUWHQ]DHFRVWLWXLVFHXQRVWUXPHQWRQHFHVVDULRSHUUHVWLWXLUHDOOXRJRXQDPLVXUDH un ruolo, e fornire gli strumenti per un nuovo linguaggio progettuale. Il Piano assegna a questa area un ruolo di riconnessione tra le diversi parti, attraverso il recupero di forme di memoria urbana, non dimenticando il presente, ma puntando l’attenzione ai luoghi che costituisco l’immagine dell’asse e della città stessa. L’idea principale del progetto è che l’asse urbano di corso Epidamnos possa costituire il cuore di una ritrovata attenzione alle identità urbane,multiple, della città, anche in relazione alla sua fruizione in senso turistico. Caratteristiche funzionali /¶DPELWRGLLQWHUYHQWRqFDUDWWHUL]]DWRSUHYDOHQWHPHQWHGDIXQ]LRQLUHVLGHQ]LDOLVLDSHUTXDQWRULJXDUGDO¶HGL¿FDWRPHQRUHFHQWHFKHSHU OHQXRYHUHDOL]]D]LRQLOXQJRLIURQWLXUEDQLDLSLDQLWHUUDVRQRSUHVHQWLDWWLYLWjFRPPHUFLDOLPHQWUHOHSLD]]HRVSLWDQRHGL¿FLSXEEOLFL $OO¶LQWHUQRGHOWHVVXWRqSUHVHQWHO¶+DPDPULVDOHQWHDO;9,;,;VHFRJJLULFRQRVFLELOHVRORSHUODVXDIRUPDSHUDOWURUHFLQWDWRHRJJHWWR di protezione dall’Istituto dei Monumenti, mentre verso sud, a fronte della viabilità principale del porto, troviamo il palazzo della Banca Na­ ]LRQDOHG¶$OEDQLDRSHUDGLXQDUFKLWHWWRLWDOLDQRGHJOLLQL]LGHO1RYHFHQWR9LWWRULR%DOOLR0RUSXJRUHFHQWHPHQWHUHVWDXUDWR/DVWHVVDUDUD DWWHQ]LRQHDGHGL¿FLGHO1RYHFHQWRGHOODFLWWjqVWDWDGDWDDOO¶HGL¿FLRVHGHGHO0XQLFLSLRDQFK¶HVVRUHFHQWHPHQWHUHVWDXUDWRHDGHJXDWR alle funzioni attuali, e valorizzato da una vistosa illuminazione notturna. Polarità ­ Centralità urbane Le polarità di rilievo sono costituite dalle due piazze,. che costituiscono gli elementi di testa formale e funzionale del tessuto storico e GHOO¶DVVHLQRJJHWWR4XHVWHSRODULWjWURYDQRSDUWLFRODUHVLJQL¿FDWRDQFKHSHUODSUHVHQ]DGLDWWLYLWjSXEEOLFKHHGLVHUYL]LDQRUGQHOOD SLD]]D/LULDWURYDQRXELFD]LRQHLO0XQLFLSLROD0RVFKHDJUDQGHLO3DOD]]RGHOODFXOWXUDDVXGLQ3LD]]DGHOPDUHRGHOOD'RJDQDIDGD FRUQLFHO¶HGL¿FLRGHOO¶H['RJDQDPHUFDQWLOH Obiettivi di progetto Il progetto nel suo insieme assume come elemento centrale l’asse, considerandolo ancora come struttura portante di questo importante settore urbano, e capace di integrare i differenti luoghi che lo intersecano. L’asse viene ripensato ridisegnando nuovi elementi che ne valo­ rizzano la sua nuova funzione: dagli incroci tra gli assi di penetrazione del tessuto urbano storico, ai punti di incontro tra la piazza del mare HODSLD]]DGHJOLLQFRQWULSXEEOLFLGDOODULTXDOL¿FD]LRQHGHLIURQWLDOODULFHUFDWDULOHWWXUDGHOOHDPSLHSDUWLGLWHVVXWRGHOODFLWWjRWWRPDQDDW­ WXDOPHQWHGLI¿FLOPHQWHSHQHWUDELOH$WDOSURSRVLWRSHUODVDOYDJXDUGLDGHOOHSRFKHWUDFFHDQFRUDHVLVWHQWLGHOO¶DELWDWR VRSUDWWXWWRODSDUWH DVXGGHOODFLWWj HLOULSULVWLQRGHOO¶DUWLFRODWRVWRULFRLO3LDQRULPDQGDDVSHFL¿FLSLDQLGLUHFXSHURLQFRQVLGHUD]LRQHDQFKHGHOO¶LQWHQVL¿FDUVL delle nuove costruzioni e di azioni di rinnovo edilizio fuori da ogni controllo urbanistico. Central Area Master Plan, 2007, Structure plan for the historical center/ Piano per l’area centrale di Durazzo, 2007: indicazioni strutturali per il centro storico. 37 $&&(66,%,/,7$¶9,$%,/,7$¶02%,/,7$¶6267(1,%,/( 7XWWRO¶DUHDqSHQVDWDFRPHSRU]LRQLGLWHVVXWRDWUDI¿FROLPLWDWRHLVROHSHGRQDOL&RVuO¶DVVHGLYHQWDODQXRYDVWUDGDSDVVHJJLDWDODFXL sezione rappresenta lo strumento di controllo che ne guida la trasformazione e ne valorizza la percezione. Tutto il sistema accessibile diventa vero luogo di connessione urbana che si struttura attraverso un sistema di piste ciclabili, di nuova alberatura, il disegno della pavimentazione e spazi di sosta. La valorizzazione di tutto il sistema di accessibilità costituisce occasione per il riordino di tutto il tessuto storico e occasione per determinare nuovi luoghi di connessione urbana. (',),&$7263$=,238%%/,&2$0%,(17( ,OSLDQRSRQHFRPHRELHWWLYRLOUHFXSHURHODVDOYDJXDUGLDGLHOHPHQWLFRQVLGHUHYROLGHOWHVVXWRDELWDWLYRHVVRSUHYHGHD]LRQLGLHPHU­ genza igienico sanitaria, interventi di ripristino tipologici nelle parti che presentano acora caratteristiche costruttive ottomane, interventi di restauro per l’haman presente ancora nella sua forma e riconoscibile come punto di forza del tessuto e nuovo spazio pubblico, interventi di ristrutturazione delle facciate del fronte. Lungo alcune strade minute, all’interno del perimetro delle vecchie mura bizantine, troviamo an­ cora parte di quei giardini murati che caratterizzava l’abitato, così come troviamo ancora tracce di tetti a padiglione realizzati con struttura SRUWDQWHLQOHJQR,OSLDQRQHYDORUL]]DODWLSRORJLDHQHFRQVLGHUDODSRVVLELOLWjGHOUHFXSHURSHUFRVWLWXLUQHDOPHQRQHOODSDUWHSLDQRUG a ridosso della piazza grande, un punto turistico ricettivo (albergo diffuso, bed and breakfast). &$5$77(5,67,&+()81=,21$/, ,OWHPDGHOUHFXSHURHGLOL]LRVLDUULFFKLVFHGLQXRYRVLJQL¿FDWRTXDQGRVLSHQVDDOODSRVVLELOLWjGLGHVWLQDUHDOFXQLHGL¿FLDSSDUWHQHQWLDO QXFOHRVWRULFRSLDUWLFRDGDWWLYLWjWXULVWLFRULFHWWLYD4XHVWRYDORUL]]DO¶LQVHULPHQWRDOO¶LQWHUQRGHOO¶RUJDQL]]D]LRQHWXULVWLFDFRPSOHVVLYD della città e la creazione di un circuito urbano che metta in relazione parte del tessuto con la città e il porto, Inoltre è importante conside­ UDUHFRPHFDUDWWHULVWLFDIXQ]LRQDOHQRQVRORODGHVWLQD]LRQHGHJOLHGL¿FLPDWXWWRO¶DUWLFRODWRVWRULFRLQTXDQWRDUHDFRQSUHVHQ]HGLUHSHUWL archeologici e di pregio storico, (resti di mura urbane, hamam, ex legazione austriaca, ecc) possa diventare un unico grande spazio aperto, inserito all’interno degli itinerari storico ­ turistici. POLARITA’­CENTRALITA’ URBANE /HGXHSLD]]HXUEDQHLQVLHPHDOO¶DVVHVWRULFRVRQRRJJHWWRGLULVWUXWWXUD]LRQHXUEDQLVWLFDDO¿QHGLGLYHQWDUHLSULQFLSDOLSROLSXEEOLFLWUD il mare e la città all’interno delle nuove previsioni di sviluppo della città policentrica. L’intervento è caratterizzato dalla volontà di creare XQDJUDQGHDUHDDSHUWDGLFRQQHVVLRQHWUDO¶DIIDFFLRDOPDUHHO¶LQWHUQRGHOODFLWWjDWUDI¿FROLPLWDWR3HUOD3LD]]DJUDQGHVRQRSUHYLVWL interventi di ristrutturazione sia della piazza in se, sia per il Palazzo della Cultura, oltre che il ridisegno del nuovo assetto stradale. Mentre ODSLD]]DGHOODGRJDQDFKHSUHVHQWDXQGLVHJQREHQULFRQRVFLELOHFRQWRUQDWDGDJOLHGL¿FLGHOµGLYHQWDO¶RUL]]RQWHXUEDQRGHOO¶LQWHUR intervento, caratterizzato dal progetto di ristrutturazione dello spazio aperto con la possibilità di inserire piccoli servizi locali. &HQWUDO$UHD0DVWHU3ODQ6WUXFWXUHSODQIRUWKHKLVWRULFDOFHQWHU3UH¿JXUDWLRQ 3LDQRSHUO¶DUHDFHQWUDOHGL'XUD]]RLQGLFD]LRQLVWUXWWXUDOLSHULOFHQWURVWRULFR3UH¿JXUD]LRQH 38 1.6.4 The recovery project of the Palace of Culture “Aleksander Moisiu” in 2005/ Il progetto di restauro del Palazzo della Cultura “Aleksander Moisiu”­ 2005 “L’amministrazione comunale comprende a pieno il ruolo architettonico svolto per quasi un quarantennio dal Palazzo della Cultura, svilup­ SDQGRXQDFFXUDWRSURJHWWRGLULVWUXWWXUD]LRQHPRWLYDWRLQQD]LWXWWRGDOORVWDWRGLREVROHVFHQ]DFRPSOHVVLYDGHOO¶HGL¿FLRLQSDUWLFRODUHGHJOL LQ¿VVLGHOO¶DUUHGRLQWHUQRGHJOLLPSLDQWL/HGHVWLQD]LRQLG¶XVRVRQRVRVWDQ]LDOPHQWHFRQIHUPDWHPDYLHQHHOXVDRULQYLDWDODTXHVWLRQH del raporto con le presenze archeologiche. La piazza mantiene un ruolo di grande attratore urbano e se in alcune parti presenta ancora le qualità dei progetti precedenti, cade quella speranza di unitarietà architettonica del fronte orientale, condensata nel progetto di portici SHULPHWUDOLLQFRQWUDSXQWRDOO¶HGL¿FDWRDIDYRUHGLQXRYLLQWHUYHQWLSULYDWLFKHQRQSURSRQJRQRXQDUHOD]LRQH³VSHFLDOH´FRQLOJUDQGHVSD]LR collettivo”. (&3R]]L/DFLWWjGHO1RYHFHQWRVWXGLGLVHWWRUHSHULO3LDQRGHOO¶$UHD&HQWUDOHGL'XUD]]R 7KHUHVWRUDWLRQSURMHFWRIWKH3DODFHRI&XOWXUH$OH[DQGHU0RLVLX0XQLFLSDOLW\RI'XUUHV Il progetto di restauro del Palazzo della Cultura “Aleksander Moisiu”­ 2005, Comune di Durazzo 1.7 Current normative conditions/ Condizioni normative attuali The new Plan for the Central Area of the Town (*) provides rules and normative directions about Iliria Square and the urban context. The planning proposals have to observe these provisions. 1. Current state (excerpt of the table 2 of the Urban Integrated Plan of WKH2OG7RZQRI'XUUHV 40 1HOOHVSHFL¿FKHSDJLQHGHOVLWRZHEGHOFRQFRUVR sono riportati alcuni estratti delle tavole del nuovo Piano per l’area centrale della Citta’. Tale Piano fornisce prescrizioni e indicazioni normative per lo spazio della piazza Iliria e il contesto urbano di appartenenza. Le proposte progettuali di concor­ so sono tenute espressamente ad attenersi a tali disposizioni normative. 2. Proposed structure (excerpt of the table 3 of the Plan) (*) Plan for the Central Area of the town was approved by Territory Adjusting Council of the Repu­ blic of Albania on 26 October 2007. Prof. Ing. Piero Rovigatti (Team leader) Prof. Arch. Carlo Pozzi, Prof. Ing. Enrico Spacone, Arch. $UFKK(GPRQG+DOL Arch. Olta Brace, Ing.. Enida Bitri Geologia: Prof. Nicola Sciarra, Ud’A $UFKHRORJLDGRWW$QGUHD6WDIID Gruppo operativo: Arch. A. Buongiovanni,Arch. Massimo 'L)UDQFHVFR$UFK0LOHQD'¶8UEDQR$UFK0LFKHOH3D­ lermo , Arch. Tiziana Percoco, Arch. Tiziana Pretara, Arch. ,SSROLWD5DQ$UFK0LUNR6ROD]]R$UFK7DXODQW'DQR L’elaborato espone l’assetto proposto per l’area di piano, articolandone la VWUXWWXUDLQSDUWLFRQQHVVLRQLHDWWUH]]DWXUH9HQJRQRLGHQWL¿FDWHOHSDUWL VHFRQGRFULWHULGLRPRJHQHLWjGLDVVHWWR¿VLFRFRQVLVWHQ]DHTXDOLWjGHOO¶HGL­ ¿FDWRHWjSUHYDOHQWHGHOOHFRVWUX]LRQLTXDOLWjGHOOHIXQ]LRQLSUHVHQWLOH connessioni – ambientali e infrastrutturali ­ e la dotazione di attrezzature. La WDYRODLGHQWL¿FDOHVHJXHQWLSDUWLLQWHUQHDOO¶DUHDGLSLDQR A. Centro storico (cittadella bizantina – ottomana), nelle sue 10 sottozone (da $DG$  B. Area dei Quartieri urbani centrali (quartieri interni a bassa densità, da sottoporre a risanamento urbanistico), nelle sue 21 sottozone GD%D%  &$UHDGHL4XDUWLHULVHWWHQWULRQDOLQHOOHVXHVRWWR]RQH GD&D&  '$UHDFRVWLHUDSHGHFROOLQDUHPHULGLRQDOHQHOOHVXHVRWWR]RQHGD'D' (:DWHUIURQWRULHQWDOHQHOOHVXHVRWWR]RQHGD(D( )$UHDSHGHFROOLQDUHLQWHUQDQHOOHVXHVRWWR]RQHGD)D) G. L’area del Parco Costiero meridionale, nelle sue 2 sottozone, da G1 a G2. 3HURJQLDUHDHOHQFDWDVRQRLQROWUHULSRUWDWLLGDWLUHODWLYLDOODVXSHU¿FLHWHUULWR­ ULDOH 67 XQDVWLPDGHOOHVXSHU¿FLFRSHUWH 6F HGHOOHYROXPHWULHHVLVWHQWL 9  HXQGDWRGLVWLPDGHOOHGHQVLWjDELWDWLYH ' /HYROXPHWULHHVLVWHQWLVRQRVWDWH ULOHYDWHHFDOFRODWHLQEDVHDOODFDUWRJUD¿DHVLVWHQWHIRUQLWDGDOO¶$PPLQLVWUD]LR­ ne, aggiornata in via speditiva tramite indagini sul campo e confronto aero­ IRWRJUD¿FR/HGHQVLWjDELWDWLYHULSRUWDWHQHOODWDYRODVRQRVWDWHGHWHUPLQDWH assumendo l’indice presunto di 80 mC/abitanti, considerando le sole volume­ WULHUHVLGHQ]LDOL/DWDYRODLGHQWL¿FDDQFKHOHVHJXHQWLSDUWLGLLQVHGLDPHQWR HVWHUQHDOO¶DUHDGLSLDQRFRPH+,QVHGLDPHQWRFRVWLHURRFFLGHQWDOH ,3DUFRWHUULWRULDOHGHO3URPRQWRULRGL'XUD]]R-$UHDSRUWXDOHGL'XUD]]R. Ambito di ristrutturazione urbanistica (contenimento, repressione e recupero selettivo degli insediamenti abusivi). 3. Urban standard (excerpt of the table 5 of the plan) Spaces and public facilities La determinazione delle densità abitative massime ammissibili per le singole PUE – SDUWLXUEDQHHOHPHQWDUL±HSHUOHORURHYHQWXDOLDUWLFROD]LRQLFKHVLULPDQGDDJOLVSHFL¿­ ci articoli delle norme tecniche di attuazione, serve anche, evidentemente, a valutare la domanda di attrezzature e servizi e la sua attuale soddisfazione in termini di offerta. E’ HVDWWDPHQWHFLzFKHUHDOL]]DODWDYRODGL3LDQRODTXDOHLGHQWL¿FDHTXDQWL¿FDOHDUHH DVHUYL]LRHVLVWHQWLHGLSURJHWWR/DYHUL¿FDGHJOLVWDQGDUGGHLVHUYL]LSXEEOLFLDYYLHQH SHUDOWURVHFRQGRGXHOLYHOOL8QSULPROLYHOORYHUL¿FDODGLVSRQLELOLWjLQWHUPLQLJHQHUDOL SHUO¶LQWHUDSRSROD]LRQHSUHVHQWHDOO¶LQWHUQRGHOO¶DUHDFHQWUDOHGL'XUD]]RGLDWWUH]­ zature di carattere generale, adoprando gli standard previsti dalla normativa vigente, riconducibili alla nozione di attrezzatura pubblica. Rientrano in questo insieme, tra le aree menzionate dalla normativa: a. le aree a verde pubblico attrezzato (parchi urbani e territoriali), per i quali la normati­ YDQD]LRQDOHDVVHJQDXQYDORUHPLQLPRGLULIHULPHQWRGL0TDGDELWDQWH b. le aree per attrezzature sociali, per le quali la normativa nazionale assegna un valore PLQLPRGLULIHULPHQWRGL0TDGDELWDQWH c. le aree per lo sport, per le quali la normativa nazionale assegna un valore minimo di riferimento di 2,5 Mq ad abitante. La normativa vigente stabilisce anche una dotazione minima di parcheggi pubblici in relazione alle abitazioni (collettive) di 1 posto auto ogni famiglia, a cui va aggiunta una quota di parcheggi per ogni abitante per le zone centrali (0,02 mq per abitante), e un’al­ tra per il servizio delle attrezzature sociali (0,10 mq per abitante). Tale modo di calcola­ re lo standard di parcheggi rende laborioso, ma non impossibile la determinazione di un unico valore. Questo si ricava facilmente, stimando pari a 4 persone la composizione di una famiglia media, lo standard per parcheggi sarebbe di 15 mq:4 + 0,02 + 0,10 mq/ab = 3,87 mq/abitante 42 4. Restrictions of archaeological and monumental protection (excerpt of the table 6 of the plan) ,O38,'FRQIHULVFHQRWHYROHDWWHQ]LRQHDOODWXWHODHDOODYDORUL]]D]LRQHGHOSDWULPRQLRDUFKHRORJLFRHFXOWXUDOHGHOODFLWWj/DFLWWjqLQIDWWL VWDWRRJJHWWRGLXQDQRUPDWLYDVSHFLDOHFKHQHKDULFRQRVFLXWRLOFDUDWWHUHGL³FLWWjPXVHR´7DOHQRUPDWLYDSHUDOWURDQFRUDYLJHQWHGH¿QL­ sce per buona parte della città tre regimi di trasformazione in relazione al rischio archeologico, come evidenziato nella tavola allegata. /D]RQD$LGHQWL¿FDOD]RQDDUFKHRORJLFDFKHFRPSUHQGHO¶DUHDVWRULFDUDFFKLXVDGDOOHPXUDEL]DQWLQHHXQDSDUWHGHOO¶DUHDFHQWUDOHD QRUGQHOODTXDOHJOLLQWHUYHQWLHGLOL]LVRQROLPLWDWLDGLQWHUYHQWLFKHQRQFRPSRUWDQRQXRYHDWWLYLWjGLVFDYR VRQRYLHWDWHOHQXRYHHGL¿FD]LR­ QLHJOLLQWHUYHQWLGLULQQRYRHGLOL]LRFKHFRPSRUWLQRULOHYDQWLLQWHUYHQWLQHOVRWWRVXROR /D]RQD%LGHQWL¿FDXQ¶DUHDGRYHVRQRSRVVLELOLQXR­ ve costruzioni, con il limite dello scavo archeologico preventivo, vincolato al parere di una Commissione mista composta da rappresentanti GHOO¶,VWLWXWR1D]LRQDOHGHL0RQXPHQWL&XOWXUDOLHGHOO¶,VWLWXWR$UFKHRORJLFR1D]LRQDOH/D]RQD&LQ¿QHLGHQWL¿FDXQDDUHDGHOODFLWWjGRYH ogni intervento edilizio che comporti lo scavo del sottosuolo, è comunque soggetta a controllo delle Autorità competenti durante tali attività. Tale normativa, come detto, è tuttora vigente, in quanto espressione di una legge dello Stato, e dunque il presente Piano la recepisce per intero. Si tratta, peraltro, di una perimetrazione in corso di revisione da parte dello stesso Istituto Nazionale dei Monumenti Culturali e GHOO¶,VWLWXWR$UFKHRORJLFR1D]LRQDOHFKHVWDQQRSURFHGHQGRDGXQDGLYHUVDDUWLFROD]LRQHGHOOH]RQH$%H&DQFKHLQUDJLRQHGHOOHSL UHFHQWLDWWLYLWjDUFKHRORJLFKHHDOOHFRQRVFHQ]HPDWXUDWHDQFKHLQUHOD]LRQHDJOLVFDYLFRQGRWWLLQRFFDVLRQHGHLSLUHFHQWLLQWHUYHQWLHGLOL]L condotti all’interno della città. Al tempo in cui, tramite provvedimento legislativo nazionale , la nuova perimetrazione, che si riporta a segui­ re, diventerà legge dello Stato, anche le norme del presente Piano si adegueranno, in relazione alla normativa sopraordinata. ,QSDUWLFRODUHORVWXGLREHQH¿FLDGHOFRQWULEXWRRIIHUWRGDOOD&DUWDGHO5LVFKLRDUFKHRORJLFRUHGDWWDGDOO¶8QLYHUVLWjGL3DUPD HTXLSHGLUHWWD dalla prof. Sara Santoro) e dai successivi studi e contributi conoscitivi. L’elaborato di piano n. 6 – Sistema di tutela e valorizzazione , raccoglie e rielabora tali contributi, anche in relazione alla normativa nazionale di riferimento, la nuova legge per la tutela del patrimonio culturale, n. 9048/2003, di cui intende costituire applicazione sperimentale. La tavola, in basso, riporta l’ elenco dei siti e dei reperti archeologici estratti dalla Carta del Rischio Archeologico redatta dall’Università di 3DUPDHXQDQDORJRHOHQFRGLEHQLFRUUHGDWRGLVFKHGHLGHQWL¿FDWLYHGHJOLHGL¿FLGLLQWHUHVVHVWRULFRDUFKLWHWWRQLFRGHO;,;H;;VHFROR Tale tavola, che ha un valore orientativo, essendo invece vincolanti gli elaborati di legge prima richiamati, articola la propria zonizzazione di indicazione del rischio archeologico in quattro livelli: OLYHOORURVVRDUHHQHOOHTXDOLOHDWWLYLWjHGLOL]LHKDQQRSUREDELOLWjWDOPHQWHHOHYDWDGLLQWHUFHWWDUHLPSRUWDQWLVWUDWL¿FD]LRQLDUFKHRORJLFKH GDUHQGHUQHDQWLHFRQRPLFDODVWHVVDSURJHWWD]LRQH OLYHOORDUDQFLRDUHHVRJJHWWHDVFDYRDUFKHRORJLFRVFLHQWL¿FRSUHYHQWLYRDVSHVHGHOO¶LPSUHVD OLYHOORJLDOORDUHHVRJJHWWHDVFDYRSUHYHQWLYRGLYHUL¿FD 4. livello blu: aree in cui le attività edilizie sono soggette a particolari controlli XQDFFXUDWRHOHQFRGHLVLWLHGHLUHSHUWLDUFKHRORJLFLFKHULPDQGDWUDPLWHQXPHURLGHQWL¿FDWLYRDOODORURLGHQWL¿FD]LRQHWRSRJUD¿FD VXOO¶HODERUDWR 43 La tavola, in basso, riporta nell’ordine: O¶LGHQWL¿FD]LRQHGHLVLWLGLLQWHUHVVHDUFKHRORJLFRVWRULFRHDUFKLWHWWRQLFRDQFKHLQUHOD]LRQH DOODORURGDWD]LRQHGDLVHFROLLQL]LDOLGHOO¶HWjFODVVLFD¿QRDLSULPLGHFHQQLGHOµVLDULJXDUGR ai siti certi, sia riguardo alle possibili ipotesi di presenze archeologiche (ipotesi di tracciato delle mura, ipotesi di tracciato della rete idrica e storica, ipotesi di tessuto urbano di origine RWWRPDQRDUHHDEDVVDGHQVLWjDUFKHRORJLFDWUDFFHDHURIRWRJUD¿FKHGLSRVVLELOLVLWLDUFKHROR­ JLFL  ODGH¿QL]LRQHGHLOLYHOOLGLWXWHODYLJHQWLHSURSRVWLSHULVXPPHQ]LRQDWLEHQL EHQLFXOWXUDOLOR­ FDOL]]DWLGDVRWWRSRUUHDRVVHUYD]LRQHULI$UWFRPPDDEHQLFXOWXUDOLORFDOL]]DWLVRWWRSRVWL RGDVRWWRSRUUHDWXWHODSUHYHQWLYDULI$UWFRPPDEEHQLFXOWXUDOLORFDOL]]DWLGLVHFRQGD FDWHJRULDULI$UWFRPPDFEHQLFXOWXUDOLORFDOL]]DWLGLSULPDFDWHJRULDULI$UWFRPPD G 3. la Normativa vigente e in itinere in materia di rischio archeologico, relativamente alle zone A H%SUHFHGHQWHPHQWHULFRUGDWH ODSURSRVWDLQLWLQHUHGHOODSHULPHWUD]LRQHGHO&HQWUR6WRULFRGL'XUD]]RVHFRQGROHLQGL­ cazioni dell’Istituto dei Monumenti Culturali e dell’Istituto Archeologico Nazionale, integrata da XQDSURSRVWDGLDOODUJDPHQWRGLWDOHSHULPHWUR XQDSURSRVWDGLFODVVL¿FD]LRQHGHLVLWLSUHFHGHQWHPHQWHLGHQWL¿FDWLFRPH³EHQLFXOWXUDOL localizzati”, ai sensi della legge 9.048 del 7 aprile 2003, “del patrimonio culturale” (complessi DUFKLWHWWRQLFLULI$UWFRPPDFRPSOHVVLVWRULFLULI$UWFRPPDFRPSOHVVLXUEDQLULI $UWFRPPDFRPSOHVVLXUEDQLVWLFLDUFKLWHWWRQLFLULI$UWFRPPDPRQXPHQWLULI$UW FRPPDRSHUHDUFKLWHWWRQLFKHGHWWLDQFKH³RJJHWWLXQLFL´DUWFRPPD]RQHDUFKHR­ ORJLFKHULI$UWFRPPDSDUFKLJLDUGLQLHRSHUHGLYDORUHSDHVDJJLVWLFRFRPHFDWHJRULD non contemplata nella legge 9.048, di cui si propone l’estensione). La tavola 06 e la presente norma orientano e guidano tutte le tipologie di intervento edilizio ammesse, nonché le modalità di scavo e controllo archeologico 44 5. Mobility system and facilities (excerpt of the table 7 of the plan) 1HOODWDYRODLO3LDQRGH¿QLVFHLOVLVWHPDLQIUDVWUXWWXUDOHDUWLFRODWR DFRQQHVVLRQLWHUULWRULDOL EFHQWULLQWHUPRGDOLHSDUFKHJJLGLYDOHQ]DWHUULWRULDOH c. circuiti turistici. Le connessioni territoriali ed urbane evidenziate nella tavola riguardano: ODOLQHDIHUURYLDULD'XUD]]R±7LUDQD LOFRUULGRLRGLPRELOLWjSXEEOLFDFRVWLHUR SHQGRORYHUGH SHQVDWRFRPHPLVXUDGLPRELOLWjDOWHUQDWLYD 3. la viabilità primaria di ingresso, che viene confermata nell’asse che dalla stazione porta al Parco dei Martiri della Resistenza, e che continua nel circuito che chiude, in corrispondenza della piazza centrale, per poi ricongiungersi alla viabilità di uscita dalla città rasente il ZDWHUIURQWRULHQWDOH ODUHWHGLYLDELOLWjVHFRQGDULDHVLVWHQWHHGLSURJHWWRWHVLDGDUHPLJOLRUHGLVWULEX]LRQHDJOLLVRODWLLQWHUQLGHOO¶DUHDFHQWUDOH 5. i tratti di viabilità da sottoporre a limitazioni d’uso: l’attuale corso Epidamnos di cui è plausibile la parziale pedonalizzazione e il tratto di YLDELOLWjGLVHUYL]LRDOZDWHUIURQWRFFLGHQWDOHGHOODFLWWjDQFKHLQUHOD]LRQHDOODUHDOL]]D]LRQHGHO³SHQGRORYHUGH´ 6. la rete di percorsi ciclo – pedonali, che interessa in particolare tutte le strade costiere e le strade interne di accesso e collegamento alle PHWHGLLQWHUHVVHVWRULFRFXOWXUDOH LSXQWLGLSRVVLELOHFRQQHVVLRQHWUDODFLWWjHLOSRUWR ODSURSRVWDGLXQDYLDELOLWjLQWHUQDDOO¶DUHDSRUWXDOH 9. il tracciato di una nuova viabilità comunale di bordo all’area portuale (area demaniale). ,FHQWULLQWHUPRGDOLHGLSDUFKHJJLRGLYDOHQ]DWHUULWRULDOHHGXUEDQDVRQRLGHQWL¿FDWLVHFRQGRWUHWLSRORJLH FRPHDUHHGLSDUFKHJJLRDUDVR FRPHSDUFKHJJLGLLQWHUVFDPELRPXOWLSLDQRLQWHUUDWL 3. come parcheggi a raso di valore urbano. 45 6. Transformation systems (excerpt of the table 9 of the Plan) La tavola 9 svolge un compito molto importante: quello di riassumere all’interno di un unico elaborato tutte le modalità di attuazione dispo­ ste dal Piano, così come già introdotto nelle apposite schede dei singoli Ambito di progettazione strategica. Queste riguardano: a. le aree di intervento diretto, cioè quelle aree dove l’intervento edilizio, proposto dai privati, non è delegato alla formalizzazione di un 3LDQRDWWXDWLYR EOHDUHHVRJJHWWHD&RPSDUWR8UEDQLVWLFRVLWUDWWDGLDUHHGLGLVFUHWDHVWHQVLRQHGRYHLOULODVFLRGLRJQLSHUPHVVRDFRVWUXLUHqVXERU­ GLQDWRDOODFRVWLWX]LRQHGLXQFRQVRU]LRWUDLSURSULHWDULGHOOHDUHHHGHJOLHGL¿FLHVLVWHQWLHDOODVWHVXUDVXORURFRPPLWWHQ]DGLXQ3LDQR XUEDQLVWLFRDWWXDWLYRGLFRPSDUWRLQDGHUHQ]DDOOHVSHFL¿FKHQRUPHGH¿QLWHQHOOH17$GHO3LDQRLQWHUPLQLGLVWDQGDUGXUEDQLVWLFLLQGLFL GLIDEEULFDELOLWjDOWH]]HPDVVLPHGHJOLHGL¿FLGLPHQVLRQLPDVVLPHDPPLVVLELOLHDFULWHULGLSHUHTXD]LRQHXUEDQLVWLFDSHULOULSDUWRGHOOH YROXPHWULHHODUHDOL]]D]LRQHGHLVHUYL]LSXEEOLFL c. le aree relative agli Ambiti di progettazione strategica, all’interno delle quali i singoli comparti attuativi o le singole altre aree soggette a UHJLPHVSHFLDOHGLWUDVIRUPD]LRQHGHYRQRVHJXLUHOHLQGLFD]LRQLGHL3URJHWWLVWUDWHJLFLGLFXLDOTXDGHUQR GOHDUHHVRWWRSRVWHD3LDQRGL5HFXSHURGLLQL]LDWLYDSXEEOLFDHRSULYDWDGDUHGLJHUHLQEDVHDOOHVSHFL¿FKH1RUPHWHFQLFKHGL$WWXD]LR­ QHGLFXLDOTXDGHUQR HOHDUHHVRWWRSRVWDD3LDQRGL5HFXSHURDOOHJDWRDOSUHVHQWH3LDQR8UEDQLVWLFR,QWHJUDWRGHOOD&LWWj9HFFKLDGL'XUD]]RQHOORVSHFL¿FRLO 3LDQRGL5HFXSHURSHUO¶DUHDXUEDQDGHOO¶DQ¿WHDWURGL'XUD]]R /¶HODERUDWRULSRUWDLQ¿QHDQFKHDOFXQHLQGLFD]LRQLSXQWXDOLUHODWLYHDOODSURSRVWDGLDOFXQLSDUWLFRODULHGL¿FLGDVRWWRSRUUHDGHPROL]LRQHR da sottoporre a ristrutturazione edilizia con salvaguardia dei caratteri generali dei fronti 46 7. Tourist and historical ­ cultural itineraries (excerpt of the table 10 of the Plan) ,O3LDQRSHUO¶DUHDFHQWUDOHGH¿QLVFHLQIRUPDRULHQWD­ tiva anche alcuni itinerari di interesse storico cultu­ rale, in relazione alla presenza di possibili mete di interesse. Tali itinerari hanno una caratterizzazione tematica, e tendono ad evidenziare la notevole pre­ senza di presenze monumentali non soltanto dell’età classica e bizantina, ma anche del periodo ottomano e del Novecento. 0ROWLSURJHWWLKDQQRWHQWDWR¿QRDGRUDGLFRQVLGH­ rare un uso propriamente turistico culturale dell’area centrale della città. Si tratta di una idea che merita di essere sorretta anche da misure di regolazione del WUDI¿FRHGLDGR]LRQHGLIRUPHGLPRELOLWjVRVWHQLELOL come evidenziato in alcuni dei “progetti strategici”, a puro valore indicativo, contenuti nel Piano, e che si spera possa trovare presto attuazione nelle scelte della nuova amministrazione locale. 1.8 Opportunities and risks/ Opportunità e rischi The projects of the Competition have to deal with the following themes of analysis and project: a. Archaeology and cultural heritage. It is important to consider and underline the archaeological, cultural and architectural heritage, according to the different historical period (Classic, Roman, Byzantine, 9HQHWLDQ2WWRPDQ7ZHQWLHWKFHQWXU\DJH DQGWRWKHH[LVWLQJSUHVHU­ vation rules. b. Green areas and ecological landscape importance. The proposed project must preserve the green areas of the study area for environ­ PHQWDODLPV7KHFRPSHWLWRUVPXVWUHVSHFWWKHODQGVFDSHTXDOLW\ they can change and innovate the street furniture without damaging WKHJUHHQDUHD)RUHDFKDFWLRQRIWUHHVUHPRYLQJVKRXOGEHDVVXUHG a new tree planting. c. Public events and outdoor displays. Each project must preserve and strengthen the use of the public space in relation with public and collective events and political, theatrical or musical displays.The squa­ re as a public and multi­functional space should be preserved. d. Integration and re­examination of the built elements. (the Mosque, WKH3DODFHRI&XOWXUHWKH7RZQ+DOOWKH/LEUDU\HWF 7KHSURMHFW must consider the current functions of the square and its surroundings and the urbanistic rules about the spaces and its functions (car parks, urban users, means of transport, pedestrian and cycle paths). e. Public and private mobility, street furniture and car parks Each proposal must attentively consider the functioning of the square and its urban surrounding according to the public and private mobility and particularly to the pedestrian and cycle mobility. Underground car parks are not expected. Each car park will have a determined exten­ VLRQDQGQXPEHU7KHUHZLOOEHDOVRVRPHVSHFL¿FFDUSDUNVIRUVWDWH employees and disabled persons. f. Ecological environmental and social sustainability of the project The proposals should take care to the ecological matters, considering the effects caused by the possible demolitions, digging, routine or extraordinary maintenances. The projects should confront with the themes of innovative technolo­ gies based on the control of the power consumption and the alternati­ ve sources of energy. 48 I progetti di concorso sono tenuti ad affrontare i seguenti temi di analisi e di progetto: a. Archeologia e patrimonio culturale Occorre dare opportuna considerazione alla valorizzazione del patrimonio archeologico, culturale e architettonico accertato e di possibile rinvenimento, in relazione ai diversi periodi di appartenenza (città classica, romana, bizantina, veneziana, ottomana, del primo Novecento), e all’attuale sistema di tutela vigente, anche in funzione di una piena valorizzazione di tali risorse in senso turistico culturale e a vantaggio di una loro piena integrazione urbana. b. Verde e continuità ecologico paesaggistica L’intervento proposto deve salvaguardate i livelli di verde attualmente presenti nell’area di studio, puntando ad un incremento delle dotazioni di van­ taggio ambientale, in relazione ad una maggiore disponibilità di spazi pubblici, e alla continuità ecologica e paesaggistica dell’area nelle sue relazioni urbane e territoriali. I concorrenti sono tenuti a rispettare la qualita’ paesaggistica e l’aspetto verde della piazza, nonche’ le modalita’ di ombreggiamento naturale, anche attraverso cambiamenti e innovazioni nella disposizione dell’arredo che pero’ non alterino e piuttosto innalzino la presenza di alberature, spazi verdi e arredi vegetali. 'HYHLQROWUHHVVHUHSUHYLVWDODPHVVDDGLPRUDLQ nuova sede di ogni alberatura di cui si ipotizza la sostituzione o l’eliminazione. c. Eventi pubblici e manifestazioni all’aperto Ogni sistemazione proposta deve salvaguardare e potenziare l’uso possibile dello spazio pubblico per eventi di carattere pubblico e collettivo, la possibilità di dare svolgimento a manifestazioni di carattere pubblico e politico, di tipo teatrale, musi­ FDOHHGLRJQLDOWURJHQHUHDUWLVWLFR'HYHHVVHUH inoltre salvaguardato il carattere della piazza di principale luogo pubblico, aperto, multifunzionale della città. In tal senso devono essere in ogni modo potenziate le relazioni funzionali, visive e di VLJQL¿FDWRFRQJOLDOWULOXRJKLSXEEOLFLGHOODFLWWj valorizzando la continuità e la coerenza di tale sistema urbano. d. Integrazione grandi contenitori funzionali: La proposta progettuale dovrà tenere in debito conto delle funzioni attualmente presenti nella SLD]]DHOXQJRLVXRLFRQ¿QLDQFKHSURSRQHQGR­ ne una parziale sostituzione, ma sempre in ragio­ ne di logiche di coerenza funzionale e simbolica. Tali proposte dovranno tenere conto anche delle domande attuali e previste degli spazi e delle fun­ zioni di servizio di tali attività (parcheggi dedicati, utenze urbane, connessione con le reti di traspor­ to pubblico e con le reti pedonali e ciclabili), nel rispetto delle norme urbanistiche vigenti. e. Mobilità pubblica e privata, arredo e politiche della sosta (eventuali parcheggi) Ogni proposta di progetto dovrà prendere in considerazione con la massima attenzione il fun­ zionamento della piazza e del settore urbano ad essa collegato nei termini della mobilità pubblica e privata, con particolare attenzione ai sistemi di mobilità pedonale e ciclabile, anche in attinenza a quanto disposto in materia dal Piano per l’Area Centrale della Città. Non sono previsti parcheggi interrati all’interno dell’area. Ogni destinazione a parcheggio dovrà avere carattere limitato per estensione e numero di posti e funzione diretta­ mente imputabile ad esigenze di tipo locale (par­ cheggi per pubblici dipendenti delle attrezzature pubbliche esistenti, parcheggi speciali, a tempo e tariffati). Una speciale attenzione dovrà natural­ mente essere dedicata al tema dell’accessibilità della piazza e delle funzioni ad essa dedicata alle persone diversamente abili, o caratterizzate da differenti capacità sensoriali e psico – motorie. 7KHDUHDRIWKHUHFHQWGLVFRYHU\RIWKH+HOOHQLVWLFOLJKWKRXVH L’area del recente ritrovamento del faro d’’età ellenistica. Top: Public abandoned areas near the perimeter of the Byzantine walls/ In alto: Aree pubbliche abbandonate a ridosso del perimetro delle mura bizantine. Above: high­density buildings under construction near the southern waterfront/ ,QEDVVRHGL¿FLDGDOWDGHQVLWjDELWDWLYDLQFRVWUX]LRQHDULGRVVRGHOZDWHUIURQWPHULGLRQDOH f. Sostenibilità ecologico ambientale e sociale del progetto 'RYUDQQRHVVHUHLQ¿QHWHQXWHLQPDVVLPDFRQVL­ derazione tutte quelle soluzioni tecnico progettuali in grado di ridurre l’impronta ecologica delle sistemazioni proposte, in considerazione sia degli impatti prodotti per gli interventi (eventuali demoli­ ]LRQLVFDYLUHLQWHUULPRYLPHQWLGLVXRORPDWHULDOL impiegati e loro provenienza, peso ecologico ed “etico” dei materiali e delle tecniche impiegate), sia degli eventuali impatti prodotti a sistemazioni avvenute, in ragione delle opere di manutenzione ordinaria e straordinaria delle opere realizzate, nonché dei consumi energetici necessari. Sono in ragione di ciò ampiamente attesi interventi a bas­ so consumo energetico o che facciamo esplicito utilizzo di tecnologie innovative basate sull’utilizzo delle fonti energetiche rinnovabili e sul controllo delle emissioni ad effetto serra. 49 1.9 Plan programme and site analysis/ Programma di progetto e analisi del sito 50 In relation to the production of works of the competition for the second phase will be made available to competing information, data and maps available: In relazione alla produzione degli elaborati del concorso per la seconda fase della competizione verranno messi a disposizione dei concorrenti LQIRUPD]LRQLGDWLHFDUWRJUD¿HUHODWLYHD ­ Use of land ­ Public Properties ­ Existing parking spaces ­ Public transport links, existing and planned ­ Plan listed the square ­ Materials and prevalent types ­ Survey of Green ­ Networks underground infrastructure (water and waste water net­ works, electricity networks public and private telephone networks and telecommunications systems, power grids and gas, cable, wireless internet service) ­ Public furniture ­ Collect solid waste and municipal )DPRXVPRQXPHQWVDQGSODFHVRILGHQWLW\ ­ Public Safety 'HPROLWLRQDQGQHZFRQVWUXFWLRQ ­ Usi del suolo ­ Proprietà pubbliche ­ Parcheggi esistenti ­ Linee di trasporto pubblico, esistenti e program­ mate ­ Piano quotato della piazza ­ Materiali e tipologie prevalenti ­ Rilievo del verde ­ Reti infrastrutturali sotterranee (reti di adduzione e smaltimento idrico, reti elettriche pubbliche e SULYDWHUHWLWHOHIRQLFKHHVLVWHPLGLWHOHFRPXQL cazione, reti energetiche e del gas, reti cablate, wireless internet service) ­ Arredi pubblici 5DFFROWDUL¿XWLVROLGLHXUEDQL ­ Monumenti celebrativi e luoghi identitari ­ Sicurezza pubblica 'HPROL]LRQLHQXRYHFRVWUX]LRQL ,QUHODWLRQWRWKH¿UVWVWDJHRIWKHFRPSHWLWLRQHQWUDQWVZLOOEHQH¿W from the information gathered in this announcement and will be made available in the form of graphical representations and measurements, RQWKHRI¿FLDOZHEVLWHRIWKHFRPSHWLWLRQ http://www.iliriasquarecompetition.org/ In relazione alla prima fase del concorso i concor­ UHQWLSRWUDQQREHQH¿FLDUHGHOOHLQIRUPD]LRQLUDF­ colte nel presente bando e che verranno messe a disposizione, anche in forma di rappresentazioni JUD¿FKHHULOLHYLVXOVLWRXI¿FLDOHGHOFRQFRUVR http://www.iliriasquarecompetition.org/ 1.10 Budget and condition of programme realization/ Budget e condizioni di attuazione del programma 7KHPXQLFLSDODGPLQLVWUDWLRQRI'XUUHVKDVHVWLPDWHGDQLQYHVWPHQW of 5 million euros in all in the project for the public works (architectural and green areas of public properties layout). The public areas involved in this intervention measure about 25.000 square metres in all. This area is about a half of the empty spaces of Skandenberg square, in Tirana, where the local administration, precisely on the occasion of the recent international Competition, has estimated an investment of 10 million euros in all. ,QWKH¿UVWSKDVHRIWKH&RPSHWLWLRQWKHFRPSHWLWRUVKDYHWKHSRVVL­ bility of showing some pre­feasibility studies in which they can expect WKHSDUWLFLSDWLRQRISULYDWHVXEMHFWVLQWKH¿QDQFLQJRIWKHSXEOLFZRU­ ks of the project: it is also possible to suppose exchanges between public and private properties in the event of consolidating the public KHULWDJHHVSHFLDOO\IRUWKHEHQH¿WRIWKHDUHDVRIDUFKDHRORJLFDO cultural, historical and landscape interest, within the more general idea of urban regeneration. In the second phase of the Competition, the groups selected are re­ quired to submit, to support the hypothesis of pre­feasibility advanced LQWKH¿UVWSKDVHDGHWDLOHGFKHFNRIERWKWKHFRVWVRIZRUNVSODQQHG and of any acquisitions of public areas, and of the urban and admini­ strative procedures necessary and appropriate. /¶$PPLQLVWUD]LRQH&RPXQDOHGL'XUD]]RKD stimato un investimento complessivo nel progetto per le sole opere pubbliche (sistemazione architettonica e degli spazi verdi delle aree già di proprietà pubblica) di circa 5 milioni di euro. Le aree pubbliche interessate dall’intervento VYLOXSSDQRXQDVXSHU¿FLHFRPSOHVVLYDGLFLUFD PT7DOHVXSHU¿FLHUDSSUHVHQWDFLUFDOD PHWjGHOOHVXSHU¿FLOLEHUHGL3LD]]D6NDQGHQ­ berg, a Tirana, dove la locale Amministrazione, proprio in occasione del recente Concorso inter­ nazionale, ha stimato un investimento complessi­ vo di 10 milioni di euro. Nella prima fase del Concorso, i concorrenti possono presentare studi di prefattibilità in cui prevedere la partecipazione di soggetti privati nel ¿QDQ]LDPHQWRGHOOHRSHUHSXEEOLFKHGLSURJHWWR E’ possibile anche ipotizzare permute tra proprie­ tà pubbliche e private, nell’ipotesi di consolidare il patrimonio pubblico, soprattutto a vantaggio di aree di interesse archeologico, storico, culturale HSDHVDJJLVWLFRDOO¶LQWHUQRGHOODSLJHQHUDOH LSRWHVLGLULTXDOL¿FD]LRQHDYDQ]DWD Nella seconda fase del Concorso, i gruppi sele­ zionati sono tenuti a presentare, a supporto delle ipotesi di pre fattibilità avanzate nella prima fase, XQDDFFXUDWDYHUL¿FDWDQWRGHLFRVWLGHOOHRSHUH previste quanto delle eventuali acquisizioni di aree a vantaggio pubblico, nonché delle procedu­ UHXUEDQLVWLFKHHDPPLQLVWUDWLYHQHFHVVDULHHSL opportune. 51 1.11 Organization of the competition/ Organizzazione del concorso 7KH&RPSHWLWLRQGXULQJLWVWZRSKDVHVEHQH¿WVE\ DTXDOL¿HGDQGPXOWLGLVFLSOLQDU\FRPPLWWHHRIH[SHUWVIRUWKHGUDI­ ting of the notice of competition and the prior research into the project. DMXU\PDGHXSRIZHOONQRZQLQWHUQDWLRQDOH[SHUWVLQWKH¿HOGVRI the urban planning, architectural design and composition, economi­ FDODQG¿QDQFLDOIHDVLELOLW\RIWKHSURMHFWVDUFKDHRORJ\UHVWRUDWLRQ protection and enhancement of cultural heritage, urban and landscape ecology. 3. a committee of sponsors and promoters of the initiative, composed of representatives of professional associations, banks, local entre­ preneurs, who are all committed to donors and contributions in work done for the full success of the initiative, in the different phases of the promoting of the competition, of the design (assistance and hospitality of the groups invited to the second phase, facilitating and participation activities of the inhabitants for the construction of the project propo­ sals), of the circulation and publication of the results (publication in the press, website of the competition, spreading through the national and international media). 7KHFRPSHWLWLRQWDNHVSODFHLQ'XUHVV7KHKHDGRIWKHSURFHGXUHLV WKH9LFH0DMRURIWKHWRZQ,QJ$GULDQ&HODKHOSHGE\WKHDUFKLWHFW RIWKHPXQLFLSDOXUEDQRI¿FH,QD;KDNRQL7KHFRPSHWLWLRQVHFUHWDULDW FROODERUDWHVZLWK,1$5&+LWVVWUXFWXUHVDQGH[SHUWV Above: Central area, except from IGM: On the right: Central area, except froma Topographic map, 1978/ ,QEDVVR$UHDFHQWUDOHHVWUDWWRGDFDUWRJUD¿D,*0$GHVWUDDUHDFHQWUD­ OHHVWUDWWRGD&DUWDWRSRJUD¿FD Il Concorso si avvale, durante le due fasi della competizione, di: XQSRROGLHVSHUWLTXDOL¿FDWRHPXOWLGLVFLSOLQDUH per la elaborazione del bando e la ricerca prelimi­ nare al progetto 2.una giuria composta da esperti internazionali di chiara fama, scelti all’interno dei campi dell’ur­ banistica, della progettazione e composizione DUFKLWHWWRQLFDGHOODIDWWLELOLWjHFRQRPLFR¿QDQ]LD­ ria dei progetti, dell’archeologia, del restauro e della tutela e della valorizzazione del patrimonio FXOWXUDOHGHOO¶HFRORJLDXUEDQDHGHOSDHVDJJLR 3.un comitato di sponsor e di promotori dell’inizia­ tiva, composto da rappresentati di associazioni professionali, istituti bancari, imprenditori locali, che si impegnano, anche attraverso donors e contributi in prestazioni d’opera, al pieno successo dell’iniziativa, nelle distinte fasi della promozione del concorso, dell’attività di proget­ tazione (assistenza e ospitalità dei gruppi invitati alla seconda fase, attività di facilitazione e di partecipazione degli abitanti alla costruzione delle proposte progettuali), della diffusione e pubblicazione dei risultati (pubblicazione a mezzo stampa, sito web del concorso, diffusione attraverso i media nazionali ed internazionali). ,O&RQFRUVRKDVHGHSUHVVRODFLWWjGL'XUD]]R,O responsabile del procedimento è il vice sindaco della città, ing. Adrian Cela, coadiuvato nella sua DWWLYLWjGDOO¶DUFK,QD;KDNRQLGHOO¶8I¿FLR8UED­ nistico Municipale. La segreteria del Concorso si DYYDOHGHOODFROODERUD]LRQHGL,1$5&+GHOOHVXH strutture e dei suoi esperti. 1.12 First phase ­ admittance conditions and inquiries/ Prima fase. Condizioni di accesso e richieste The Competition is organized in two phases. ,QWKH¿UVWSKDVHDOOWKHLQGLYLGXDOSURIHVVLRQDOVDGPLWWHGWRWKH Competition, have to hand a preliminary project and a perso­ nal or group curriculum to the jury. The aim is to show the own TXDOL¿FDWLRQDQGH[SHULHQFHLQWKHPDWWHUDORQJVLGHZLWKWKH ¿UVWLGHDVRILQWHUYHQWLRQDQGWKHRZQSHUVRQDODSSURDFKWRWKH VTXDUHGHVLJQ7KHMXU\RIWKH¿UVWSKDVHKHOSHGE\WKHH[SHUWV responsible for the notice of Competition and for the Competition planning, will value the preliminary project and the curricula and ZLOOSUHSDUHDVKRUWOLVWRIQRPRUHWKDQ¿YH  JURXSVDGPLW­ WHGWRWKHVHFRQGSKDVHRIWKH&RPSHWLWLRQ7KH¿QDOLVWJURXSV admitted to the second phase of the Competition will receive at the end of this phase the sum of 10.000 euros each. This sum will be an advance for the winner group of the Competition that will have the working assignment, and the total sum of 200.000 euros as a remuneration for the professional performance. The SDUWLFLSDWLRQWRWKH¿UVWSKDVHRIWKH&RPSHWLWLRQLVIUHH$OOWKH SURIHVVLRQDOFRPSHWHQW¿JXUHVFDQDWWHQGWKH&RPSHWLWLRQ7KH participation of groups composed of different individual profes­ VLRQDOVLVDOVRZHOFRPH,QWKH¿UVWSKDVHRIWKH&RPSHWLWLRQ each group has to hand, within the time prescribed by the notice of Competition (no later than September 25) the following docu­ ments and support drawings: 1. a statement in paper stating the composition of the group, with the nomination of the team leader or a legal representative, DQGDOOWKHSURIHVVLRQDOTXDOL¿FDWLRQVZLWKDQ\UHJLVWUDWLRQVWR WKHUHVSHFWLYHSURIHVVLRQDORUGHUV 2. a project report, A4 size, indicating the aims, strategies and the intervention actions planned, alongside with some pre­feasi­ ELOLW\GLUHFWLRQVRIWKHLQWHUYHQWLRQVSURSRVHG 3. 3 drawings, A3 size, free composition, able to demonstrate WKHLQWHQWLRQVDQGWKH¿UVWSODQQLQJOLQHVSURSRVHGE\WKHJURXS Sketches, schemes, photos and functional diagrams are suitable IRUWKLVSXUSRVHGHWDLOHGGUDZLQJVRUSODQLPHWULHVRIWKHDUHD concerned are not expressly required in this phase. The designers have to think about the reason why it is neces­ sary an intervention in Liria Square and its contiguous spaces, and how this intervention can be executed and in particular what can be carried out for the revitalization of the square and of the urban centre of the town. Incompatibility conditions to participation at the Competition. Those who have family ties just to the third degree kinship or business relations of a continuous nature with the members of WKHMXU\WKHDGPLQLVWUDWRUVRIWKH0XQLFLSDOLW\RI'XUUHVRUWKH experts which have collaborated to the drawing up of this notice of Competition are not admitted to participate at the Competition. Il Concorso è organizzato in due fasi. Nella prima fase, tutti i professionisti ammessi alla partecipazione sono invitati a sottomettere alla valutazione della Giuria, un progetto preliminare e il loro curriculum personale o di gruppo. Lo scopo è quello di manifestare, assieme alle prime idee di intervento e al proprio personale approccio DOSURJHWWRGHOODSLD]]DDQFKHODSURSULDTXDOL¿FD]LR­ ne ed esperienza in materia. La Giuria di prima fase, assistita dagli esperti coinvolti nella stesura del bando e nella progettazione del Concorso, valuterà il progetto preliminare e i curricula presentati, e preparerà una VKRUWOLVWGLQRQSLGLFLQTXH  JUXSSLFKHVDUDQQR ammessi alla seconda fase del Concorso. I gruppi ¿QDOLVWLDPPHVVLDOODVHFRQGDIDVHGHO&RQFRUVR riceveranno al termine di tale fase la somma di 10.000, 00 euro cadauno. Tale somma costituirà un anticipo per il gruppo vincitore del Concorso, cui verrà attribuito l’incarico per la progettazione esecutiva dell’opera, e la somma complessiva di 200.000,00 euro come compenso complessivo della prestazione professionale svolta. La partecipazione alla prima fase del Concorso è libera e gratuita. Possono partecipare al Concorso di SULPDIDVHWXWWHOH¿JXUHSURIHVVLRQDOLXWLOLHFRPSHWHQWL a ben svolgere le richieste del Concorso. E’ tuttavia ben valutata la partecipazione di gruppi composti da diverse professionalità, in attinenza ai temi di concorso indicati nel punto 8 del bando. Nella prima fase del concorso, ogni gruppo concorrente dovrà consegnare, nei termini del Bando, i seguenti documenti ed elaborati progettuali: 1.una dichiarazione in carta semplice indicante la com­ posizione del gruppo, con la nomina del capogruppo o OHJDOHUDSSUHVHQWDQWHHWXWWHOHTXDOL¿FKHSURIHVVLRQDOL FRQHYHQWXDOLLVFUL]LRQLDLULVSHWWLYL2UGLQL3URIHVVLRQDOL 2. una relazione di progetto, in formato A4, indicante gli obiettivi, le strategie e le azioni di intervento previ­ ste, assieme ad alcune indicazioni di prefattibilità degl LQWHUYHQWLSURSRVWL QHODERUDWLJUD¿FLLQIRUPDWR$DFRPSRVL]LRQH libera, atte a dimostrare le intenzioni e le prime linee progettuali proposte dal gruppo. Sono appropriate a questo scopo tecniche di rappresentazione quali schizzi, VFKHPLIRWRJUD¿HHGLDJUDPPLIXQ]LRQDOLQRQVRQR richieste invece espressamente in questa fase disegni dettagliati né planimetrie dell’area di progetto. I proget­ tisti sono invitati a rispondere alla domanda del perché si ritiene necessario un intervento sulla piazza Liria e sui suoi spazi associati, su come questo intervento può essere fatto e cosa può essere realizzato per rivitalizza­ re la piazza. Condizioni di incompatibilità alla partecipazione al concorso. Non sono ammessi a partecipare al concorso tutti coloro FKHDEELDQRYLQFROLGLSDUHQWHOD¿QRDOWHU]RJUDGR nonche’ rapporti di lavoro a carattere continuativo con i membri della giuria, gli amministratori in carica del &RPXQHGL'XUD]]RRFRQJOLHVSHUWLFKHKDQQR collaborato alla stesura del presente bando di concorso. 53 1.13 Second phase ­ admittance conditions and inquiries/ Seconda fase. Condizioni di accesso e richieste The groups admitted to the second phase of the Competition are re­ TXLUHGWRSURGXFHDGH¿QLWLYHSURMHFWWRDSUHFLVHDQGGHWDLOHGVFDOH DFFRUGLQJWRDZRUNSURJUDPPHWKDWZLOOEHGH¿QHGDWWKHHQGRIWKH ¿UVWSKDVHRIWKH&RPSHWLWLRQHYHQLQUHODWLRQZLWKWKHLGHDVDQGWKH ¿UVWSURSRVDOVFROOHFWHG)LUVWRIDOOWKHSURMHFWLVH[SHFWHGWREHFDUUL­ ed out in no fewer than 5 tables A0 size, completed with a plastic to a suitable scale (no fewer than scale 1:500), a technical planning report with the necessary economical and feasibility estimates. The groups admitted to the second phase of the Competition have to declare at the moment of their acceptance for the participation at this phase of the Competition the presence of the following professional ¿JXUHV 1. general architect 2. landscape architect 3. archaeologist 4. urban network engineer 5. expert of feasibility of urban projects 6. artist (visual and communication Arts) I gruppi ammessi alla seconda fase di concorso VDUDQQRWHQXWLDSUHVHQWDUHXQSURJHWWRGH¿QLWL­ vo, in scala accurata e di dettaglio, secondo un SURJUDPPDGLODYRURFKHYHUUjGH¿QLWRDOWHUPLQH della prima fase di concorso, anche in relazione alle idee e alle prime proposte raccolte.In prima istanza, si prevede che tale progetto dovrà essere svolto in non meno di 5 tavole di formato A0, corredate da un plastico di scala adeguata (non meno di scala 1:500), di una relazione tecnico progettuale, corredata delle necessarie stime economiche e di fattibilità.I gruppi ammessi alla seconda fase di concorso dovranno dichiarare al momento della loro accettazione alla partecipa­ zione di tale fase di concorso la presenza delle VHJXHQWL¿JXUHSURIHVVLRQDOL 1. architetto generalista 2. architetto paesaggista 3. archeologo 4. ingegnere delle reti urbane 5. esperto di fattibilità dei progetti urbani 6. artista (arti visive e della comunicazione) (YDOXDWLRQSURFHGXUHVRIWKHÀUVWDQGVHFRQGSKDVH Procedure di valutazione della prima e seconda fase The jury will examine the proposals according to their quality, innova­ tion and connection with the themes of the Competition listed in the announcement (paragraph 8). The jury of both stages will be made XSRIZHOONQRZQH[SHUWVLQPXOWLGLVFLSOLQDU\¿HOGVLQUHODWLRQZLWK the theme of the Competition and with the competitors’ proposals. 7KHMXU\SUHVLGHGRYHUWKH0DMRURI'XUUHVZLOOEHFRPSRVHGRIWKH Minister of the Public Works, Republic of Albania, the National Institute of Monument, the Archaeological Institute of Albania and some representatives of the Albanian Universities.This representa­ tion will have a different importance for the judgment compared to WKHLQWHUQDWLRQDOPHPEHUVRIWKH&RPSHWLWLRQ7KH,1$5&+ZLOOEHD supervisor and a guarantor for the quality of the Jury and for its HYDOXDWLRQV7KHUHVXOWVRIWKH&RPSHWLWLRQERWKWKH¿UVWVWDJHDQG WKHVHFRQGRQHRIZLOOEHDYDLODEOHRQWKHRI¿FLDOZHEVLWHRI 0XQLFLSDOLW\RI'XUUHVDQGRQWKHRI¿FLDOZHEVLWHRIWKH&RPSHWLWLRQ 54 La giuria esaminerà le proposte in ragione della loro qualità, innovazione e attinenza ai temi di concorso proposti nel bando e in particolare nel punto 8. La Giuria sarà composta da esperti di fama internazionale, provenienti da diversi settori disciplinari, in relazione ai temi oggetto del FRQFRUVR/D*LXULDSUHVLHGXWDGDO6LQGDFRGL'X­ razzo, vedrà presenti rappresentanti del Ministero dei Lavori Pubblici della Repubblica di Albania, dell’Istituto Nazionale dei Monumenti e dell’Istituto di Archeologia di Albania e di rappresentanti delle Università albanesi.Tale rappresentanza peserà in termini percentuali, in misura inferiore al peso della componente internazionale del Concorso. /¶,1$5&+VYROJHUjXQUXRORGLVXSHUYLVLRQHH garante della qualità della Giuria e dei risultati dei suoi lavori. I risultati della competizione verranno UHVLQRWLDWWUDYHUVRLOVLWRXI¿FLDOHGHO&RPXQHGL 'XUD]]RHLOVLWRXI¿FLDOHGHO&RQFRUVR 1.15 Administrative contract/ Contratto amministrativo The administrative contract conditions for the carrying out of the Executive Project to the winner group of the second stage of the competition will obey the laws in force, even in relation with the international rules. These contract conditions will be published on the website of the Competition before the launch of the second stage of WKH&RPSHWLWLRQ7KH0XQLFLSDO$GPLQLVWUDWLRQRI'XUUHVWKH%LGGLQJ $XWKRULW\LQWHQGVWRHQWUXVWWKH'LUHFWLRQRIWKH:RUNZLWKWKHQRU­ mal tendering procedures. The works will tender in accordance with the normal law procedures. The Municipal Administration, since the technical and planning complexity and the innovation of the solutions proposed by the winner group, will give them the task of the Artistic Supervision of the works. Le condizioni di contratto amministrativo in relazione all’aggiudicazione del contratto per l’esecuzione del Progetto esecutivo al Gruppo vincitore della seconda fase del concorso verranno stabilite nel rispetto delle norme vigenti, anche in relazione alle norme internazionali in materia, e verranno comunicate sul sito del concorso prima dell’avvio della seconda fase del concorso. L’Amministrazione Comunale di 'XUD]]RHQWHEDQGLWRUHGHO&RQFRUVRVLULVHUYD GLDI¿GDUHOD'LUH]LRQH/DYRULGHOO¶2SHUDWUDPLWH normali procedure di gara. I lavori verranno messi a gara secondo le normali procedure di legge. L’Amministrazione, in ragione della complessità tecnico progettuale e dell’innovazione delle so­ luzioni proposte dal progetto vincitore, si riserva l’opportunità di incaricare il gruppo autore del SURJHWWRGHOOD'LUH]LRQH$UWLVWLFDGHOOHRSHUH 1.16 Calendar of the competition/ Calendario della competizione July 2, 2008: Conference for the presentation of the initiative in Turin (XXIII UIA World Congress of Architecture) and opening of the enrolments in the ¿UVWSKDVHRIWKHFRPSHWLWLRQZHEVLWHSUHVHQWDWLRQ&'520DQG 9LGHRVWRU\ July 2 – July 21, 2008: Implementation of the web site of the competition with graphic mate­ rials and texts July and August, 2008: Guided tours to the places of the competition ­ listening seminars and participation to the project September 25, 2008: 'HDGOLQHIRUVXEPLWWLQJGUDZLQJVIRUWKH¿UVWSKDVH WKUHH$VL]H tables, report of the preliminary lay­out, curriculum of the design JURXS 7KHGHOLYHU\RIWKHGUDZLQJVFHUWL¿HVHYHQWKHHQUROPHQWWR WKHFRPSHWLWLRQ7KHFRQGLWLRQVRIGHOLYHU\ZLOOEHGH¿QHGLQWKHRI¿FLDO notice of competition, available in the website www.iIliriasquarecompetition.org September 27, 2008 (Forum delle Città Adriatiche e dello Ionio): (YDOXDWLRQRIWKH¿UVWSKDVHSURMHFWV3URFODPDWLRQRIWKH¿UVWSKDVH UHVXOWV&RQIHUHQFHDQGH[KLELWLRQRIWKHSURSRVDOVRIWKH¿UVWSKDVH± Launch of the second phase of the competition 2 Luglio 2008: conferenza di presentazione dell’iniziativa a Tori­ no, (XXIII UIA World Congress of Architecture) e apertura iscrizioni alla prima fase del concorso – SUHVHQWD]LRQHVLWRZHE&'URPH9LGHRUDFFRQWR 2 Luglio – 21 Luglio 2008: implementazione sito del concorso con materiali JUD¿FLHWHVWL Luglio e Agosto 2008: visita guidata ai luoghi del concorso – seminari d’ascolto e partecipazione al progetto 25 Settembre 2008: termine consegna elaborati prima fase (tre tavole A3, relazione del progetto preliminare, curriculum gruppo di progettazione) Entro 27 Settembre 2008: 9DOXWD]LRQHSURJHWWLSULPDIDVH 27 Settembre 2008 (Forum delle Città adriatiche e dello Ionio): Proclamazione risultati prima fase del concorso Avvio seconda fase del Concorso 27 settembre – 28 ottobre 2008 Attività di partecipazione e discussione pubblica delle proposte selezionate (forum telematico, questionari, forum tematici con soggetti di interes­ se, associazioni e cittadini) 55 September 29 to October 28, 2008: Public participation activities and discussion of selected proposals (telematic forums, questionnaires, thematic forums with subjects of interest, associations and citizens) December 28, 2008: deadline for the submitting drawings of the second phase of the com­ SHWLWLRQ7KHFRQGLWLRQVRIGHOLYHU\ZLOOEHGH¿QHGLQWKHRI¿FLDOQRWLFH of competition, available in the website www.iIliriasquarecompetition.org January 28, 2009: Proclamation of the winner project 28 Dicembre 2008: Termine consegna elaborati 2° fase del Concorso 28 ennaio 2009: Proclamazione progetto vincitore (in relazione all’approvazione del nuovo bilancio comunale 1.17 Support drawings/ (ODERUDWLJUD¿FLGLVXSSRUWR 1. Basic cartography 1.1 Satellite map of the area and of the study context 1.2 Central area setting, A3 size table, scale 1:5000 1.3 Urban setting, A3 size table, scale 1:2000 )UHHGRP6TXDUHDQGDGMDFHQWDUHDV$VL]HWDEOHVFDOH 2. Satellite map graphic elaborations, updating )UHHGRP6TXDUHDQGDGMDFHQWDUHDVFXUUHQWVWDWHGLPHQVLRQHG plan, A3 size table, scale 1:1000 )UHHGRP6TXDUHGLPHQVLRQHGSODQFXUUHQWVWDWH$VL]HWDEOH scale 1:500 3.Photographic relieves 3.1 Photo composition relief of A3 size table 3.2 Photo composition relief of A3 size table 3.3 Photo composition relief of A3 size table 3.4 Photo composition relief of A3 size table the Northern side front of the square, the Southern side front of the square, the Western side front of the square, the Eastern side front of the square, 4. Details of map (Central area plan of Durres – PACD­ KRTSh, Octber 6, 2008) 'HWDLODQGXSGDWLQJRIWKHFXUUHQWDQGODZVWDWHWDEOHV (except of the table 2 of the plan) 4.2 Structural directions (excerpt of the table 3 of the plan) 4.3 Urban standard (excerpt of the table 5 of the plan) 4.4 Restrictions of archaeological and monumental protection (excerpt of the table 6 of the plan) 4.5 Mobility system and facilities (excerpt of the table 7 of the plan) 4.6 Transformation systems. Priority intervention (excerpt of the 56 &DUWRJUD¿DGLEDVH 1.1 Ortofoto dell’area e del contesto di studio, 2007 1.2 Inquadramento area centrale, tavola A3, scala 1:5.000 1.3 Inquadramento settore urbano, tavola A3, scala 1:2.000 1.4 Piazza della Libertà e aree adiacenti, A3, scala 1:1.000 (ODERUD]LRQLJUD¿FKHGDRUWRIRWRFRQ aggiornamenti 2.1 Piazza della Libertà e aree adiacenti, stato di fatto, piano quotato, A3 scala 1:1.000 2.2 Piazza della Libertà, piano quotato, stato di fatto, A3 scala 1:500 3. Foto rilievi )RWRFRPSRVL]LRQHULOLHYRIURQWHSLD]]DODWR Nord, formato A3 )RWRFRPSRVL]LRQHULOLHYRIURQWHSLD]]DODWR Sud, formato A3 )RWRFRPSRVL]LRQHULOLHYRIURQWHSLD]]DODWR Ovest, formato A3 )RWRFRPSRVL]LRQHULOLHYRIURQWHSLD]]DODWR(VW formato A3 4. Estratti elaborati del Piano dell’area centrale di Durazzo KRTSh, 28 ottobre 2008 4.1 Estratto e aggiornamento tavola stato di fatto e GLGLULWWR WDYROD3$&' 4.2 Indicazioni strutturali (stralcio tavola 3 di Piano) 4.3 Standard urbanistici (stralcio tavola 5 di Piano) 9LQFROLGLWXWHODDUFKHRORJLFDHPRQXPHQWDOH (stralcio tavola 6 di Piano) 9LDELOLWjHVHUYL]L VWUDOFLRWDYRODGL3LDQR 4.6 Regimi di trasformazione. Interventi prioritari (stralcio tavola 9 di Piano) table 9 of the plan) 4.7 Tourist and cultural itineraries (excerpt of the table 10 of the plan) 4.7 Itinerari turistico – culturali (stralcio tavola 10 di Piano) 5. Cartography of competition ,GHQWL¿FDWLRQFRPSHWLWLRQDUHD$VL]HWDEOHVFDOH 5.2 Public properties map, A3 size table, scale 1:1000 5.3 Concept, A3 size table, scale 1:1000 &DUWRJUD¿DGLFRQFRUVR ,GHQWL¿FD]LRQHDUHDGLFRQFRUVR$VFDOD 1:1.000 5.2 Carta delle proprietà pubbliche, A3 scala 1:1.000 5.3 Schemi direttori di progetto, A3 scala 1:1.000 6. Historical cartographies &DUWRJUD¿HVWRULFKH 1.18 Application forms for the competition/ Moduli di partecipazione &RPSHWLWRUVLQWKH¿UVWSKDVHRIWKHFRPSHWLWLRQPXVWVXEPLW their documentation for the competition in a sealed envelope, PDUNHGRQO\E\DPRWWRLGHQWL¿FDWLRQFRPSHWLQJJURXSWKH following documents: a) Project Report, a maximum of 6 typed pages in A4 format PD\LQFOXGHDGGLWLRQDOVNHWFKHVDQGGUDZLQJVE QQWDEOHV A3, relating to the proposed project, according to the informa­ WLRQVSHFL¿HGLQSDUDJUDSKRIWKLVQRWLFHF D&'FRQWDL­ ning the same elaborated in paragraphs a) and b), without DQ\RWKHULGHQWLI\LQJPDUNRIWKHZRUGRQSDLQRIGLVTXDOL¿­ cation. d) a sealed envelope, with the only motto that says JURXSLGHQWL¿HUFRQWDLQLQJDGHFODUDWLRQRQSODLQSDSHU 7KHPRWWRRIWKHSURMHFWWKHGDWHRIFRPSOHWLRQRIWKHSURMHFW EHIRUH6HSWHPEHU 7KHQDPHRIDQ\SDUHQWRU OHJDOUHSUHVHQWDWLYHRIWKHJURXS$OLVWRIHYHU\PHPEHURI that group, including the general master data of each of the SURIHVVLRQDOTXDOL¿FDWLRQDQGSRVWDODGGUHVVHVDQGHPDLO In this document will then be attached in the same sealed envelope, the curriculum of different part of that group. This document must specify the works consistent with the theme of the competition, analyzed in short, with any photographs or drawings, even relative to the works or planned. This documentation will prevent later than 24.00 hours of the day September 25, 2008 at the following address: Ing Adrian Cela 0XQLFLSDOLW\RI'XUUHV'XUUHV$OEDQLD with the subject shown in the upper left corner of the envelope: ILIRIA SQUARE COMPETITION Competition Secretariat: 5(&(37,212)),&(2)7+(&217(67 ,1$;+$.21,85%$1,67,&2)),&(081,&,3$/,7<2) '855(6 I Concorrenti alla prima fase di concorso sono tenuti a trasmettere la loro documentazione di partecipazione al concorso in busta chiusa, contrassegnata solo da un motto LGHQWL¿FDWLYRGHOJUXSSR concorrente, i seguenti elaborati: a) Relazione di progetto, di massimo 6 cartelle dattiloscritte in formato a4 eventualmente comprensive di schizzi e GLVHJQLLQWHJUDWLYLE QQWDYROHLQIRUPDWR$UHODWLYHDOOD SURSRVWDGLSURJHWWRVHFRQGROHLQGLFD]LRQLVSHFL¿FDWHDO SXQWRGHOSUHVHQWHEDQGRF XQ&'FRQWHQHQWHJOLVWHVVL HODERUDWLGLFXLDLSXQWLD HE VHQ]DDOWURVHJQRLGHQWL¿FD­ tivo del motto, pena l’esclusione dal concorso. d) una busta FKLXVDHVLJLOODWDFRQVXVFULWWRLOVRORPRWWRLGHQWL¿FDWRUH del gruppo, contenente una dichiarazione in carta semplice ULJXDUGDQWHLOPRWWRGHOSURJHWWRODGDWDGLUHGD]LRQHGHO SURJHWWR HQWURLOVHWWHPEUH LOQRPHGHOO¶HYHQWXDOH FDSRJUXSSRROHJDOHUDSSUHVHQWDQWHGHOJUXSSRO¶HOHQFRGL ogni componente del gruppo medesimo, comprensivo delle JHQHUDOLWjDQDJUD¿FKHGLRJQXQRGHOODTXDOL¿FDSURIHVVLR­ nale, e degli indirizzi postali e e – mail. A tale documento GRYUjLQ¿QHHVVHUHDOOHJDWRQHOODPHGHVLPDEXVWDFKLXVD e sigillata, il curriculum del capogruppo, eventualmente LQWHJUDWRGDL&9GHLGLYHUVLDSSDUWHQHQWLDOJUXSSRPHGH­ simo. Tale documento dovrà precisare le opere realizzate congruenti con il tema della Competizione, analizzate in EUHYHFRQHYHQWXDOLLPPDJLQLIRWRJUD¿FKHRGLVHJQLDQFKH in relazione all’importo delle opere realizzate o in progetto. Tale documentazione dovrà prevenire entro le ore 24,00 del giorno 25 settembre 2008 al seguente indirizzo: Ing. Adrian Cela 0XQLFLSLRGL'XUD]]R'XUD]]R$OEDQLD con il seguente oggetto indicato in alto a sinistra del plico: ILIRIA SQUARE COMPETITION Segreteria del Concorso: 5(&(37,212)),&(2)7+(&217(67 ,1$;+$.21,85%$1,67,&2)),&(081,&,3$/,7<2) '85$==2 57 2 First phase design solutions/ Risultati della prima fase 2.1 The experience of Liria square competition in the new urban season of Durres/ L’esperienza del concorso di Piazza Iliria nella nuova stagione urbana di Durazzo ,OSUHVHQWHWHVWRqVWDWRSUHVHQWDWRGDJOLDXWRULQHOFRUVRGHO&RQYHJQRLQDXJXUDOHGHO;)RUXPGHOOH &LWWjGHOO¶$GULDWLFRHGHOOR,RQLRWHQXWRVLD'XUD]]RLORWWREUH 'XUUHVLVWKHVHFRQGODUJHVWFLW\E\SRSXODWLRQLQ$OEDQLD RYHU 200,000), and is now an integral part of a large metropolitan area in training, which takes place between the coastal city and capital city, Tirana. This area now contains one third of the entire Albanian population (over one million inhabitants), is equipped with an impor­ WDQWD[LVRILQIUDVWUXFWXUHOLQNLQJWKHSRUWRI'XUUHV PDLQSRUWRIWKH country) Riina International Airport (the only one in Albania), and the ¿QDQFLDODQGLQVWLWXWLRQDOFDSLWDO,WµZDVDOVRFDOFXODWHGWKDWDORQJWKDW OLQH WKHLQLWLDOSDUWRIWKHIXWXUHPXOWLPRGDO(XURSHDQ&RUULGRU9,,, LV FRQ¿QHGLQWKHPDLQSURGXFWLRQFHQWHUVRIWKHFRXQWU\DERXWRI $OEDQLDQ*'35HFHQWO\P\FLW\KDVDQHZSXEOLFXQLYHUVLWLHVZKLFK enforces a system of research and training of high level, albeit still at an embryonic level, but destined to grow strongly in coming years, focusing on the University Polytechnic Tirana and a growing number RIVPDOOHUXQLYHUVLWLHV'XUUHVKDVDOZD\VEHHQLQWKHSDVWWKHGRRU of the East for all its countries of the Adriatic coast. The proof multi millennial history of my city, as well as physical evidence that this story has deposited over the centuries: the Roman Amphitheatre, the largest and best preserved of the Balkans, its walls, Byzantine, 2WWRPDQ9HQHWLDQLWVPRVTXHVFKXUFKHV2UWKRGR[FDWKHGUDOV UHÀHFWLQJDPXOWLUHOLJLRXVDQGSHDFHIXOFLW\ZLWKLWVPDQ\RWKHU traces of a long and lively. This role of East Gate, or perhaps better, this complex and vibrant geographical reality that goes by the name of the Balkans, is expected to grow, even in reverse, as the gateway to Italy and the EU Balkans, including because of new programs on LQIUDVWUXFWXUHGHYHORSPHQW &RUULGRU9,,,PRWRUZD\VRIWKHVHDV WR identify all the joints in my city a more important regional and geo­ graphical. My town is also leaving behind many years of uncontrolled development and unconscious, during which the opportunity to open market economies and development, has built and distributed by the new wealth, exacerbated other problems unresolved and created new questions. The image of the city, particularly in the old town and its coastline is there to indicate errors and missed opportunities, with the urgency of action already achieved many of the failures caused by urban development disrespectful quality historical and environmental. 0\WRZQKDVUHFHQWO\OHGWRWKH¿QDO 1DWLRQDO&RPPLVVLRQRI2FWREHU 26, 2007), a new planning instrument, dedicated to the historic town and its immediate surroundings, through which we intend to innovate WKHSUDFWLFHVRIUHFRYHU\DQGFODVVL¿FDWLRQRISDUWRIWKHFLW\PRUH dense and urban cultural values, the idea of starting a new season for the city, thereby providing a more sustainable and development oriented to improving the quality of life of its inhabitants. This is a new tool, created through the collaboration of Italian universities (inclu­ Adrian Cela, P. Rovigatti (*) 'XUUHVqODVHFRQGDFLWWjSHUQXPHURGLDELWDQWL dell’Albania (oltre 200.000) , ed è ormai parte integrante di una vasta area metropolitana in formazione, che si svolge tra la città costiera e la città capitale, Tirana. Questa area contiene ormai un terzo dell’intera popolazione albanese (oltre un milione di abitanti), è attrezzata da una impor­ tante asse infrastrutturale che collega il porto di 'XUD]]R SULQFLSDOHSRUWRGHOSDHVH DOO¶DHURSRUWR internazionale di Riina (l’unico, in Albania), e al FHQWUR¿QDQ]LDULRHLVWLWX]LRQDOHGHOODFDSLWDOH Lungo tale asse (tratto iniziale del futuro Corridoio 3OXULPRGDOH(XURSHR9,,, VLFROORFDQRRJJLL maggiori centri di produzione del paese, per circa O¶GHO3,/DOEDQHVH5HFHQWHPHQWHODFLWWj si è dotata di una nuova Università pubblica, che rafforza un sistema di ricerca e di formazione d’al­ to livello, sia pure ancora ad un livello embrionale, ma destinato fortemente a crescere nei prossimi anni, incentrato sull’Università Politecnica di Tira­ ne e su un crescente numero di Università minori. 'XUD]]RqVHPSUHVWDWDLQSDVVDWRODSRUWD dell’Oriente per tutti i suoi paesi dell’altra sponda adriatica. Lo provano la sua storia pluri millena­ ULDQRQFKpOHWUDFFH¿VLFKHFKHTXHVWDVWRULD KDGHSRVLWDWRQHLVHFROLO¶DQ¿WHDWURURPDQRWUD LSLJUDQGLHPHJOLRFRQVHUYDWLGHL%DOFDQLOH sue mura bizantine, ottomane, veneziane, le sue moschee, chiese, cattedrali ortodosse, a testi­ PRQLDQ]DGLXQDFLWWjPXOWLUHOLJLRVDHSDFL¿FD assieme alle sue tante altre tracce di un passato lungo e vivace. Questo ruolo di Porta d’Oriente, o forse meglio, di questa complessa e vivace realtà JHRJUD¿FDFKHYDVRWWRLOQRPHGL%DOFDQLqGH­ stinato a crescere, anche in senso inverso, come porta balcanica verso l’Italia e l’Unione, anche in ragione dei nuovi programmi di sviluppo infra­ VWUXWWXUDOH &RUULGRLR9,,,DXWRVWUDGHGHLPDUL  FKHWXWWLLQGLYLGXDQRLQ'XUD]]RXQRGHJOLVQRGL GLPDJJLRUHULOHYDQ]DWHUULWRULDOHHJHRJUD¿FDGHO paese. La città si lascia peraltro alle spalle molti anni di sviluppo incontrollato e inconsapevole, nel corso dei quali l’opportunità di aprire le econo­ mie al mercato e allo sviluppo, ha da una parte distribuito e costruito nuova ricchezza, dall’altra aggravato problemi irrisolti, e creato nuove que­ stioni L’immagine stessa della città, in particolare del suo centro storico e del suo litorale costiero sta lì ad indicare errori e occasioni mancate, assieme all’urgenza di un’azione già risanatrice 61 ding University of Pescara), who tries to resume a special attention to the historical city and the central areas of the city after many years of urban disorder and of lack of administrative initiative on issues of recovery and urban quality. The implementation of this plan, every action that leads to recovery DQGQHZFRQVWUXFWLRQWRWKHSURYLVLRQRIVSHFL¿FDQGZHOOGRFXPHQWHG implementation plans, based on the principle of equalization urban­ oriented production of spaces and public facilities, it collided with the lack of experience technicians and building local promoters in the preparation of such instruments, and is an excellent opportunity for technical collaboration and external professionals, experienced in the care of such tools. Our idea is to start soon an International Urban Planning Competition for testing these instruments under the plan. These measures are also in a program of urban regeneration of the city began to acquire greater substance and structure, initiated by the most recent municipal administrations, and this thanks to the coopera­ tion of many international organizations (European Union, World Bank, ,WDOLDQ&RRSHUDWLRQ'HYHORSPHQW0$( DQGRSHUDWLRQDQGVXSSRUWRI VFLHQWL¿FUHVHDUFKLQWKH¿HOGRIDUFKHRORJ\DQGXUEDQSODQQLQJRIIHUHG by some Italian Universities (some years ago the University of Parma, Bologna, and more recently the University of Chieti and Pescara) . Recovery of Cultural Heritage and Environmental What we try to do is also and above all to re­establish a new relation­ ship with the urban history of our city, started a major revitalization and restoration of cultural and environmental heritage in the city is still equipped. I think this is a theme and a common effort of many of the Mediterranean and Adriatic cities, in particular the eastern Adriatic shore, many of which have experienced similar processes of transition to market economies. This action we are still unprepared, both from a technical point of view of science, both for their lack of experience professionals, construction companies and local workers in the techni­ ques of restoration and recovery in urban and techniques and putting renaturalization safe areas of risk and environmental degradation. ,WLVDFRQGLWLRQWKDWLVWUXHLQSDUWLFXODUWKH&DSH&RDVWDO'XUUHVLQ serious hydrogeological and strongly affected by phenomena of illegal 62 dei molti guasti arrecati da uno sviluppo urbano poco rispettoso della qualità storiche e ambientali. L’Amministrazione della città ha da poco portato DOO¶DSSURYD]LRQH¿QDOH &RPPLVVLRQH1D]LR­ nale del 26 ottobre 2007), un nuovo strumento urbanistico, dedicato alla Città storica e al suo immediato intorno, attraverso il quale si vuole LQQRYDUHOHSUDWLFKHGLUHFXSHURHTXDOL¿FD]LRQH della parte di città maggiormente densa di valori culturali ed urbani, nell’idea di avviare una nuova stagione improntata ad uno sviluppo maggior­ mente sostenibile ed orientato al miglioramento della qualità della vita dei suoi abitanti. Si tratta di uno strumento nuovo, realizzato anche attra­ verso la collaborazione delle Università italiane (in particolare dell’Università di Pescara), che prova a riattivare una attenzione peculiare verso la città storica e le aree centrali della città, dopo molti anni di disordine urbanistico e diassenza di iniziativa amministrativa sui temi del recupero e della qualità urbana. L’applicazione di tale Piano, che rimanda ogni azione di recupero e di nuova FRVWUX]LRQHDOODSUHGLVSRVL]LRQHGLVSHFL¿FLHEHQ documentati piani attuativi, fondati sul principio della perequazione urbanistica e orientati alla produzione di spazi e attrezzature pubbliche, pur scontrandosi, oggi, con la scarsa esperien­ za dei tecnici e dei promotori edilizi locali nella predisposizione di tali strumenti, costituisce un ottima occasione di collaborazione anche per WHFQLFLHSURIHVVLRQLVWLHVWHUQLSLHVSHUWLQHOOD cura di questo genere di strumenti. L’idea è anche quella di avviare presto un Concorso Internazio­ nale di Urbanistica per la sperimentazione di tali strumenti applicativi del Piano. Tali azioni si inse­ ULVFRQRSHUDOWURLQXQSURJUDPPDGLULTXDOL¿FD]LR­ ne urbana della città che comincia ad acquisire sempre maggiore sostanza e struttura, avviato GDOOHSLUHFHQWL$PPLQLVWUD]LRQL&RPXQDOLH ciò grazie anche alla cooperazione di numerosi organismi internazionali (Unione Europea, World Bank, Cooperazione Italiana allo Sviluppo, MAE), HDOO¶DWWLYLWjGLVXSSRUWRHGLULFHUFDVFLHQWL¿FD in campo archeologico e urbanistico offerta da alcune Università Italiane. Il recupero del Patrimonio Culturale e Ambientale L’intenzione è anche e soprattutto di ristabilire un nuovo legame con la storia urbana della città, avviando un’opera di rivitalizzazione e recupero del considerevole patrimonio culturale e ambien­ tale di cui ancora appare dotata. E’ questo sia un tema e uno sforzo comune a molte delle città della sponda orientale adriatica, molte delle quali hanno vissuto analoghi processi di transizione all’economia di mercato. Su questa azione siamo tuttavia ancora imprepa­ UDWLVLDGDXQSXQWRGLYLVWDWHFQLFRVFLHQWL¿FRVLD per la scarsa esperienza che hanno i profes­ sionisti, le imprese edili e le manovalanze locali FRQVWUXFWLRQDVZHOODVWKHDUHDLQVLGHWKHIRUPHUODJRRQ.HQHWD Seismic risk. There is also the issue of seismic risk, which in the past has often shocked the city and its territory, and that could be both a ¿HOGUHVHDUFKWULDOSUDFWLFHDQGWKDWVHHPVWRKDYHEHHQWDNHQLQWR due consideration in the most recent housing development in the city. The issue of new development and bio architecture. 7KHFLW\RI'XUUHVKDVJURZQLQUHFHQW\HDUVPRVWO\WKURXJKQHZ construction of intensive and speculative, ignoring opportunities to experiment, even in new buildings, new technologies, savings and self­oriented energy supply, and the organic architecture the bio buil­ GLQJDVZHVWDUWHGWRGRQRZDOORYHUWKHZRUOG+DVEHHQORVWVRIDU with the opportunity to experience this new language of architecture, in adherence to the new urban styles and attitudes that are increasin­ gly shared by the Albanian cities in Western cities. Today is beginning to emerge a new direction, albeit at a level embryo, we would like to strengthen and encourage, both between professionals and between enterprises, closer to the criteria of environmental sustainability and cultural development, including in relation to the opportunities that glimpse to my town in the area of cultural tourism, and the perspective of improving the quality of life of its inhabitants. Above: internal street of hisytorical center/ sotto: strada interna al centro storico nelle tecniche del restauro e nel recupero urbano, quanto nelle tecniche di rinaturalizzazione e messa in sicurezza delle aree di rischio e degrado ambientale. Si tratta di una condizione che riguar­ da in modo particolare il Promontorio Costiero di 'XUD]]RLQFRQGL]LRQLGLJUDYHGLVVHVWRLGURJH­ ologico e fortemente interessato da fenomeni di abusivismo edilizio, così come l’area ex lagunare LQWHUQDGHOOD.HQHWD Il rischio sismico. A tali condizioni si aggiunge anche il tema del rischio sismico, che in passato KDSLYROWHVFRQYROWRODFLWWjHLOVXRWHUULWRULRH che potrebbe costituire tanto un campo di ricerca che di sperimentazione pratica, e che non sembra sia stato considerato nella dovuta attenzione nelle SLUHFHQWLFRVWUX]LRQLHGLOL]LHGHOODFLWWj Il tema delle nuove costruzioni e della bio architet­ tura./DFLWWjGL'XUD]]RqFUHVFLXWDLQTXHVWLXOWLPL DQQLVRSUDWWXWWRDWWUDYHUVRQXRYHHGL¿FD]LRQLGL carattere intensivo e speculativo, tralasciando le occasioni di sperimentare, anche nel campo delle nuove costruzioni, nuove tecnologie, orientate al risparmio e all’auto approvvigionamento energe­ tico, alla bio architettura e alla bio edilizia, come si è cominciato a fare ormai in tutto il mondo. Si è SHUVD¿QRUDFRQFLzO¶RSSRUWXQLWjGLVSHULPHQWDUH nuovi linguaggi dell’architettura, in aderenza ai QXRYLVWLOLHFRPSRUWDPHQWLXUEDQLFKHVHPSUHSL accomunano le città albanesi alle città occidentali. Oggi sta cominciando ad emergere un orienta­ mento nuovo, sia pure ad un livello embrionale, che vorremmo rafforzare e incoraggiare, tanto tra i SURIHVVLRQLVWLFKHWUDOHLPSUHVHSLDWWHQWRDLFUL­ teri della sostenibilità ambientale e culturale dello sviluppo, anche in relazione alle opportunità che si intravedono per la mia città nel settore del turismo culturale, e nell’ottica del miglioramento comples­ sivo della qualità della vita dei suoi abitanti. Lo sviluppo del turismo balneare e del turismo culturale. La scoperta del mare e del turismo balneare ha comportato negli ultimi anni una crescita imponente di alberghi (una stima della &DPHUDGL&RPPHUFLRGL'XUD]]RSDUODGLFLUFD 300 unità in tutta l’area costiera), soprattutto lungo la grande spiaggia tra il Porto della Città HODORFDOLWjGL.DYDMD6LWUDWWDGLXQIHQRPHQR di massa, che offre ospitalità ad un pubblico turistico composto in prevalenza di ospiti stranieri provenienti da paesi dove è forte la presenza di XQDHWQLDDOEDQHVH LO.RVVRYROD0DFHGRQLD &L sono molte analogie, di tipo insediativi e urbanisti­ co, con quanto è successo nella formazione della conurbazione costiera adriatica italiana, ma con ancora maggior disordine e assenza di strumenti di controllo e indirizzo. La razionalizzazione di tale sistema – rilevante in termini economici e sociali – è certamente un altro tema di possibile 63 collaborazione tra le città adriatiche, come lo è, IRUVHDQFRUDGLSLTXHOORGHOSRWHQ]LDPHQWR LQ termini di strutture e management) del turismo culturale che da sempre costituisce un potenziale QDWXUDOHGHOOD&LWWj9HFFKLDHFKHFRPLQFLDDG assumere rilevanza anche in termini di presente e di volume di affari prodotto. Rispetto a ciò sono anche presenti alcuni progetti che attendono ora di essere implementati (a cominciare da quelli SURPRVVLGDOFLWDWR3LDQRSHUOD&LWWj9HFFKLD  ma ogni proposta di collaborazione e di azione comune è naturalmente bene accetta, all’interno di un campo di attività che si presenta ancora per molti aspetti vergine. A sinistra, Durres, il waterfront meridionale The development of seaside tourism and cultural tourism. The discovery of the sea and beach tourism has led to impressive growth in recent years the hotel (an estimate of the Chamber of Com­ PHUFHRI'XUUHVWDONLQJDERXWXQLWVWKURXJKRXWWKHFRDVWDODUHD  PDLQO\DORQJWKHJUHDWEHDFKHVLQWKH3RUW&LW\DQGUHVRUW.DYDMD This is a mass phenomenon, offering hospitality to a tourist audience composed mainly of foreign visitors from countries where there is a VWURQJSUHVHQFHRIHWKQLF$OEDQLDQV .RVRYR0DFHGRQLD 7KHUHDUH many similarities, and urban­type settlement, with what has happened in formation of the Italian Adriatic coastal conurbation, but with even greater disorder and lack of instruments to monitor and address. The rationalization of the system ­ relevant economic and social terms ­ is certainly another area of possible collaboration between Adriatic cities, as it is, maybe more, that of building (in terms of facilities and ma­ nagement) of cultural tourism has always been a natural potential of the Old City, and begins to become relevant in terms of turnover and this product. Compared to this there are also some projects that are waiting now to be implemented (beginning with those promoted by the said Plan for the Old Town), but any proposal for cooperation and joint DFWLRQLVRIFRXUVHZHOFRPHLQD¿HOGDFWLYLWLHVWKDWDUHVWLOOLQPDQ\ ways a virgin. The new City Plan 7KHSDWKRIP\DGPLQLVWUDWLRQFRQWLQXHVLQWKHXUEDQ¿HOGWKURXJKWKH drafting of the new general municipal planning instrument, which will EHUHDOL]HGWKDQNVWRWKH¿QDQFLDOFRRSHUDWLRQRILQWHUQDWLRQDOLQVWLWX­ tions. In these days it is starting to take the business of an internatio­ QDOGHVLJQWHDPKHDGHGE\DQ,WDOLDQFRPSDQ\ +\GH ZKRKDVZRQ an international competition sponsored by the World Bank, under the LAMP project (Land Administration and Management Project), whose task is to prepare new planning instruments (structural plan, opera­ tional plan, strategic plan, program, public works) of the four largest FLW\DIWHU7LUDQD$OEDQLD'XUUHV9ORUD6KNRGUDDQG.DPH]7KH formation of the new planning instrument general of the city, then go through procedures for high experimental value, within a collaboration WKDWEULQJVKLJKEUHDWKDJDLQZLWKTXDOL¿HGLQWHUQDWLRQDOHQJLQHHULQJ 64 Il nuovo Piano Regolatore della Città Il percorso dell’Amministrazione prosegue, in campo urbanistico, attraverso la redazione del nuovo strumento urbanistico generale comunale, che verrà realizzato grazie anche alla cooperazio­ QH¿QDQ]LDULDGHJOLLVWLWXWLLQWHUQD]LRQDOL Proprio in questi giorni sta infatti per prendere avvio l’attività di un team di progettazione inter­ nazionale, diretto da una società italiana, che si è aggiudicata una gara internazionale promossa dalla Banca Mondiale, nell’ambito del progetto LAMP (Land Administration and Management Project), cui spetta il compito di redigere i nuovi strumenti urbanistici (piano strutturale, piano ope­ rativo, piano strategico, programma delle opere pubbliche) delle quattro maggiori città albanesi GRSR7LUDQD'XUD]]R9DORQD6FXWDULH.DPH] La formazione del nuovo strumento urbanistico generale della città, passa dunque attraverso procedure di alto valore sperimentale, nell’ambito di una collaborazione di alto respiro che mette di QXRYRDVVLHPHTXDOL¿FDWHVRFLHWjGLLQJHJQHULD internazionali, Università albanesi e italiane, strutture dello Stato, operatori e amministrazioni ORFDOLH'XUD]]RqDQFRUDSURWDJRQLVWDGLWDOH VSHULPHQWD]LRQH7UDOH¿QDOLWjGLTXHVWRSURJHWWR ¿JXUDDQFKHODFROODERUD]LRQHDO0LQLVWHURGHL/D­ vori Pubblici per l’aggiornamento delle normative e dei regolamenti nazionali di settore. L’azione in campo ambientale. Assieme all’azione in campo urbanistico e nei settori prima citati, forte è lo sforzo dell’ammi­ nistrazione in campo ambientale. Nell’agenda amministrativa, tutto ciò riguarda, in primo luogo: il recupero e la valorizzazione delle grandi aree di interesse paesaggistico – ambientale (il 3URPRQWRULR&RVWLHURO¶H[ODJXQDGHOOD.QHWDOD fascia costiera meridionale). Qui l’Amministrazio­ ne intende estendere e rendere attiva la tutela esistente, anche attraverso progetti di sviluppo per un turismo eco – culturale e sostenibile. Su tale tema, si è recentemente costituito un gruppo di lavoro internazionale, composto da esperti francesi, canadesi, americani e italiani, coordinato company, Albanian and Italian universities, state structures, operators DQGORFDOJRYHUQPHQWVDQG'XUUHVLVVWLOOIRUHIURQWRIWKLVH[SHULPHQ­ tation. I still remember that the aims of this project is also included collaboration with the Ministry of Public Works to update the rules and regulations for the sector. The action on the environment. $ORQJZLWKDFWLRQSODQQLQJ¿HOGDQGLQWKHDUHDVFLWHGDERYHWKH stronger the effort of my administration in environmental matters. In RXUDGPLQLVWUDWLYHDJHQGDDOOWKLVLQYROYHVLQWKH¿UVWSODFHWKHUH­ covery and exploitation of large areas of scenic interest ­ environment &RDVWDO3URPRQWRU\WKHIRUPHUODJRRQ.QHWWKHVRXWKHUQFRDVW  +HUHP\DGPLQLVWUDWLRQZLOOH[WHQGDQGPDNHH[LVWLQJDFWLYHSURWHF­ tion, including through development projects for tourism eco ­ cultural and sustainable. Compared to that theme, has recently established DQLQWHUQDWLRQDOZRUNLQJJURXSFRPSULVLQJH[SHUWVIURPWKH)UHQFK Canadians, Americans and Italians, coordinated by the University of 3HVFDUDZKLFKP\$GPLQLVWUDWLRQKDVVRXJKWWRGHYHORSD³)HDVLEL­ lity Study for the recovery environmental and tourist development of :DWHUIURQW6RXWKRI'XUUHVKLJKOLJKWLQJWKHFRQGLWLRQVRIHQYLURQPHQ WDOIHDVLELOLW\HFRQRPLF¿QDQFLDOWHFKQLFDOPDQXIDFWXULQJWHFKQLFDO and procedural part of the administrative action of this important urban area. Compared to that action, to which my Administration assigns the highest strategic value, so that it already included in the municipal budget for the current year, I ask all employers to submit an expres­ sion of interest, along with the suggestion of new ideas and ideas. The collection of municipal solid waste and more effective treatment at sea. On this my city has, as you know is a major collaboration with other Adriatic cities to introduce the collection, more effective mana­ gement of collection centers, the construction of a sewerage system and sanitary sewage and industrial grade to eliminate or reduce the current hardships. dall’Università di Pescara, a cui è stato chiesto di sviluppare uno “Studio di fattibilità per il recu­ pero ambientale e la valorizzazione turistica del :DWHUIURQWPHULGLRQDOHGL'XUD]]R´FKHPHWWD in evidenza le condizioni di fattibilità ambientale, HFRQRPLFR±¿QDQ]LDULDWHFQLFRFRVWUXWWLYD tecnico procedurale e ammnistrativa di tale importante azione urbana e territoriale. Rispetto a tale azione, cui l’Amministrazione assegna il massimo valor strategico, tanto da averla già inserita nel bilancio comunale per l’anno in corso, chiediamo a tutti gli imprenditori presenti una manifestazione di interesse, assieme al suggeri­ mento di spunti e di nuove idee. Anche sul tema GHOODUDFFROWDGHLUL¿XWLVROLGLXUEDQLHGLXQSL HI¿FDFHWUDWWDPHQWRHVPDOWLPHQWRDPDUHODFLWWj ha avviato una importante collaborazione con altre città adriatiche per introdurre la raccolta dif­ IHUHQ]LDWDXQDJHVWLRQHSLHI¿FDFHGHLFHQWULGL raccolta, la realizzazione di un sistema fognario e di depurazione delle acque sanitarie e industriali in grado di eliminare o ridurre i disagi attuali. /¶HPHUJHQWHSUREOHPDGHOWUDI¿FRHGHOODPRELOLWj Qui l’intenzione, ben visibile nel nuovo, recente­ mente approvato, Piano per l’area centrale della città, è quella di sviluppare sistemi di mobilità so­ stenibile e di trasporto pubblico a basse emissioni (piste ciclabili, percorsi pedonali, tram ecologici), anche in relazione ai possibili collegamenti metro­ SROLWDQL PHWURSROLWDQDGLVXSHU¿FLH3RUWR±DUHD costiera turistica – area industriale – aeroporto internazionale – università – centro città capitale). L’emergenza energetica – problema di assoluta ri­ levanza in Albania – è un tema a cui l’Amministra­ ]LRQH&RPXQDOHGL'XUD]]RLQWHQGHULVSRQGHUH 'XUUHV3RUWR5RPDQRDEDQGRQHGPLOLWDU\EXQNHUVRQWKHEHDFKDurazzo, Porto Romano, bunker militari abbandonati sulla battigia 65 avviando un serio sviluppo delle fonti energetiche rinnovabili, anche utilizzando in modo appropriato le vaste aree inutilizzate o sotto utilizzate della ex ODJXQD .QHWD  L’attività edilizia e di edilizia sociale. Ma è la stessa attività edilizia, che tanto si è svi­ luppata, in questi ultimi anni, nella nostra regione, con esiti non sempre soddisfacenti e sostenibili, a rappresentare una formidabile occasione di sperimentazione per nuove pratiche progettuali e di intervento, secondo i dettami della bio – edilizia e della eco – urbanistica. Per non parlare della necessità che la mia città ha oggi di riprendere la produzione di interventi di edilizia sociale, per at­ tenuare le tensioni abitative che il mercato edilizio privato da solo non è stato in grado di risolvere e che ha anche in parte aggravato. 'XUUHVWKHFLW\DQGWKHSRUWDHULDOYLHZ Durazzo, la città e il porto, veduta aerea 7KHHPHUJLQJSUREOHPRIWUDI¿FDQGPRELOLW\ +HUHWKHLQWHQWLRQLVFOHDUO\YLVLEOHLQWKHQHZUHFHQWO\DSSURYHGSODQ for the central area of the city, is to develop systems for sustainable mobility and public transport, low emission (bike paths, foot paths, environmentally friendly tram), even in relation to possible links metropolitan (metro area Porto area ­ coastal tourism ­ business area ­ International Airport ­ universities ­ the capital city center). The energy emergencyDSUREOHPRIJUHDWVLJQL¿FDQFHLQ$OEDQLD ZKLFKWKH0XQLFLSDOLW\RI'XUUHVZLOOUHVSRQGE\LQLWLDWLQJDVHULRXV development of renewable energy sources, including using properly WKHYDVWDUHDVRIXQXVHGRUXQGHUXWLOL]HGIRUPHUODJRRQ .QHW  The building activity and social housing. But it’s the same building activity, so that has developed in recent ye­ ars in our region, with results not always satisfactory and sustainable, to represent a formidable opportunity for testing new design practices and intervention, according to the dictates of bio ­ Building and Eco ­ town planning. Not to mention the need for my city today to resume production of social housing interventions to mitigate tensions housing the private housing market alone was not able to solve and which also partly aggravated. Public facilities and public administration reform Great effort is put in the creation of new schools (three new schools for the next four years, in collaboration with World Bank), new roads and other vital community facilities. The new administrative challenges regarding the implementation of a new project for the computerization of municipal taxes and the transparency of all administrative activities RIWKHPXQLFLSDOLW\ZLWKFLWL]HQVDQGLQFROODERUDWLRQZLWK,)&0\DG­ PLQLVWUDWLRQLV¿QDOO\SURGXFLQJDJUHDWHIIRUWLQGHVLJQLQJVXVWDLQDEOH projects and obtaining the resources necessary to deliver them. 66 Attrezzature pubbliche e riforma della pubblica amministrazione Grande impegno è riposto anche nella realizza­ zione di nuovi istituti scolastici (tre nuove scuole per i prossimi quattro anni, con la collaborazione di World Bank), di nuove strade e di altre vitali DWWUH]]DWXUHFROOHWWLYH/HQXRYHV¿GHDPPLQL­ strative riguardano la realizzazione di un nuovo progetto per l’informatizzazione dei tributi urbani e la trasparenza di tutte le attività amministrative del municipio, con i cittadini e in collaborazio­ QHFRQ,)& a questione del Porto di Durazzo Tale sforzo deve fare i conti con l’assetto territoriale attuale, in cui evidenti sono anche le questioni che rimandano ai rapporti con la QRVWUDYLFLQDFLWWjFDSLWDOHHOHGLI¿FLOLTXHVWLRQLGL rapporto istituzionale con la realtà portuale della nostra città, anch’essa di recente interessata da programmi di ammodernamento infrastruttu­ rale e di natura strumentale (è stato di recente riformato il nuovo Piano Regolatore Portuale, dopo una gara internazionale su fondi europei). La formazione del nuovo strumento è avve­ nuta attraverso un modesto collegamento con l’Amministrazione della parte urbana della città, a conferma di una separatezza tra il Porto e la città che sopravvive e si mantiene stabile ormai da molto tempo. Si tratta di una separatezza di cui fa le spese soprattutto la Città, che sopporta tutti gli oneri dell’ingombrante presenta portuale, senza parteciparne in modo consistente agli utili, che cominciano, anche in ragione degli investimenti realizzati da World Bank e dall’Unione Europea sullo scalo marittimo durazzino, a farsi sempre SLFRQVLVWHQWL'LIDWWRO¶$PPLQLVWUD]LRQHKD LQDXJXUDWRFRQO¶$XWRULWj3RUWXDOHGL'XUD]]RXQ rapporto di collaborazione e di apertura, ma an­ FKHXQDYHUDHSURSULDYHUWHQ]DSHUODGH¿QL]LRQH del limite dell’area portuale, per la destinazione degli spazi dismessi dell’ex linea ferroviaria a The issue of the Port of Durres This effort has to deal with the current planning, which are obvious questions that refer to relations with our nearest capital city, and the GLI¿FXOWLVVXHVRILQVWLWXWLRQDOUHODWLRQVKLSZLWKWKHUHDOLW\RIRXUSRUW city, which is also recently affected by infrastructure modernization programs and the instrumental nature (it has been recently formed a new plan of the harbor after an international competition on European funds). The formation of the new instrument was achieved by a small FRQQHFWLRQZLWKWKHDGPLQLVWUDWLRQRIWKHXUEDQSDUWRIWKHFLW\FRQ¿U­ ming a separation between the Port and the city survives and remains stable for a long time. This is a separate institution which makes the expenses especially the City, which bears all the burden has dell’in­ JRPEUDQWHSRUWZLWKRXWPDNHDVXEVWDQWLDOFRQWULEXWLRQWRSUR¿WV which begin, also because of investments made by World Bank and the European Union durazzino on seaport, to become increasingly VLJQL¿FDQW,QIDFWP\$GPLQLVWUDWLRQKDVRSHQHGZLWKWKH3RUW$XWKR­ ULW\RI'XUUHVDUHODWLRQVKLSRIFROODERUDWLRQDQGRSHQQHVVEXWDOVRD JHQXLQHGLVSXWHRQWKHGH¿QLWLRQRIWKHOLPLWVRIWKHSRUWWKHGHVWLQD­ tion of the abandoned spaces of the former line Railway serving the port which the city claims for itself (as was also one of the strategic projects of the Plan for the central area of the University of Pescara, deleted in the approval of the planning instrument for the construction of a new road that give fresh breath and more safely to the network urban waterfront town on the eastern). The theme of boating and development of sailing. servizio del porto che la città rivendica a se (come faceva peraltro uno dei progetti strategici del Piano per l’area centrale dell’Università di Pescara, stralciato in sede di approvazione dello strumento urbanistico, per la costruzione di una nuova arteria stradale che desse nuovo respiro e maggiori condizioni di sicurezza alla rete urbana cittadina sul waterfront orientale). Il tema della nautica da diporto e dello sviluppo di attività diportistiche. In tutta l’Albania è quasi del tutto assente una tra­ dizione e una attività marinara di tipo diportistico. L’assenza di infrastrutture portuali specialistiche in tale settore è la conseguenza di fattori storici ma anche di contingenze normative destinate ad essere presto superate. Tra un anno scade una moratoria che vieta il possesso, ad ogni cittadino albanese, di un natante a motore. Si tratta di una norma che tendeva ad ostacolare LOIHQRPHQRGHLWUDI¿FLGHOO¶LPPLJUD]LRQHFODQGH­ stina costiera, oggi del tutto superato. La scoperta della nautica, e lo sviluppo di tutte le attività economiche connesse (marina, ricettività nautica, cantieristica, attività di rimessaggio e di manutenzione) è destinata a caratterizzare molto SUREDELOPHQWHODFLWWjGL'XUD]]RDVVLHPHD quella delle altre poche località costiere albanesi attrezzate o attrezzabili per tale genere di attività. Si tratta di una attività – giova qui ricordarlo – Above: The city and the harbour, view from the hill/ In basso: la città e il porto dalla collina 67 Across Albania is almost entirely absent from a tradition and a kind of pleasure craft marine activities. The lack of port infrastructure experti­ se in this area is the result of historical factors but also contingencies legislation intended to be overcome soon. In a year ending a moratorium that prohibits the possession, every Albanian citizen, a boat motor. It is a rule that tended to hinder the phenomenon of illegal immigration coastal trade, now completely outdated. The discovery of the boat, and the development of all economic activities related (marina, campground boating, shipbuilding activities and depot maintenance) is probably intended to characterize WKHFLW\RI'XUUHVDORQJZLWKWKDWRIPDQ\RWKHUFRDVWDOWRZQV$OEDQLDQ equipped or equipped for this kind of activity. This is an activity ­ it should be mentioned here ­ that can leverage both external demand (pleasure boating activity takes place along the Adriatic coast and hospitality that is currently organized along the Albanian coast) is a po­ tential domestic demand, consists of high­income population sectors that could be directed to the possession of boats and this kind of expe­ rience. Obviously this dual application requires policies and decisions ZKLFKGHSRWHQ]LQRWKH¿UVWIRUWKHVHFRQGWDUJHWWKURXJKSURMHFWVDQG actions well balanced, even in respect of environmental values and coastal landscape. Should also be recalled as the development of nautical tourism in particular binds to the enhancement of other forms of tourism ­ the cultural and environmental ­ and assume because of this strong strategic value. The experience of the International Competition of Piazza Illyrians 7KLVH[SHULHQFHLVFRPLQJWRDUHVXOWRIJUHDWYDOXH,QWKH¿UVWSKDVH of the competition, we can now show the products, all very interesting, of the 36 design teams that participated from many different countries: Japan, USA, Mexico, Brazil, Britain, Germany, Austria, Spain , Por­ WXJDO,WDO\DQGRIFRXUVHLQZKDWSHUKDSVIRUWKH¿UVWWLPHLQ$OEDQLD was a true International Architecture Competition. This exhibition presents images and texts, as they have been delivered to the Com­ SHWLWLRQ-XU\IRUWKHLUHYDOXDWLRQ,ZDQWWRHVSHFLDOO\SRLQWRXWWKH¿YH SURMHFWVWKDWZLOOFRPSHWHKHUHDWWKHHQGRI-DQXDU\WKH¿QDOUHVXOW for high design quality and the freshness and innovation that offer all WKHGLI¿FXOWLVVXHJLYHQWKHFRPSHWLWLRQ,WKLQNWKLVH[SHULHQFHLVIRU my part of the administrative, for young engineers who collaborated in the organization, and here I want to personally thank, for professionals and businesses that operate and work in my city, but also and above all its citizens and residents, experience and exemplary in some way historical. Many Albanian cities are watching with interest what is KDSSHQLQJLQ'XUUHVDQG,KRSHWKDWWKURXJKWKHZRUNRIPDQ\IRUHLJQ teams who participated ­ or thought to participate ­ in the competi­ tion, is born or strengthened also equal attention to the life and future 'XUUHVDOVRIURPRWKHUFLWLHVWKH0HGLWHUUDQHDQDQGWKHZRUOG0\FLW\ QHHGVJRRGLGHDVDQGJRRGH[DPSOHVLQWKHGLI¿FXOWWDVNZHKDYH undertaken to initiate new experiences in urban as we opened the new season, more attentive to the grounds of the city itself and its inhabi­ tants. This competition is then only one step in a long journey that will take my city, not alone but in good company! 68 che può fare leva sia su una domanda esterna (l’attività diportistica che si svolge lungo le coste adriatiche e che non trova attualmente ospitalità organizzata lungo la costa albanese) sia su una potenziale domanda interna, costituita da settori di popolazione ad alto reddito che potrebbero essere interessati al possesso di natanti e a que­ sto genere di nuova esperienza. Naturalmente tale duplice domanda necessita di politiche e di scelte che non depotenzino la prima in funzione della seconda, attraverso progetti e azioni ben calibrate, anche nel rispetto dei valori ambientali e di paesaggio costieri. Occorre ancora ricordare come lo sviluppo di un turismo nautico si leghi in modo particolare al potenziamento di altre forme di turismo – quello culturale e ambientale – e assuma in ragione di ciò forte valore strategico. /DPLDDPPLQLVWUD]LRQHVWDLQ¿QHSURGXFHQGR un grande sforzo nell’ideare progetti sostenibili e nel reperire le risorse necessarie per realizzarli. Tra questi, voglio appena citare il tema della ULTXDOL¿FD]LRQHGHO3DUFRFRVWLHURODUHDOL]]D]LR­ ne del Parco Archeologico centrale, già da tempo promosso dalla Missione Archeologica dell’ ’Uni­ YHUVLWjGL3DUPDLO3URJHWWRGHO3DUFRGHOOH0XUD bizantine e del Palazzo di re Zog, in attuazione del Piano dell’area centrale realizzato dall’ 8QLYHUVLWjGL3HVFDUDODULTXDOL¿FD]LRQHGHJOL spazi pubblici del centro storico, e in particolare della piazza centrale della città, attraverso l’istitu­ zione di un concorso internazionale di architet­ tura, ancora con la collaborazione di Università, centri di ricerca, l’Istituto Italiano di Architettura ,1$5&+ ¶8QLYHUVLWjGL3DUPDLO3URJHWWRGHO Parco delle Mura bizantine e del Palazzo di re Zog, in attuazione del Piano dell’area centrale realizzato dall’Università di Pescara, la riquali­ ¿FD]LRQHGHJOLVSD]LSXEEOLFLGHOFHQWURVWRULFR e in particolare della piazza centrale della città, attraverso l’istituzione di un concorso internazio­ nale di architettura, ancora con la collaborazione di Università, centri di ricerca, l’Istituto Italiano di $UFKLWHWWXUD ,1$5&+  L’esperienza del Concorso Internazionale di Piazza Iliria Questa esperienza sta volgendo verso un risul­ tato di grande valore. A conclusione della prima fase del Concorso, possiamo oggi mostrare i prodotti, tutti di grande interesse, dei 36 gruppi di progettazione che hanno partecipato, provenienti da tanti diversi paesi: Giappone, USA, Mexico, Brasile, Gran Bretagna, Germania, Austria, Spa­ gna, Portogallo, e naturalmente Italia, in quello che forse per la prima volta in Albania è stato un vero Concorso Internazionale di Architettura. Questa mostra ne presenta le immagini e i testi, così come sono stati consegnati alla Giuria del &RQFRUVRSHUODORURYDOXWD]LRQH9RJOLDPR in particolare segnalare i cinque progetti che VLFRQWHQGHUDQQRGLTXLDOOD¿QHGLJHQQDLRLO ULVXOWDWR¿QDOHSHUO¶DOWDTXDOLWjSURJHWWXDOHHSHU la freschezza e l’innovazione che tutti propon­ JRQRQHOGLI¿FLOHWHPDDVVHJQDWRGDOFRQFRUVR Crediamo che questa esperienza rappresenti per l’Ammnistrazione, per i giovani tecnici che hanno collaborato nell’organizzazione, e che qui vogliamo personalmente ringraziare, per i profes­ sionisti e le imprese che operano e lavorano nella mia città, ma anche e soprattutto per tutti i suoi cittadini e abitanti, un’esperienza esemplare e in qualche modo storica. Molte città albanesi stanno guardando con interesse a cosa sta succedendo D'XUD]]RHVSHURFKHJUD]LHDOODYRURGHOOH tante equipes straniere che hanno partecipato – o pensato di partecipare – al concorso, nasca o si rafforzi anche una eguale attenzione alla vita e al IXWXURGL'XUD]]RDQFKHGDSDUWHGLDOWUHFLWWjGHO Mediterraneo e del Mondo. La città ha bisogno GLEXRQHLGHHHGLRWWLPLHVHPSLQHOGLI¿FLOH compito che ci siamo assunti, di avviare nuove esperienze nella nuova stagione urbana che DEELDPRLQDXJXUDWRSLDWWHQWDDOOHUDJLRQLGHOOD città stessa e dei suoi abitanti. Questo Concorso è allora solo un passo di un lungo cammino che la 'XUD]]RLQWHQGHLQWUDSUHQGHUHQRQGDVRODPDLQ buona compagnia! 'XUUHVWK2FWREHUVKRZVDQGVHWWLQJXSYLGHR QRLVHRQWKHUHVXOWVRIWKH¿UVWSKDVHRIWKHFRPSHWLWLRQ DWWKH;)RUXPRI$GULDWLFDQG,RQLDQ&LWL]HQVREVHUYH and comment on the proposals/ Durazzo, 28 Ottobre 2008, mostra e allestimento video sonoro sui risultati del Concorso di prima fase, in occasione del X Forum delle Città dell’Adriatico e dello Ionio. I cittadini osservano e commentano le proposte presentate. 69 2.2 Thirty­six planning ideas for the city and its square/ Trentasei progetti per la città e la sua piazza 36 projects from many foreign countries, many Italians, of course, but also projects from Japan, Mexico, Texas, Great Britain, Germany, Austria, Portugal, Spain. Not to mention the groups who often have varied appearances, such as Canada, Brazil and even Japan, even in teams composed predominantly of Albanian and Italian architects. 1RWEDGIRUSDUWLFLSDWLRQLQWKH¿UVWLQWHUQDWLRQDOFRPSHWLWLRQWKDQNV WRWKHFROODERUDWLRQRI,1$5&+IURPRQHFLW\'XUUHVXQWLODIHZ\HDUV ago in the chronicles considered national and international base EHFDXVHRIDQLQÀX[RILOOHJDOLPPLJUDQWVWKDWIRUWKH¿UVW\HDUV involved in particular the Italian coast. 'XUUHV$OEDQLDZDVOLWWOHFKDQJHGIURPWKRVH\HDUVDQGWKLVEHJDQ to notice the many architects who participated in the Competition for the Revitalisation of Liria Square, the city’s main square ­ the count­ ry’s second city, port and terminal fundamental building Pan­European &RUULGRU9,,,LVLQWHQGHGWRFRQQHFWWKHVRXWKHUQ%DONDQVDQGWKH Black Sea to southern Italy, part of an extensive metropolitan conur­ bation that now connects the city at one port of the Balkans with the capital, Tirana. That many foreign architects have believed such a bet, working to strengthen action “launched by the most recent municipal administrations, thanks to the cooperation of numerous international ERGLHVDQGLQYROYHPHQWDQGVXSSRUWRIVFLHQWL¿FUHVHDUFKLQWKH¿HOG of archeology and urban offered by some Italian Universities (some years ago the University of Parma, Bologna University, and most recently the University of Chieti and Pescara) is therefore a good response signal to the Adriatic city and its courageous administrators, but also a sign that things are in Albania for the opening of a debate ­ also made up of works and projects ­ the fate of historic cities and the role that public space and community facilities (functions much neglected by the more recent urban development of these cities) may still play in the delicate balance of physical and in new urban econo­ mies of its cities. Albania is also new to the experience of architectural competitions, including internationally. But so far had been Tirana to UHDOL]HWKH¿UVWH[SHULPHQWVPDNLQJDUFKLWHFWXUDOFRPSHWLWLRQVVXFK as the recovery of the national headquarters of the Bank of Albania, Skanderbeg Square, a prestigious work of early twentieth­century ,WDOLDQDUFKLWHFW9LWWRULR0RUSXUJR%DOOLRVRPHLPSRUWDQWLQWHUYHQWLRQV construction management in the city center, ending the competition for the characterization of the capital city’s main square, marked by a good international participation. The experience of international competition for the revitalization of the VTXDUHLQ'XUUHV/LULDEHQRWHGKRZHYHUIRUVRPHSHFXOLDUHOHPHQWV 36 progetti, provenienti da molti paesi esteri, molti italiani naturalmente, ma anche progetti da Giap­ pone, Mexico, Texas, Gran Bretagna, Germania, Austria, Portogallo, Spagna. Per non parlare dei gruppi, che spesso presentano presenze varie­ gate, come Canada, ancora Giappone e Brasile, anche all’interno di team composti prevalente­ mente da architetti italiani e albanesi. Non male per la partecipazione al primo Con­ corso Internazionale bandito grazie anche alla FROODERUD]LRQHGL,1$5&+GDXQDFLWWj'XUD]]R ¿QRDSRFKLDQQLIDFRQVLGHUDWDQHOOHFURQDFKH nazionali e internazionali solo perché base di SDUWHQ]DGLXQÀXVVRPLJUDWRULRFODQGHVWLQRFKH per i primi anni 90 ha interessato in particolare le coste italiane. 'XUD]]RHO¶$OEDQLDqPROWRFDPELDWDGDTXHJOL anni, e di questo hanno cominciato ad accorger­ sene i tanti architetti che hanno partecipato al Concorso per la Rivitalizzazione di Piazza Liria, la piazza principale della città – seconda città del paese, porto e terminale fondamentale del FRVWUXHQGR&RUULGRLR3DQHXURSHR9,,,GHVWLQDWR a collegare i Balcani Meridionali e il Mar Nero alla 6XGG¶,WDOLDSDUWHGLXQDHVWHVDFRQXUED]LRQH metropolitana che ormai collega in un tutt’uno la città Porta dei Balcani con la capitale, Tirana. Che molti architetti stranieri abbiano creduto a tale scommessa, collaborando a rafforzare XQ¶D]LRQH³DYYLDWDGDOOHSLUHFHQWL$PPLQLVWUD]LR­ ni Comunali, grazie anche alla cooperazione di numerosi organismi internazionali e all’attività di VXSSRUWRHGLULFHUFDVFLHQWL¿FDLQFDPSRDUFKHR­ logico e urbanistico offerta da alcune Università Italiane (già da alcuni anni l’Università di Parma, O¶8QLYHUVLWjGL%RORJQDHSLUHFHQWHPHQWHO¶8QL­ versità di Chieti e Pescara) è dunque un buon segnale di risposta per la città adriatica e i suoi coraggiosi amministratori, ma anche un segno di novità per l’apertura in Albania di una discus­ sione – fatta anche di opere e di progetti – sul destino delle città storiche e il ruolo che lo spazio pubblico e le attrezzature collettive (funzioni molto WUDVFXUDWHGDOORVYLOXSSRXUEDQRSLUHFHQWHGL queste città) possono ancora svolgere nei delicati HTXLOLEUL¿VLFLHQHOOHQXRYHHFRQRPLHXUEDQH delle sue città. L’Albania non è peraltro nuova all’esperienza dei Concorsi di Architettura, anche GLOLYHOORLQWHUQD]LRQDOH0D¿QRUDHUDVWDWD7LUDQD 71 RIQRYHOW\FRPSDUHGWRWKHH[SHULHQFHVFLWHG7KH¿UVWLVWKDWDIWHU the contest is opposed adoption of the Urban Plan ­ Plan for the central area of the city, due in many respects to one of our Reco­ YHU\3ODQZKLFK¿UVWSODFHSURWHFWLYHFRQGLWLRQVDQGRSSRUWXQLWLHV cultural development of the area’s most valuable archaeological and historic city. A plan should be repeated, which became law ­ unlike many more announced plans for the capital city, never became operational ­ and even drafted with the cooperation of several Italian universities. The competition project is therefore to provide operating conditions for a set of rules and knowledge that the plan adopted at its formation, also based on studies and analysis carried out by local programs and subjects of international cooperation. The second novelty is the use of the Web and new technologies has facilitated the development of a distance and overall design theme articulated through the medium of a multilingual website (Albanian, English, Italian): www.iliriasquarecompetition.org, probably destined to become soon a veritable museum of virtual urban city, waiting just inside the square are the real place, as reque­ sted by the announcement. Thus, the activity of an architectural competition, in addition to being the best way to select project proposals even leaving the door open IRUDQLPSRUWDQWH[SHULHQFHIRU\RXQJGHVLJQHUVLWLVFRQ¿UPHGDVD tremendous opportunity investigation and knowledge of urban, partly in his training, both in gathering a collection of proposals that are often a further addition of knowledge of the place (design is known). The third, not new to the experience of international architecture competitions, but innovative as compared to recent activities in Alba­ nia, on the resort to practices of participation of citizens and inhabi­ tants of the city and especially in neighborhoods next to the square WRWKHFRQVWUXFWLRQRISURMHFWSURSRVDOVVHFRQGVWDJH7KH¿UVWSKD­ VHLWHQGHGRQ2FWREHUZLWKWKHDQQRXQFHPHQWRI¿YH¿QDOLVWV E\WKH,QWHUQDWLRQDO-XU\ DPRQJRWKHUV/XFD=HYL,WDO\&RXVVDUDQ $ODLQ)UDQFH5RFFR0DUDJQR&DQDGD LWOHDYHVRSHQWKHGH¿QLWLRQ DQGGHYHORSPHQWRIWKH¿YHSURMHFWVWKDWZLOOFRPSHWHIRUWKH¿QDO UHVXOW RI¿FHRIWKHH[HFXWLYHSURMHFWZRUNIRUDQHVWLPDWHGPLOOLRQ euros) also to activities involving the direct involvement of end users ZRUN)LUVWVWDJHRIWKLVVHFRQGSKDVHDQGWKLVSDUWLFXODUSURJUDP participatory activities, the initiative Monday, October 27, entitled ³0HHWLQJ'XUUHVSURMHFWVIRU6TXDUH/LULD´GXULQJZKLFKWRJHWKHU ZLWKWKHSXEOLFSURFODPDWLRQRIWKHUHVXOWVRIWKH¿UVWVWDJHRIWKH competition, and the inauguration of the exhibition graphics of the RULJLQDOSURSRVDOV 'XUUHV3DODFHRI&XOWXUHDQGRSHQVSDFHVLQWKH VTXDUH/LULD WKH¿YHVHOHFWHGJURXSV WKUHH,WDOLDQRQH3RUWXJXHVH one Anglo Albanian, see footnote page) will be called to explain to people in a square, their ideas and proposals, in a public debate that promises lively and participatory. Last particular novelty in style wiki, all contestants will have access WRDOOPDWHULDOVFROOHFWHGLQWKH¿UVWURXQGDVVXPLQJWKH\VKDUHWKH same base, while respecting the intellectual authorship of ideas. 72 a realizzare i primi esperimenti, mettendo a gara opere architettoniche come il recupero della sede nazionale della Banca d’Albania, in piazza Skan­ derbeg, opera prestigiosa di un architetto italiano GHOSULPR1RYHFHQWR9LWWRULR%DOOLR0RUSXUJR alcuni importanti interventi di edilizia direzionale QHOFHQWURGHOODFLWWjSHU¿QLUHDO&RQFRUVRSHUOD TXDOL¿FD]LRQHGHOODSLD]]DSULQFLSDOHGHOODFLWWj capitale, segnata da una discreta partecipazione internazionale. L’esperienza del Concorso Internazionale per ODULYLWDOL]]D]LRQHGLSLD]]D/LULDD'XUD]]RVL segnala tuttavia per alcuni elementi peculiari di novità, rispetto alle esperienze citate. La prima è che tale concorso nasce dopo la combattuta approvazione di un Piano Urbanistico – il Piano per l’area centrale della città, riconducibile per molti versi ad un Piano di Recupero, nella norma­ tiva italiana – che per primo ha posto condizioni di tutela e occasioni di valorizzazione culturale all’area di maggior valore archeologico e storico della città. Un Piano, occorre ripeterlo, divenuto legge – a differenza dei tanti sempre annunciati Piani per la città capitale, mai diventati operati­ vi – e redatto anche grazie alla cooperazione di alcune università italiane. Il progetto di concorso si trova dunque a dare condizioni operative ad un complesso di norme e di conoscenze che il Piano KDGH¿QLWRQHOFRUVRGHOODVXDIRUPD]LRQHDQFKH sulla base di studi e di analisi del luogo realiz­ zate da programmi e soggetti di cooperazione internazionali. Il secondo elemento di novità è dato dall’uso del web e delle nuove tecnologie che ha agevolato lo svolgimento a distanza di un tema progettuale complesso e articolato attraverso lo strumento di un sito web plurilingue (albanese, inglese,italian): www.iliriasquarecompetition.org , destinato pro­ babilmente a diventare a breve un vero e proprio museo urbano virtuale della città, in attesa che proprio all’interno della Piazza trovi sede quello reale, così come richiesto dal Bando di Concorso. In tal senso, l’attività di un Concorso di Archi­ tettura, oltre a costituire il modo migliore per selezionare proposte progettuali lasciando anche aperta la porta di una importante esperienza per giovani progettisti, si conferma anche come una formidabile occasione di indagine e di conoscen­ za urbana, sia nell’atto della sua formazione, sia nella raccolta di un repertorio di proposte che rappresentano spesso un ulteriore aggiunta di conoscenze del luogo (progettare è conoscere). Il terzo, non nuovo alle esperienze dei Concorsi internazionali di Architettura, ma innovativo rispetto alle recenti attività in materia albanesi, riguarda il ricorso a pratiche di partecipazione dei cittadini e degli abitanti della città e in particolare dei quartieri prossimi alla piazza alla costruzione delle proposte progettuali di seconda fase. La prima fase, conclusasi infatti lo scorso 11 ottobre FRQODSURFODPD]LRQHGHLFLQTXHSURJHWWL¿QDOLVWL da parte della Giuria internazionale (tra gli altri: /XFD=HYL,WDOLD$ODLQ&RXVVDUDQ)UDQFLD Rocco Maragna, Canada) lascia infatti aperta la GH¿QL]LRQHHORVYLOXSSRGHLFLQTXHSURJHWWLFKH VLFRQWHQGHUDQQRLOULVXOWDWR¿QDOH LQFDULFRGHO progetto esecutivo, per un importo presunto dei lavori di 5 milioni di euro) anche ad attività che prevedono il coinvolgimento diretto degli utenti ¿QDOLGHOO¶RSHUD Prima tappa di questa seconda fase, e di questo VSHFL¿FRSURJUDPPDGLDWWLYLWjSDUWHFLSDWLYHq stata l’iniziativa di lunedì 27 ottobre, dal titolo: ³'XUUHV0HHWLQJSURJHWWLSHU3LD]]D/LULD´QHO corso della quale, assieme alla proclamazione pubblica dei risultati della prima fase del concor­ VRHDOO¶LQDXJXUD]LRQHGHOODPRVWUDJUD¿FDGHOOH SURSRVWHLQL]LDOL 'XUD]]R3DOD]]RGHOOD&XOWXUD e spazi all’aperto in piazza Liria), i cinque gruppi selezionati (tre italiani, uno portoghese, uno anglo albanese, vedi nota a piè di pagina), verranno chiamati ad illustrare ai cittadini, in piazza, le loro idee e proposte, all’interno di un pubblico dibatti­ to particolarmente vivace e partecipato. Ultimo particolare di novità: in perfetto stile wiki, tutti i partecipanti al concorso hanno avuto accesso a tutti i materiali raccolti nella prima fase, nell’ipotesi di condividere la stessa base di par­ tenza, pur nel rispetto della paternità intellettuale delle idee progettuali. 'XUUHV2FWREHU;)RUXPRI$GULDWLFDQG Ionian. Images of the inaugural conference, with the SDUWLFLSDWLRQRIWKH,WDOLDQ$PEDVVDGRU6DED'¶(OLD images of the session dedicated to the presentation of the competition (from left to right: Piero Rovigatti, 9DQMXVK'DNR(PLOLR'¶$OHVVLR Durazzo, 28 Ottobre 2008, X Forum delle Città dell’Adriatico e dello Ionio. Immagini del convegno inaugurale, con la partecipa­ zione dell’Ambasciatore d’Italia Saba D’Elia, e della sessione dedicata alla presentazione del Concorso (da sinistra a destra: Piero Rovigatti, Vanjush Dako, .Emilio D’Alessio). 73 2.3 First phase JURY’S STATEMENT / Valutazione della Giuria La Giuria Internazionale, composta dai seguenti membri: $UFK/XFD=HYL,1$5&+,WDOLD $UFK$ODLQ&RXVVHUDQ3DULJL)UDQFLD 'RWW$OEHUWR0RQWL8QLYHUVLWjGL3DUPD,WDOLD $UFK5RFFR0DUDJQD7RURQWR&DQDGD (GXDUG0XND6WRFFROPD6YH]LD $UFK9LFWRU'KLPJMLQL'XUD]]R$OEDQLD $UFK0DULQ%LFRNX'LSDUWLPHQWRGHOOH3ROLWLFKH8U­ EDQHH3LDQL¿FD]LRQH0LQLVWHURGHL//337UDVSRUWL e Telecomunicazioni, Albania, e sotto la direzione del Presidente Onorario della giuria, Sindaco &RPXQHGL'XUD]]R,QJ9DQJMXVK'DNRVLqULXQLWD il giorno 9 ottobre alle ore 16,00 presso la sala A del 3DOD]]RGHOOD&XOWXUDLQ'XUD]]R I lavori della Giuria sono stati introdotti dal prof. The Jury paid careful consideration to all the 34 remaining proposals, Piero Rovigatti, che ha illustrato i risultati della evaluating the proposed concepts, without being aware of the authors &RPPLVVLRQH7HFQLFR6FLHQWL¿FDULXQLWDVLQHOJLRUQR precedente (...) RIHDFKVFKHPH7KH-XU\VHOHFWHGWKHIROORZLQJ¿YHSURSRVDOV Project Linea D’ombra This scheme offers a soft concept. The unity of the whole and the covered element on the east side is seen as a positive approach. The organization of vehicular circulation is not as clear, therefore it needs DEHWWHUGH¿QLWLRQ)RUWKHQH[WSKDVHFRQVLGHUGHYHORSLQJDEHWWHU connection between the archeological sites and the square. Project Suoli Sensibili The interpretation of the public space is interesting in the provision of sensitive connections with the rest of the city, especially on east side. More attention should be given in the resolution of the circulation of vehicles and pedestrians. La Giuria Internazionale (...) ha dedicato un attento esame a tutte le 34 restanti proposte, prendendo in esame i singoli elaborati progettuali, esaminati in forma anonima, senza la conoscenza dei rispetti autori. Al termine di tale valutazione, la Giuria ha VHOH]LRQDWROHVHJXHQWLFLQTXHSURSRVWHLGHQWL¿FDWH in base al motto di progetto, accompagnandole da un giudizio complessivo e da alcune indicazioni per lo sviluppo del progetto. Progetto Linea d’ombra Questo progetto propone un approccio soft dell’in­ tervento. L’unità dell’intervento e l’elemento porticato coperto sul lato est sono stati valutati come un approccio positivo. L’organizzazione della circola­ zione veicolare non è tuttavia del tutto evidente, e SHUWDQWRDEELVRJQDGLXQDPLJOLRUHGH¿QL]LRQH3HU la prossima fase si consiglia di prendere in conside­ UD]LRQHODGH¿QL]LRQHGLXQDPLJOLRUHFRQQHVVLRQH tra i siti archeologici e la piazza. Project Con Sheshi Temporary There is an interesting and harmonious balance between the geo­ metrical and natural shapes. The scheme needs to improve on its pedestrian circulation. The extension of the hill onto the square as an Progetto Suoli Sensibili extended park area is a positive solution. The vehicular road immedia­ L’interpretazione dello spazio pubblico è interessan­ tely to the south of the archeological forum cannot be continuous. te nella proposta avanzata di sensitive connections Project Sundial The scheme’s organization provides an axial rationalization on the WHUULWRU\DQGLWLVLGHQWL¿HGDVDQHZIRFXV7KHSURMHFWKDVSRVLWLYH aspects regarding the connectivity of the archeological sites. Improve­ ment and special consideration is needed to articulate the grading and archeological remains at the base of the surroundings of the vertical element. 74 con il resto della città, in particolare sul lato est. Una maggiore attenzione dovrebbe essere data nella ri­ soluzione della circolazione dei veicoli e dei pedoni. Progetto con Sheshi temporaneo La proposta è basata su un interessante ed armo­ nioso equilibrio tra le forme geometriche e naturali. /RVFKHPDKDELVRJQRGLPLJOLRUDUHODGH¿QL]LRQH dei sistemi di circolazione pedonale proposti. L’estensione della collina sulla piazza nella forma di un estesa area a parco è una soluzione positi­ YD/DVWUDGDYHLFRODUHLPPHGLDWDPHQWHD6XGGHOO¶DUHDDUFKHRORJLFDGHO)RUXP %L]DQWLQRQRQSXzHVVHUHFRQWLQXDHPHULWDGLHVVHUHULGH¿QLWDLQVHGHGLSURJHWWR successivo. Progetto Sundial Il regime prevede l’organizzazione della piazza sulla base di una lettura e di una UD]LRQDOL]]D]LRQHDVVLDOHGHOODFLWWjLQUDSSRUWRDOVXRWHUULWRULRHGLGHQWL¿FDXQ nuovo focus urbano. Il progetto ha aspetti positivi per quanto riguarda la con­ nessione proposta tra i diversi siti archeologici. Un miglioramento e una speciale FRQVLGHUD]LRQHqQHFHVVDULDSHUDUWLFRODUHODFODVVL¿FD]LRQHHUHVWLDUFKHRORJLFL alla base dei dintorni dell’elemento verticale. Progetto Folding Il progetto ha aspetti positivi per quanto riguarda la connessione tra i siti archeolo­ gici. E’ anche di interesse la disposizione di sensibili collegamenti con il resto della città. Una buona considerazione deve essere data all’area archeologica posta a 1RUG(WSHUXQDSLQHWWDGH¿QL]LRQHWUDLWUDI¿FLYHLFRODULHSHGRQDOL,QROWUHOR VFKHPDSURSRVWDKDELVRJQRGLXQDSSURFFLRSLXQL¿FDWR /D*LXULDKDLQ¿QHHVSUHVVROHVHJXHQWLUDFFRPDQGD]LRQLJHQHUDOLDWXWWLLFRQFRU­ renti selezionati: 1 ­ Prendere in considerazione il mantenimento della circolazione veicolare all’interno della piazza anche se come secondaria alla circolazione pedonale, rispettando il carattere dominante di quest’ultima, senza cioè eliminare completa­ mente la circolazione veicolare. 2 ­ Evitare la realizzazione di aree di parcheggio all’interno della piazza. 3 ­ Prendere in considerazione la possibilità di sviluppare il lato est della piazza, attraverso usi che possano rafforzare il carattere civico e pubblico di tale luogo. In TXHVWRDPELWRqDQFKHGDYHUL¿FDUHODSUREDELOHSUHVHQ]DGLULOHYDQWLSUHVHQ]H archeologiche. 6XOODEDVHGHOOHFDUDWWHULVWLFKHPLFURFOLPDWLFKHGHOODFLWWjGL'XUD]]RXQXVR diffuso dell’elemento acqua nelle soluzioni progettuali è fortemente raccomandata. $ERYH'XUUHV3DODFHRI&XOWXUH2FWREHUUHYLHZRIWKH¿UVWVWDJHSURMHFWVE\ members of the International Jury/ Durres, Palazzo della Cultura, 9 ottobre 2008, esame dei progetti di prima fase da parte dei membri della Giuria Internazionale. Project Folding The project has positive aspects regarding the connectivity between the archeologi­ cal sites. There is a provision of sensitive connections with the rest of the city. A good consideration needs to be given to the north east archeological area, which UHJDUGVDSURSHUGH¿QLWLRQEHWZHHQYHKLFX­ ODUDQGSHGHVWULDQUHDOP)XUWKHUPRUHWKH VFKHPHQHHGVDPRUHXQL¿HGDSSURDFK The Jury has the following general recom­ mendations to all the selected competitors: 1­ Consider maintaining vehicular cir­ culation in the square as secondary to pedestrian movement by enforcing the dominance of the latter, but not completely eliminating the vehicular movement. 2­ Avoid parking areas inside the square. 3­ Consider the possibility of developing the east side incorporating uses which reinforce the civicness and publicness of the place. In this area, be aware of the probable high archeological presence. 4­ Based on the micro­climate conditions of WKHFLW\RI'XUUHVWKHSUHVHQFHRIZDWHULV strongly recommended. 75 3URMHFWGHVLJQIRUWKHH[KLELWLRQRI¿UVWSKDVHSURMHFWV 0DULD)UDQFHVFD0RQWHIRUWH6HSWHPEHU / Progetto allestimento per la mostra dei progetti di prima fase, (Maria Monteforte, settembre 2008) 3 Design solutions/ Risposte progettuali della prima fase 3.1 Linea d’ombra Arch. Ivan de Sousa Arch. Ines Antunes 3257$75$25,(17((2&&,'(17(/$5,1$6&,7$ 'XUD]]RFLWWjPLOOHQDULDVLVYLOXSSDLQXQDSRVL]LRQHVWUDWHJLFDVXOO¶DQWLFRDVVHPLOLWDUHHFRPPHUFLDOHGHOO¶LPSHURUR­ mano, la via Egnazia ­ una direttrice che rappresenta il primo legame tra Oriente ed Occidente. La via Egnazia, infatti, QRQqSLFKHXQSUROXQJDPHQWRGHOODYLD$SSLDFKHFROOHJDYD5RPDD%ULQGLVLHYLUWXDOPHQWHYLDPDUHUDJJLXQJH­ YDO¶DWWXDOH'XUD]]RGRYHSDUWLYDODYLD(JQD]LD¿QRDOOD*UHFLD8QDGLUHWWULFHVWUDWHJLFDFKHHEEHXQUXRORLPSRUWDQ­ WHSHUJOLVFDPELHODGLIIXVLRQHFXOWXUDOHLQHWjPHGLHYDOHHGRWWRPDQD'XUD]]RLQTXHVWRVHFRORVDUjVHJQDWDGDOOD ULQDVFLWDGHOODVWHVVDGLUHWWULFHFKHJOLKDIDWWRVWRULDFRQODUHDOL]]D]LRQHGHOFRUULGRLR9,,,/DFLWWjUHFXSHUHUjLOWHPSR perduto e riconquisterà il suo ruolo di porta tra Oriente e Occidente. 81$9,6,21(3(5'85$==2/$&,77¬'(/182920,//(11,2 ³O¶HVSHULHQ]DVWRULFDGHOOHQRVWUHFLWWjFLLQGLFDFRQVXI¿FLHQ]DFKLDUH]]DTXDOLVRQRLIDWWLGHFLVLYLLWHPLGH¿QLWLL mezzi e le soluzioni adeguati” (Giorgio Grassi) &RQODUHFHQWHWUDQVL]LRQHGDOFRPXQLVPRDOO¶HFRQRPLDGLPHUFDWRO¶DUHDXUEDQDGL'XUD]]RqFUHVFLXWDVHQ]DXQD strategia generale di un futuro possibile e sostenibile. Con l’arrivo del progetto di connessione per facilitare lo scambio GLPHUFLHQHUJLDHSHUVRQHWUDO¶8QLRQH(XURSHDHJOLVWDWLEDOFDQLFLLOFRUULGRLR9,,,O¶HVSDQVLRQHXUEDQDLQFRQWUROODWD SXzDFFHQWXDUVLDQFRUDGLSLGDQQHJJLDQGRVHULDPHQWHOHFLWWjHLOWHUULWRULRÊTXLQGLXUJHQWHSUH¿JXUDUHXQIXWXUR SHU'XUD]]RHQRQVHJXLUHLSDVVLGHOOHFLWWjGHOO¶(XURSD2FFLGHQWDOLFKHLQSRFKHGHFLQHG¶DQQLKDQQRYLVWRLOVXR territorio invaso da costruzioni senza una struttura di supporto capace di assicurare la crescita della città presente e futura. L’elemento essenziale della vita delle città è stato addirittura rinunciato­ la strada urbana­ che rappresenta, a nostro avviso, un evidente abbandono del progetto della società civile. 2JJLTXHVWHFLWWjKDQQRFRPHSUREOHPDFHQWUDOHODULTXDOL¿FD]LRQHGHOOHLPPHQVHSHULIHULHFRVWUXLWHQHOOHXOWLPH decadi. Una sorta di risarcimento all’uomo costretto a vivere in un ambiente costruito nella totale indifferenza dell’ XRPRVWHVVR'XUD]]RSXzHYLWDUHTXHVWRWLSRGLULVDUFLPHQWRHWURYDUHQXRYHULVSRVWHFUHGLELOLGXUHYROLHVRSUDWXWWR FRQGLYLVLELOLSHUO¶DQQXQFLDWDFUHVFLWDXUEDQD8QDULVSRVWDFKHVLDFDSDFHGLSLDQL¿FDUHXQSURFHVVRWHPSRUDOH mediante una matrice sociale dove la continuità, densità e limite urbano danno forma alla città. Pensare nel centro storico senza pensare contemporaneamente nel futuro dell’espansione della città è rinviare fatalmente un problema che investirà il territorio in generale ma sopratutto il proprio centro storico che è spesso la prima vittima collaterale. I IRWRPRQWDJJLFKHDEELDPRPHVVRDFRQIURQWRPRVWUDQRGXHPRGHOOLXUEDQLFRQSULQFLSLRSSRVWL,SULPLGXH'XUD]]R 0DQKDWWDQH'XUD]]R%DUFHOORQDUDI¿JXUDQRXQDFUHVFLWDXUEDQDEDVDWDVXOODFRQWLQXLWjGHQVLWjHOLPLWHXUEDQRLQ FXLODVWUXWWXUDXUEDQDqODEDVHGHOODORURLGHQWLWj/¶XOWLPRLQYHFH'XUD]]RGLVSHUVLRQHXUEDQDUDI¿JXUDODFLWWj basata sulla discontinuità e la frammentazione. Un modello che rompe con la dialettica città/campagna e racconta XQDFLWWjLQFLYLOHGRYHODSHUGLWDGLVHQVRODYLROHQ]DHOHGLI¿FROWjGHOODYLWDTXRWLGLDQDVRQRXQDSUHVHQ]DFRVWDQWH Ogni forma di vita cittadina è stata eliminata. Uno scenario che rappresenta la pochezza delle risposte all’espansione XUEDQDGHOOHXOWLPHGHFDGLQHOOHPDJJLRUSDUWHGHOOHFLWWj'XUD]]RYDQWDDQRVWURDYYLVRXQDTXDOLWjVWUDRUGLQDULD quella della ritardata crescita urbana che mantiene tuttora e nonostante tutto intatto un territorio ancora incontamina­ to. Una qualità che deve essere valorizzata e fare parte del nuovo progetto del futuro. “Solo così possiamo evitare la potenza distruttrice della dispersione urbana e le sue conseguenze già ampiamente comprovate nelle maggior parte delle città”. 325729,$3,$==$ /DFLWWjGL'XUD]]RHGLQSDUWLFRODUHLOVXRFHQWURVWRULFRGLVSRQHGLXQQRWHYROHSDWULPRQLRVWRULFRFXOWXUDOHDWHVWL­ monianze delle differenti culture che l’hanno abitata nei diversi periodi storici. L’identità della città è fortemente legata al suo fronte d’acqua che lungo la storia fu un elemento vitale nella formazione della sua morfologia urbana. Infatti, la via del Commercio, perpendicolare alla linea di costa, rappresenta la matrice generatrice della città storica che colle­ gava le due porte della città, a sud la porta del mare e a nord la porta grande.Oggi questa via, la principale arteria del centro urbano, collega due importanti spazi pubblici, il parco costiero di carattere ludico e ricreativo e la piazza della /LEHUWjGLFDUDWWHUHVLPEROLFRHUDSSUHVHQWDWLYR8QVLVWHPDFKHSXzGLYHQWDUHXQYHURPRWLYRTXDOL¿FDWRUHGHOO¶ DPELHQWHXUEDQRFDSDFHGLULVWDELOLUHO¶DWWHVROHJDPHFRQODVWRULDXUEDQDGL'XUD]]R/DSLD]]DLQTXHVWRVLVWHPD svolge un ruolo fondamentale, quello di articolare il centro storico “intramura” a sud con il resto della città a nord. Un’ articolazione capace, contemporaneamente, di collegare i vari episodi culturali e storici circostanti, tra cui, le aree archeologiche, il castello, i tessuti ottomani esistenti, la moschea, ecc. Negli ultimi anni, tuttavia, la città ha assistito ad un aumento di costruzioni spesso oggetto di speculazione, dove la ricerca formale dell’oggetto in sé prevale sulle relazioni contestuali. La Piazza della Libertà e il suo intorno è l’esempio di questo fenomeno che nonostante i vari in­ WHUYHQWLHSURJHWWLQRQqULXVFLWDDGDFTXLVWDUHXQFDUDWWHUHIRUPDOHHVSD]LDOHVWDELOH/DVXD¿VLRQRPLDLQIDWWLGHULYD GDQXPHURVLHGLYHUVLPRPHQWLGLIRUPD]LRQLPDqQHOFKHVLqFHUFDWRGLGH¿QLUHLOODWRQRUGGHOODSLD]]DFRQLO 79 80 Palazzo della Prefettura. Una soluzione parziale che ha dato origine a due spazi continui ma con direzioni distinte, tuttora irrisolti. Già nel SLDQRGLO¶DUFK/HRQH&DUPLJQDQLWHQWDYDGLULVROYHUHLOSUREOHPDSURSRQHQGRXQQXRYRHGL¿FLRFHUQLHUDGLIURQWHDOO¶DWWXDOH3DOD]]R 0XQLFLSDOHFKHGHOLPLWDLGXHVSD]LXQDSLD]]DHXQDURWDWRULDSHUULVROYHUHLOWUDI¿FRGLTXHOWHPSR2JJLODVWHVVDDUHDVLSUHVHQWDFRPH XQDPSLRVSD]LRGRYHODVFDUVDDUWLFROD]LRQHHLOFRQÀLWWRWUDLOSHGRQHHLOWUDI¿FRYHLFRODUHSHUVLVWRQR&RQODOLPLWD]LRQHGHOWUDI¿FR veicolare della via del Commercio e del centro storico in generale, d’accordo con il piano urbanistico del 2007, infatti, lo slargo perde il suo senso. Si propone, pertanto, una nuova piazza come alternativa all’attuale slargo. La nuova piazza di carattere culturale insieme alla piaz­ za rappresentativa esistente formano un unico spazio pubblico, capace di ristabilire un’articolazione adatta alla complessa struttura urbana GHOODFLWWjHDOOHQXRYHHVLJHQ]HFRQWHPSRUDQHH/¶RELHWWLYRSULPDULRGHOSURJHWWRGLYLHQHDOORUDODULGH¿QL]LRQHHO¶DUWLFROD]LRQHGHJOLVSD]L che compongono la piazza attraverso il suo perimetro e le relazioni con le aree circostanti. LO SPAZIO PUBBLICO Con la realizzazione di un plastico di studio capace di rappresentare e descrivere le caratteristiche morfologiche, volumetriche e spaziale dell’area d’intervento, si è sviluppata una prima proposta progettuale che prevede tre elementi essenziale: 3(5&2562&23(572XQDOLQHDG¶RPEUDFKHQDVFHGDOO¶LQWHQ]LRQHGLULFXFLUHOHUHOD]LRQL¿VLFKHFRQOHDUHHFLUFRVWDQWLGLLQWHUHVVH storico, culturale e paesaggistico, articola in due spazi la piazza. Un segno che si concretizza in percorso coperto, percorre e delimita tutto il lato est dello spazio pubblico, sul quale si sviluppa un’area di cerniera tra i due spazi. Qui si prevede un’ampia copertura sospesa dispo­ nibile ad accogliere molteplici programmi di appoggio quali,caffè­bar, ristorante, punto di informazione turistico o semplicemente un’area ombreggiata. “Un segno che si concretizza in percorso coperto... sul quale si sviluppa un’area di cerniera tra i due spazi”, “La nuova piazza di carattere culturale insieme alla piazza rappresentativa esistente formano un unico spazio pubblico, capace di ristabilire un’articolazione adatta alla complessa struttura urbana della città e alle nuove esigenze contemporanee”. 2­ SCALINATA: una imponente scalinata sul perimetro ovest raggiunge la quota della Moschea e del verde pubblico per consentire una maggiore integrazione con la piazza. In questo modo la piazza e il giardino della Moschea formano un unico continuum di carattere pubblico. La scalinata invita anche ad un utilizzo informale. “La piazza e il giardino della moschea formano un unico continuum di carattere pubblico”. ,/18292(',),&,238%%/,&2XQQXRYRYROXPHSRVWRVXOIURQWHRSSRVWRGHOOD3UHIHWWXUDSHUPHWWHGLGHOLPLWDUHORVSD]LRGHOOD SLD]]DHYDORUL]]DUHOHLQWHUD]LRQLWUDLGLYHUVLHGL¿FLHVLVWHQWL8QHGL¿FLRDGHVWLQD]LRQHSXEEOLFDGLDOWH]]DQRQVXSHULRUHDTXHOORGHOOD 3UHIHWWXUD6LSURSRQHORVSRVWDPHQWRGHOODELEOLRWHFDSHULOQXRYRHGL¿FLR6XOODWRRSSRVWRLQYHFHVLSURSRQHLOQXRYR0XVHRGHOOD&LWWj VXOO¶DWWXDOHHGL¿FLR4XHVWHGXHQXRYHGHVWLQD]LRQLG¶XVRLQVLHPHDO3DOD]]RGHOOD&XOWXUDFRVWLWXLUDQQRXQLPSRUWDQWHSRORFXOWXUDOHGHOOD città. 9,$%,/,7$¶ /DSURSRVWDSUHYHGHODSHGRQDOL]]D]LRQHGHOORVSD]LRSXEEOLFRDWWUDYHUVRLOULRUGLQRGHOWUDI¿FRYHLFRODUH6LSURSRQHTXLQGLFRPHDOWHUQD­ WLYDDOODYLDGHO&RPPHUFLRHDOODYLD+7URSOLQLODGHYLD]LRQHGHOWUDI¿FRSHUOHYLHSHUSHQGLFRODULDOODYLD$OGR0RXURFKHUDJJLXQJHQGROD YLD(JQDWLDFROOHJDWXWWDO¶DUHDSRUWXDOH,QTXHVWRPRGRO¶DUHDG¶LQWHUYHQWRWUDVIHULVFHODVXDIXQ]LRQHDWWXDOHGLVQRGRGHOWUDI¿FRSHUDUHH OLPLWUR¿GLYHQWDQGR¿QDOPHQWHXQYHURVSD]LRSXEEOLFRUDSSUHVHQWDWLYRVLPEROLFRHFXOWXUDOHGHOODFLWWjÊJDUDQWLWDFRPXQTXHO¶DFFHVVLEL­ lità ai residenti, mezzi di soccorso e manutenzione con opportune demarcazioni nella pavimentazione del nuovo spazio pubblico. 81 3.2 Temenos Prof. Arch. Umberto Siola Arch. Luigi Milano $UFK)HGHULFD9LVFRQWL Arch. Renato Capozzi 7KHQRWLFH³5HYLWDOL]DWLRQ)UHHGRPVTXDUH,QWHUQDWLRQDO&RPSHWLWLRQLQ'XUUHV´QHHGVDERYHDOOWRWU\WRDQVZHUWRD TXHVWLRQZK\PDNLQJDSURMHFWIRUWKLVVTXDUHRIWKHFLWW\RI'XUUHV" Bacause language spoken by architetcts, or the one which they should speak, is the one of the project, our answer LVDERYHDOOLQWKHGUDZLQJVRIWKHVTXDUHHYHQLILW¶VRQO\WREHLQWHQGHGDVD¿UVWK\SRWKHVLVVXVFHSWLEOHRIRWKHU investigations. +RZHYHUWKHKLQWRIUHPDUNSURSRVHGE\WKH1RWLFHLVYHU\LQWHUHVWLQJDQGLWKDVDSDUWLFXODUPHDQLQJDFFRUGLQJWR XVEHFDXVHWKHFRPSHWLWLRQFRQFHPVWKHVXEMHFWRIWKHUROHRIWKH³FHQWUDO´SXEOLFVSDFHRIWKHFLW\RI'XUUHV The quality of the public space, in all the westem urban history, starting from the Greek agora and the Roman forum, has always represented an important element to determine the “beauty” and the concise intelligibility of a city, almost as the presence of monuments or the architectural quality of the public or private buildings, which were the tissues. And a great part of the considerable role of the public space has always been not only in some spatial intrinsic quali­ WLHVRIWKHSXEOLFVSDFHEXWDOVREHFDXVHWKH\DUH³SODFHVRIUHODWLRQVKLS´DQGRI³UHÀHFWLRQ´EHFDXVHWKH\DUHSODFHV where people can meet each other, civil place seat of the most important urban functions, supporting structure, “ske­ leton” of the building city. It seems to us that this caracteridtic of the public space was expressed clearly by Manuel da 6DOj0DUDOHVLQWKHLVVXH/RWXV1RWHERRNV'RFXPHQWVZKLFKKDVWKHWLWOH'HVLJQLQJ&LWLHVZKHUHKHZURWH³WKHLP­ portance of this latter (of the public space), is not in its vastness, quantitatively dominant or symbolic protagonist, but LQSXWWLQJLQFRQQHFWLRQWKHVSDFHVPDNLQJWKHPDFROOHFWLYHHVWDWH´6RLW¶VYHU\VLJQL¿FDQWWKDWMXVW'XUUHVVWDWHVWKH SUREOHPRIWKHUHGHVLJQRILWVPRVWFHQWUDOVSDFHLQWHUPVQRWRQO\RISRVLWLRQEXWDOVRRILPSRUWDQFHDQGVLJQL¿FDQFH In a very near future it is probable that the inner system of Albania will be realized in a unique linear city between the FLW\RI7LUDQDDQG'XUUHV$FFRUGLQJWRWKLVK\SRWKHVLV'XUUHVZLWKLWVVLJKWRQWKHVHDZLOOEHDQLPSRUWDQWSRLQWIRU international connections. But to reach these new aims, a more general matter concerning the politics of the cities and their way to use architecture in the countries that want to expand themselves must be considered. 'XUUHVLVKDUGO\ZRUNLQJGXULQJWKHVH\HDUVWREHFDPHD(XURSHDQFLW\DQGWRUHFRQTXHUDUROHZKLFKLWKDGLQWKH FRXUVHRILWVVWRU\)RULWVJHRJUDSKLFDOSRVLWLRQ'XUUHVZDVLQDFRXQWU\RIVPDOOGLPHQVLRQVDFUXFLDOFURVVURDGRI different peoples and countries. Almost since the Roman Empire is evident the cosmopolitan vocation of this country DVQDWXUDOFRQÀXHQFHIRUDQ(XUR$VLDWLFDQGPXOWLQDWLRQDOSROLWLFDOV\VWHPQDWXUDOFRQÀXHQFH±DVZHMXVWVDLG before – for its essential geographical position in the system of communication and organizationof trade exchanges. $FWXDOO\WKHWUXHYRFDWLRQRIWKHVHODQGVDQGSHRSOHVZDVGH¿QHGHPEOHPDWLFDOO\ IURP%& ZLWKWKHFUHDWLRQRI (JQDWLDVWUHHWZKLFKVWDUWLQJIURP%UXGLVLXPWKHHQGRI$SSLDFRQQHFWHG'XUUDFKLXP 'XUUHV'XUD]]R WKURXJK0D­ FHGRQLDQODNHVDQG9DUGDUYDOOH\7R7HVVDORQLFDDQGWKH*UHHFHDQGWKHQGRZQWRWKH(DVWKLQJHEHWZHHQ/DWLQLW\ DQG+HOOHQLVPODWHUIUHHWUDGHDUHDEHWZHHQWKH(DVWHPDQG:HVWHUQ5RPDQ(PSLUHV%XWWKLVFRVPRSROLWDQYRFD­ tion had to face the complex political and social movements that followed the decline of the Roman Empire with all its JHRSROLFDOFKDQJHVWKHGLIIHUHQWDQGRIWHQRSSRVHGGHVWLQLHVRIWKH$GULDWLFODQGV RQVLGH,WDO\(XURSHUHPRGHOHG E\*HUPDQLFSRSXODWLRQV±*RWKV/RQJREDUGV)UDQNV±RQWKHRWKHUVLGHWKH%DONDQVSUHVVHGE\6ODYLFLQYDVLRQV driven by Eastern nomads, Avari, Bulgarians, Turks) offered a complex alternation of closures, different adjustments, new relations. The current slakenings of the relations with the capital, within an alternation of local selfgovemment and VWURQJLPSHULDODFKLYHPHQWUHFRQ¿UPWKHROGYRFDWLRQRIWKH$OEDQLDQODQGVWREHFURVVURDGEHWZHHQWKH(DVWDQG /DWLQ0HGLWHUUDQLDQWKHVWUDWHJLFIXQFWLRQRIQDWXUDOFRQÀXHQFHEHWZHHQ(XURSHDQG%LVDQ]LRZDVDOVRHVWDEOLVKHG during the time of Crusades, until the conquest of Costantinopoli in 1204. 7RGD\WKHFLW\RI'XUUHV±LQSDUWLFXODUIRULWVSRVLWLRQDQGWKHGLPHQVLRQRILWVKDUERXU±FDQKDYHDQLPSRUWDQWUROHRI crossroad on the Adriatic sea: it can be on one side the gate for the East, on the other side a European city, confor­ PLQJDVDROGWUDGLWLRQDVWKHVDPHFRXQWU\RI$OEDQLD7KHUHIRU'XUUHVFDQEHFRQVLGHUHGDVWKH³KLVWRULFDOFLW\´RI $OEDQLDWKLVIHDWXUHJLYHVLWDQDWLRQDOUROHWKDWKDVWREHSURPRWHG'XUUHVLWVDOVRWKH%DOFDQLFGRRUWR³&RUULGRLR´ for this reason, it is an international junction of strategic importance. But, this aspects can be both opportunities and threatens, since the development of the city in the next years could produce the loss of the typical urban features of the city, as it happens in many developing countries. To avoid these dangers one has to work considering its past and history. Albania, as often happens or happened in other countries after the fall of communist dictatorships, risks that the break with the past changes into loss of identity. Another risk for Albania is that its particular attention to western culture in general – especially to American culture – could cause the recourse to a sort of International Style perver­ WLQJWKHROGHVWVLJQVRIDSDVWWKDWRQWKHFRXQWUDU\KDVWREHUHDI¿UPHG'XUUHVGHPRQVWUDWHGFRQVFLRXVQHVVIRU WKLVMXVWRQWKHRFFDVLRQRIWKH&RPSHWLWLRQ³8UEDQ6WXG\'XUUHV&LW\&HQWUDO=RQH´DQGWRGD\LQWKHJHQHUDOSLFWXUH of the rules determined by the Plan, the Competition for one of its most representative places is the chance for a real ¿UVWFRQFUHWHSURRILQZKLFKLWFDQGHPRVWUDWHWREHDIDVKLRQ(XURSHDQFLW\EXWDOVRFRUHIXODQGSURXGRILWVKLVWRULFDO URRWVDQGWUDGLWLRQV8UEDQVWUXFWXUHRIWKHZKROHFLW\RI'XUUHVFDQEHUHDGDVVHWXSRQD³FHQWUDOVSLQH´IRUPHGE\ the axis which connects the present entrance to the harbour to the area of the amphitheatre: the spine constitutes the bisector of a triangle which sides are constituted by boarding line of the commercial harbour (on the east) and by the 82 83 piece of the lin of the coast probably destined to a new tourist development (on the west). This “central spine” unable to develop itself be­ FDXVHRIWKHRURJUDSKLFDOKLOO\V\VWHPXQGHUJRHVDURWDWLRQMXVWLQFRUUHVSRQGHQFHRI)UHHGRPVTXDUHZKHUHLWIRUNVLQDQD[LVZKLFKJRHV to the north and in another, lightly folded to the east. Both get onto the orthogonal system, characteristic of the recent expansion of the city to the north, leaned on the station axis. The square so is really the “centre” of the city and shelters the most important public buildings (the municipality, the mosque, the prefecture and the museum). And besides it’s the “heart” of the city in which the archaeological runs linked to the tower and the amphitheatre, the By­ ]DQWLQHZDOODQGWKHFLUFXODUIRUXPFRQYHUJH%XWLIWKHVHDUHWKH³UHDVRQV´WRUHGHVLJQ)UHHGRPVTXDUHLW¶VQRWOHVVLPSRUWDQWDFFRUGLQJ to us, the way in which this will be done: because one needs to be certain that the project will give back, intelligible, the meanings and the values about which one discussed. 6RRXUK\SRWKHVLVLVWRUHGHVLJQ)UHHGRPVTXDUHDVDFHQWUDOHOHPHQWDVRUWRI6FDQGHUEHJVTXDUHIRU'XUUHV$QGWKLVVHHPVWREH the solution which could preserve the safeguard of the practicability expected by the Plan: with a main practicability which coming from the east, coasts the western side of the square and goes throught the west, along the front of the Museum and a secondary practicability ZKLWKDOLPLWHGXVH ZKLFKFRPPLQJIURPWKHKDUERXUFRDVWVWKHZHVWVLGH,W¶VDELJVOLSZD\FKDUDFWHUL]HGE\VWDLUVZKLFKGH¿QHZLWK the difference of a hight, a big central public space. One foresees to realize a basement level, for a parking, towords the municipality, DQGDQH[SRVLWLYHVSDFHWRZRUGVWKHPXVHXP7KHIXO¿OPHQWRIWKHVHYROXPHVFDQSHUPLWWRVXSSRVHWKHUHDOL]DWLRQRIWKHSURMHFWE\D private person who invests and who can be within his means with the management of these spaces. But on the central space there is a quite important conceptual difference between the hypothesis of a drawing of this square in comparison with the reference to the square of 7LUDQD,Q7LUDQDWKHXQLWDU\GUDZLQJRIWKHFHQWUDOSODFHFRPHVIURPDXQLWDU\GHVLJQRILWVEXLOGLQJV,Q'XUUHV)UHHGRQVTXDUHHPERGL­ PHQWRIWKHSDUWLFXODUFKDUDFWHURIWKLVFLW\LVWKHSODFHRIWKHKLVWRULFDOVWDWL¿FDWLRQVDQGWKHPHHWLQJRIGLIIHUHQWJHRPHWULHVDQGDWWLWXGHV So one has to introduce some exception in this “central” drawing which can call to cause as protagonists the buildings which characteri­ ]HGDQGGUDZWKHVTXDUHLQWKHGLUHFWLRQVRIWKHÀRRULQJVLQWKHSODFHPHQWRIWKHDSSURDFKVWDLUVWRWKHFHQWUDORYHUUXQLQWKHGLIIHUHQW ³WUHDWPHQWV´RIWKHSDUWV,QWKLVVHQVHWKHVSDFHZKLFKKDVDUHODWLRQRQWKHQRUWKWRWKH0XVHXPFRXOGEHDQRSHQWKHDWUHGH¿QHGE\LWV VFHQLFEDFNJURXQGRQWKHFRQWUDU\WKHVDXWKHUQVSDFHLVWKHFLYLFVTXDUHRIWKH0XQLFLSDOLW\ZKLOHEHWZHHQWKHVHWZRWKH0RVTXHJLYHV WKHRULHQWDWLRQRIWKHFHQWUDOVSDFHWRZKLFKDOVRWKHSODQWLQJDQGWKHFHQWUDOZULQNOHVRIZDWHUFRQIRUPWKHPVHOYHVWRGH¿QHWKHFKDUDFWHUV of a Islamic tradition garden. To underline these topological relationships with the representatives buildings and their placements there are then some erratic objects (front scene, little tower of the stairs, springs, columns) which furnish the square in its inner part. 84 3.3 Cult|d|urres Arch. Nadir Bonaccorso 7KH¿UVWLPSDFW VRPHWLPHVWKHGHQVHVWEHFDXVHLWLVLQQRFHQW DWDELJJHUVFDOHLVWKHZD\KRZWKHLOLULDVTXDUH polarises all the urban tissue and circulation scheme. Like a body |almost an organic form| with arms that embrace the whole city. Its position, its geometry, all a result of centuries of development (urban, political, social and cultural) show the importance that the site encloses potentially as a representative place. That clear image, loses strength in a closer analysis. The square hibernates and at this time seems not to be responding to all the new challenges our new century is proposing. Re­thinking about what is a square today, how has changed its representative image LVRQHRIWKH¿UVWVWHSVZHWULHGWRIROORZ,IWKHRUHWLFDOO\PRVWRIWKHNQRZQDQFLHQWVTXDUHVDUHFOHDUO\GH¿QHGE\ WKHVXUURXQGLQJFRQVWUXFWLRQ DVDFRQWUROOHGQHJDWLYHLQDEXLOWVSDFH ,OLULD¶VVTXDUHLVPRVWO\GH¿QHGWRGD\E\D circulation structure and by 5 nonalined buildings (4 public and 1 private). In the west side, the border in which we found the mosque and the prefecture building is clearly cut, limiting and separating the hill from the more horizontal SODQ1HYHUWKHOHVVDVTXDUHGH¿QHGSXQFWXDOO\E\EXLOGLQJVORFDWHGLQVWUDWHJLFDOSRVLWLRQVLIDVVXPHGDQGZRUNHG out, can turn its apparent fragility into an intense and strong urban relation. Assuming that all the history of the place LVJHQHUDOO\NQRZQLWLVLPSRUWDQWWRUHIHUWKHHIIRUW HYHQLIUHÀHFWLQJDFODVVLFDOZD\RIVROYLQJDSXEOLFVSDFH RIWKH PDVWHUSODQGDWHGRI¿QGLQJRQHORJLFDOVROXWLRQWRJLYHWRWKLVDUHDDUHSUHVHQWDWLYHVTXDUH7KHSURMHFWZDVQRW EXLOWOHDYLQJVRPHWUDFHVLQWKHDFWXDOFRQ¿JXUDWLRQ BASES The prior informations used as base for the project were: WKHQHZURXWHLQVLGHWKHVTXDUH WKHSUHVHUYDWLRQRIWKHIRXQWDLQ WKHUHVSHFWIRUDQ\HYHQWXDODUFKDHRORJLFDOVLWHEHQHDWKWKHVLWH WKHQHFHVVLW\RIDQQHZHFRORJLFDOVWUDWHJ\ ­ polarise all the different historical buildings under a “hinge”. 2%-(&7,9(6 The presented study focuses, trying answering at the same time, the objectives/desires: GH¿QLQJDQGHTXLOLEUDWLQJWKHVTXDUH VHZLQJWKHXUEDQWLVVXH RUJDQLVLQJWKHÀRZV GHYROYLQJSULRULW\WRSHGHVWULDQV ­ to question and following principal turning the square as a symbol of the city PROJECT 'H¿QLQJWKHVTXDUH 7KHVWUDWHJ\ZHIROORZHGIRUWKHGH¿QLWLRQRIWKHVTXDUHVWDUWVIURPWKHLGHDWROHWWKHSXEOLFEXLOGLQJVIDFLQJWKHVTXD­ re participate to all its future activities in an effort to concentrate on the square the relations between them. 7KH¿UVWVWHSZDVWRFRPSHQVDWHWKHHTXLOLEULXPDQGGH¿QLWLRQRIWKHVTXDUHSURSRVLQJDQHZEXLOGLQJLQWKHQRUWK HDVWVLGHDYRLGLQJDFOHDUORVVRIWHQVLRQLQWKLVDUHD7KHEXLOGLQJSURSRVHGFRXOGEHVXFKDVDQ(FR+RWHOUDLVLQJ achieving the status of a contemporary land mark. ­ The square The second step follows our desire and organizes the new square linking each one of the public buildings (all of them have access at different levels) allowing an equal pedestrian/human relation with the square. In a certain way we could say that re­interpreting the “form” of the existing square (body and arms) we create a new level (in superimposi­ WLRQ 7KLVJHQHUDWHVOHYHOVRIXVHWUDQVSRUWDWLRQDWWKHROGOHYHO SDUWLDOO\ DQGSHGHVWULDQDWWKH¿UVWOHYHO7KHVX­ SHULPSRVLWLRQFRQFHSWLVUHODWHGWRWKHDUFKDHRORJLFDOWKHRU\RIOD\HUVLQVWHDGRIWU\LQJWRH[FDYDWHWRVROYHWKHÀRZV needs we add a new layer avoiding works on the ground as it is possible. The new square starts from the end of the PDLQFRPPHUFHVWUHHW LQSURMHFWZLWKOLPLWHGWUDI¿F FRPLQJIURPWKH+DUERXUDUHDLQWURGXFLQJWKHVTXDUHWKURXJKD new pavement ( a white rock pavement) that in front of the Chamber creates with its own movement a little represen­ WDWLYHVTXDUHIRURI¿FLDORUVPDOOSXEOLFXVH7KHZKLWHURFNPDVVFRQWLQXHVLWVDSSURSULDWLRQRIWKHODQGLQFOLQLQJLWVHOI In this vertical movement it links through extension of this mass (almost like if it had been extended) to the mosque without touching it and to the prefecture reaching it with ramps until the entrance area. The links to the other two public buildings (the cultural centre and the new Eco­hotel) follow the same rule but instead of generating a continuity ZLWKWKHJURXQGLWE\SDVVHVWKHQHZPDLQURDG7KLVV\VWHPHQVXUHVFRQWLQXLW\IRUHDFKRQHRIWKHÀRZVDOORZLQJD privileged relation with the square. The west (and green) side is now free from the road imposition and slides until the QHZOLPLWLQFUHDVLQJWKHJUHHQDQGSHUPHDEOHVRLODQG¿QGLQJDFRQWLQXLW\LQWKHUHODWLRQZLWKWKHVTXDUH7KLVZLOO 85 generate a corridor and will optimize the green area. In the east side the connections planned are small ramps alined with the severe front, allowing the passage but maintaining the separation between road and square. The square, on its surface is pointed by a patio desig­ ned by the direction of the entrance of the mosque and the actual location of the existing fountain. It has been imagined as a quiet patio excavated in the square mass, a space of relax that could eventually permit different utilization of the whole surface that possibly organize. It is important to underline that all the paths linking to the buildings search for a special point of view, pointing on framings of the involving space. 7KHZKROHVTXDUHLVDOLYLQJVSDFHEDVLFDOO\HPSW\WKRXJKWIRUWKHKXPDQÀRZVDQGUHDG\WRZHOFRPHZHHNO\RUGDLO\PDUNHWVFRQFHUWV and ephemeral events of any kind. In the layer below the square, where the height permits (almost half of the square area) the mass can be excavated to incorporate public lavatories, spaces of public use and in the northern side a covered parking, just in front of the Cultural Centre. ­ Living spaces 7KHOD\HURIWKHVTXDUHLQLWVPDWHULDOLW\SHUPLWVDJUHDWGHDORIÀH[LELOLW\7KHURFNPDVVZLOODOORZWREXLOGZLWKWKHVDPHPDWHULDODOOWKH urban furniture needed in a public place. It will also allow to include functional spaces like bar and esplanade leaving always open the possibility of bigger events. ­ The streets surrounding The white rock will spread all around, marking routes, organizing the urban furniture with the purpose of intensifying the density the mate­ rial when we approach to the centre. ­ Sustainability (QHUJ\HI¿FLHQF\DVSHFWVDUHLQWKLVSKDVHVXPPDULHV0HDQZKLOHWKHUHXVHRIUDLQLQJZDWHUIRUWKHSXEOLFODYDWRULHV ZF DQGWKHSRVVL­ bility of using solar energy (photovoltaic) for the lightning of the square even if not located are considered as fundamental for this project. $GD\LQ'XUUHV Travelling the Mediterranean countries in a hot summer we decide to take a boat from Bari (south east coast of Italy) in direction to Albania. 7KHWULSZDVGXULQJWKHQLJKWZLWKVRPHELJERDWWUDQVSRUWLQJRXUFDU:KHQZHZDNHXSWKHERDWZDVDOUHDG\FORVHWRWKH'XUUHV+DUERXU Without knowing very well the history of the city we start our trip to Tirana, the capital town... passing trough the centre something called RXUDWWHQWLRQDVWRQHZDOOULVLQJSUREDEO\GH¿QLQJVRPHWKLQJPD\EHDVTXDUH6RZHVWRSSHG:HSDUNHGEHQHDWKWKHVWRQHVSDFHDQG we ascend the stairs... it was market day, from the square we could see all the spaces around: the commerce street street , the mosque, the tower of the old cast­ le, and on the other side a building we had seen from the boat, a hotel that seems to enclose the square. The passages from one building to another were opening frames of views. We spend a few hours buying stuff in the market, we came down and we start the historical walk... the Byzantine wall, the Roman amphitheatre and so on... we had a wonderful lunch, and then we decide to take a room in the hotel. On our way we saw that the cultural centre was showing an exhibition of Cristina Iglesias. In the afternoon we were in the room, looking to the see through a window that we understood later was a photovoltaic frame. the dinner was in the roof of the hotel with a view to the city, a storm from the sea was announcing, well, the rest is not to be written, nine months later I became a father. 86 3.4 Piazza della Liberazione 015 $UFK6DUD'DQLHOD5RGULJXH]1DYDUUR ,1752'8&7,21 'XUUHVLVDVROHPQFLW\ULFKRIKLVWRU\DQGJORU\7KHKHULWDJHRIGLYHUVHJRYHUQDQFHIRUPVKDVJURZQDFLW\EULPRI hoard of different cultures. The important history occurred, has left in the city ineffaceable trace of its old splendor. A city which has defeated its enemies, defended and conquered its sovereignty, risen and preserved to continuous LQYDVLRQ<HWKDVHYHQUHVLVWHGDQGRYHUFRPHWKHQDWXUDOGHIDQFHGHYDVWDWLRQVRIVHYHUDOHDUWKTXDNHV'XUUHVKDV expanded and developed like an industrial, cultural and educational center. The city requires a monumental Plaza to ennoble its heritage, a extensive plaza symbolical to the citizens. The public Plaza constitutes the traditional civic, so­ cial and recreational center of the community, a necessary space to understand the own city. To the visitor the public plaza and its surrounding area represents an indication thermometer of the urban health. A representative urban spa­ ce vast with valuable social meaning. There is no urban development unattached to symbolic elements that concede identity to the cites. The place where the individual subject dissolves, acquires conscience of their collectively and of WKHLUIHOORZFLWL]HQVDQGE\UHÀHFWLRQRIWKHPVHOYHVDOOWKHLQGLYLGXDOVDUHHTXDORQWKHSOD]DRQWKLVSODFHWKH\EDSWL­ ze themselves citizens of a nation, with the same rights and obligations, and the same constraint of belongings to the state. The encounter space where all the people converge, it is a place to meet, to linger, is an origin or a destiny, like UHFHSWDFOHDFTXLUHVLWVXWLOLW\RILWVHPSW\VWDWHE\LWVSRWHQWLDOLW\RIEHLQJ¿OOHGDQGWRORGJHDFWLYLW\7KHVHVSDFHV are capital for the development of the human being like social individual. The intangible generates experiences in ZKLFKOLYHWKHVSDFHVDVVLJQL¿FDQWDVWKHWDQJLEOH7KH3OD]DUHVHPEOHWKHVRFLDOLQWHJUDWLRQFRQYHUJHSK\VLFV intellectual and emotionally individuals and characteristics in a neutral space, in where those causes which divide them are excluded. The Plaza provide the city a open area, a breath, and allow their habitants with a site to satisfy their playful, social, ritual, and even spirituals pursuit. Is a process to live the city, not only in the physical form, but as a experience. 352326$/2%-(&7,9(6 The city requires to revitalize its urban centers, an integrated plan which recovers urban quality spaces for the citizens is implemented. As a part of this revitalization plan, the plaza of Iliria represents a point of exceptional importance, its accurate location in the city, surround by institutional and cultural buildings, and also some important archeological remnants, has a social, cultural and administrative role, a cardinal area. The purpose of this project in the Plaza Iliria LVWRHQQREOHWKHKHULWDJHDQGEHFRPHDLGHQWLW\V\PERORI'XUUHV7KH3OD]DZLOOHPERG\DXUEDQQRGHRIYLWDOLW\WKH KHDUWWKHGHSDUWXUHSRLQWDQGQHXUDOJLFFHQWHURIWKHFLW\DQGZLOODVVLVWWKHGHYHORSPHQWDQGFRQVHUYDWLRQRI'XUUHV DVPDMRUFLW\$VFHQHU\IRUFROOHFWLYHDFWLYLWLHVRIGLIIHUHQWQDWXUHDVSROLWLFDODQGDUWLVWLFZDLWLQJIRUWKHJODQFHVDQG silence of which pass by, and certain days of the year will pigment of the color of the multitude that occupies it and surround it. A mirror of the city. Integrated to the immediate context, and being part of the daily life experience of the citizen, who pass through and remaining in their reminiscence deliver with elements that distinguish and enhance. $FURVVWLPHWKHSOD]DZLOOEHFRPHDUHODWRURIWKHQHZKLVWRU\RI'XUUHVKLVWRU\WKDWZLOOSHUVLVWLQWKHPHPRU\RI its materials, as a witness of the citizens everyday life and of the own city undergoing changes and sensible to the nature which it is transforming. Gather with poetic and monumental language the plaza is transformed into a image of contemporary architecture, dissolve and include as a part of the city. This visual gaze tries to modify aspects of urban interaction and gestate superior appearance, the iteration of the plaza is not only an architectonic reiteration but also the deliberate repetition of a open interplay between the dominant surrounding buildings. This proposal present a FRPSOHWHFRQWHPSRUDU\YLVLRQRIWKHSOD]DZKLFKSUHVHUYHDVLJQL¿FDQWSLQQDFOHWKHROGFHQWHUIRXQWDLQDQGFRQWHP­ plates green areas and trees location for environmental purpose, and regarding consideration to the pedestrians user. To these generating spaces, main monumental buildings of the city stuck their face. These surrounding buildings will FRPHWROLIHLQWHUUHODWLQJDQGIRUPLQJDVWURQJO\KLHUDUFKLFDOFLUFXODWLRQSDWWHUQWKHSOD]DZLOOEHFRPHDQDSSUHFLDWLRQ spot to observe what concurs around, a tribune with enough distance to appreciate the four lateral sides, the monu­ mental facades which delimit and give the space the character of plaza, will be also upraise to a superior level. PROJECT CONCEPT 7KHREMHFWLYHIRU'XUUHVFLW\LVJDLQHGDQDSSHDUDQFHHVSHFLDOO\QHDUWKHSRUWHPEHOOLVKWKHFHQWHURIWKHFLW\7KH aspiration is to preserve and reinforce the use of the public space as a common and well know point for collective events of several orders, political or artistic demonstrations. It consider the current urbanistic function of the plaza and its surroundings, public and private mobility as car parks, and particularly to the pedestrian users, public transport and cycle routes. Intentional to achieve greater proportions, the project integrates the three fractionate actual components of the space, subdivide by small streets, the small souther portion, the main square, and the square append to the side street, this last fraction is separated of the sidewall an gives place to a street which connect with one major viability of the city, the intention is to remark the plaza as a unit, as a entire unattached aspect, and also gives more LPSRUWDQFHWRWKHSHGHVWULDQXVHURYHUWKHURDGWUDI¿F7KHLQWHJUDWLRQRIWKHWKUHHIUDFWLRQVHQJHQGHUDQH[WHQVLYH square dimension with monumental aspirations. Another important aspect is to create a dialogue between the plaza 88 DQGWKHVXUURXQGLQJEXLOGLQJVWKHUHLVWKHEHOLHILQFRUUHVSRQGHQFHEHWZHHQWKHVSDWLDOTXDOLWLHVRISOD]DDQGWKHVXUURXQGGH¿QHGWKURX­ gh conexion components, two principal marked accentuated paths inside the plaza extend to reach the side walks, and allow the users arrive, the multiplicity arising from the forms of these relationships between the areas permits an immediate variety of access and move­ ment. Particularly accenting the connection towards the plaza and the Palace of Culture with each other, the street asphalt is interrupted DUULYLQJWRWKHSOD]DE\DQHOHYDWLRQLQWKHOHYHODURZRIEROODUGVGH¿QHVWKHPD[LPXPLQYDVLRQVSDFHRIWKHDXWRPRYLOHXQGHUVWRRGDV DGLPHQVLRQDOH[WHQVLRQRIWKHSOD]DDOORZLQJWKHURDGWUDI¿FDFKDQJHRIPDUFKLQWKHFLUFXODWLRQDQGHQFRXUDJHWKHSHGHVWULDQPDUFK Everybody is invited to use the paths to reach their destinations. PROJECT CONCEPT 'XUUHVLVLGHQWL¿HGDVWKHPDLQSRUWRI$OEDQLDDQLPSRUWDQWWLHSRLQWFRQQHFWLQJWRZHVWHUQ(XURSHVLQFHLWRYHUORRNDWRQHRIWKHFORVHVW points of the Adriatic Sea, and having special proximity with peninsula of Italy. The importance UHFOLQHLQLWVJHRJUDSKLFSRVLWLRQ'XUUHVOLHVRQDVPDOOSHQLQVXODRQWKHFRDVWRIWKH$GULDWLFVHDQDWXUDOKDUERUIXQGDPHQWDODVSHFWLQ WKHJURZWKRI'XUUHV7KHZDWHULVDIRXQGDWLRQDOHOHPHQWUHSUHVHQWLQJWKHVHDSRUWWKLVLVWKHPRWLYHRIWKHDPSOHSUHVHQFHRIWKHZDWHU as a component in the plaza. The water surface evokes the sea, it sound, the imaginary ambulant ramble to the sea. A placement of three IRXQWDLQVLQGLYHUVHIRFDOSRLQWVRIWKHSOD]DFRKHUHGE\DZDWHUSDWKZKLFKXQL¿HVDQGJLYHVWKHPVROLGLW\WKH¿UVWLQWKHVRXWKFRPSOH­ WHVDV\PEROLFWULORJ\RIWLPHUHSUHVHQWVWKHSDVWWKHVHFRQGLQWKHFHQWHUUHSODFHVWKHUHPHPEUDQFHRIWKHDFWXDOIRXQWDLQUHSUHVHQWV the present has an immediate connection with the Mosque building located in front, and the third in the north, represents the future, embellish a monument elevated in a strategically prime point, with the conception to be the culmination of the projected view from the two main streets that frame the plaza. The vertical monument located in the north of the plaza has the intention to be an element that can be observe from the depth of the two mayor streets which point out the plaza, relate and serve as access and so become an approach signal. 'LVWLQJXLVKLQJWKH6RXWKSDUWRIWKHSOD]DDVDLQYLWLQJFRQWHPSODWLRQDQGKDELWDEOHDUHDVHUYHZLWKEHQFKHVZKLFKDOORZWKHYLVLWRUWRWDNH DWLPHWRUHJDUGWKHÀRZLQJZDWHUIRXQWDLQVDVSDFHWRUHPDLQVXUURXQGHGE\JUHHQDUHDVZKHUHGLYHUVHDFWLYLWLHVFDQEHGHYHORSHGD VHDWHGPDQUHDGLQJDFRXSOHWDONLQJWZRIULHQGV¿QGHDFKRWKHUFKLOGUHQUXQQLQJDQGVSDWWHUDURXQGWKHIRXQWDLQV7KHHDVWSDUWVHUYHV as esplanade, an elongate clean space and dispose to be participate in the elections of visitors use, a space to pass across, or to be part of a multitude congregation. One last area is notable in the northeast part, a tree lined ramble, a graticule of trees in equitable distance, DVKDGHGDUHDZLWKDQLQWLPDWHIHHOJLYHVVSDUHSULYDF\WRWKHYLVLWRUDFFRPPRGDWHDFDOPFRPIRUWDEOHDWPRVSKHUH'LVSHUVHGOLJKWVZLOO LOOXPLQDWHWKHSOD]DDWQLJKWZLWKLQWKHZDWHUZLOOUHÀHFWHGDQGUHPDUNHGWKHSULQFLSDOZDWHUD[LVDQGWKH]HQLWKPRQXPHQWDOLQHRILOOX­ PLQDWHGEROODUGVZLOOVKRZWKHZD\WRWKHURDGWUDI¿F7KHLGHDEHKLQGLVWRRSHQXSDÀH[LEOHXVDJHRIHDFKDUHDDQGWRIRUPDWWKHVDPH time a strong identity within the space by the elements and material, which express solidity and time light movement towards the pavement and paths. People can freely select their own experience it becomes a place where children, adults and the elderly can approach a new LQWHUDFWLYHYLWDOLW\ZLWKLQWKHFLW\RI'XUUHV 3.5 MST 08 Eng. Lluka llukani, Arch. Luca Giannini, $UFK9HUHQD(ZHUHW$UFK$OHVVDQGUR,QWHUODQGR 0(025<2)+,6725,&$/6,*16 The site, object of the design competition “Iliria Square Project”, and the adjacent areas are rich of important historical elements that make us assume the relevant events of the past. Unfortunately the development and transformation of WKH'XUUHVLQWKHODVWFHQWXU\GLGQRWDOZD\VSXWDSDUWLFXODUO\DWWHQWLRQWRWKHLQWHJUDWLRQRIWKHLPSRUWDQWSUHH[LVWLQJ urban elements. Some of the traces of the past are still visible but they are not emphasised like the Roman forum, the 5RPDQWKHDWUHDQGWKH9HQHWLDQZDOOVZKLOHVRPHRWKHUVLJQVQRZDUHFRPSOHWHO\KLGGHQDQGIRUJRWWHQE\WKHFRO­ lective memory, like the original morphology of this place. The intent of the project is on the one hand to revaluate the existing historical signs and on the other hand to bring back to the surface the invisible traces to assure to conserve WKHLUPHPRU\,W¶VDSRVVLELOLW\IRU'XUUHVWRUHFRYHUDSDUWRILWVKLVWRULFDOLGHQWLW\7KHPRGDOLW\WRUHDOLVHWKHLQWHQWRI the project is to do a virtual archaeological excavation and to transport it to the skin of the square by the design of the SDYLQJDQGWKHRXWGRRU¿WWLQJV7KHKLVWRULFDOUHVHDUFKRIWKHSUHH[LVWLQJXUEDQWH[WXUHJLYHVXVLQIRUPDWLRQDERXWD very interesting alignment, an old street axes, between vanished building lots in direction to the now un­existing main JDWHRIWKH9HQHWLDQZDOOEHOW7KHFRLQFLGHQFHZHIRXQGLVWKDWH[WHQGLQJWKLVVLJQZHFDQ¿UVWWRXFKWKHFRUQHURIWKH UHVWRIWKH9HQHWLDQZDOOVDQGWKHQZHUHDFKWKH5RPDQWKHDWUH7KHVHWUDFHVEHFRPHYLVLEOHRQWKHVXUIDFHRIWKH VTXDUHWKHD[HVLVLQWURGXFHGOLNH³ZDWHUSDWK´DQGWKHPDLQJDWHDQGWKHEXLOGLQJORWVZLOOEHOHJLEOHE\DVWURQJVLJQ in the pavement. In this way the project will accentuate the importance of this square from the past signing its HQWUDQFHDQGLQWKHVDPHWLPHLQWHQWVDOVRWRUHYDOXDWHWKHVWLOOH[LVWLQJHOHPHQWRIWKH9HQHWLDQZDOOVQHDUWKH mosque giving them a new visibility. The proposal for the paving is to use local stone with different sizes and textures. Inserts of some other materials like iron or wood could enforce the design of the historical traces. 9HUWLFDOVTXDUHHOHPHQWVOLNHWUHHVVHDWEHQFKHVDQGXUEDQOLJKWHQLQJZLOOHQIRUFHWKHKRUL]RQWDOVLJQV 7+(648$5(())(&7 Iliria Square is a wide open space surrounded by buildings containing the most important public, cultural and religious IXQFWLRQVZKLFKFRQIHUVWRLWWKHDWWULEXWHRIPDLQVTXDUHRI'XUUHV7KHDVSHFWWKDWLVPLVVLQJWRWKLVSODFHLVWKDWZH don’t have the “effect” of a square because the existing urban texture, remaining discontinuous and non­proportional, doesn’t gives an exact limit of the extension of space. The buildings are “singular events” without relation to the other existing volumes and they result completely disconnected to the square. They are situated on different levels, with different vertical e horizontal extension so that the facades looking to the square don’t close the scenery. The project ZDQWVWRGH¿QHWKHVSDFHRIWKHVTXDUHDQGRQRQHWLPHSXWLQHYLGHQFHDOOWKHEXLOGLQJVFRQWDLQLQJLPSRUWDQWIXQ­ ctions and hide on the same time the other buildings. The intent of the proposal is to introduce two vertical continuous HOHPHQWVWKDWSHUPLWVWRGH¿QHDQHZKRUL]RQWDOOLPLWOLQHRIVSDFHWKDWUHFUHDWHWKH³VTXDUHHIIHFW´7KLVWZR “scenery elements” will be interrupted where the project wants to give visibility to the important buildings and will be more compact where the project wants to hide other nonproportional urban elements. The design of this elements could be a steel structure with metal grids for climbing plants. More over wants to be a volume containing pedestrian paths on more levels connected by stairs that in some points will enlarge to platforms. These terraces permit to privileged look over the square, to the city and to the sea. The choice of a “green scenery” permits to obtain the effect of a soft limit line that remains see­through with a coloured and vibrating skin changing through the seasons. Anyway to obtain the “square effect” the design of these elements can be developed in many different ways and materials. 3('(675,$1$1'75$)),&6<67(0 The project strategy to resolve the problem of the vehicular occupation of the square is the following one: liberate the ELJJHVWSDUWRIWKHVTXDUHIURPWKHYHKLFXODUWUDI¿FDQGSDUNLQJORWVSURSRVLQJDQHZDFFHVVWRWKHVLWHZLWKDQHZ parking system. The automobiles are not banned to this place, they are only redirect and reorganised in a different way without compromising the private and comfortable transportation by car which is very a important aspect for the PRGHUQ$OEDQLDQVRFLHW\7KHLQWHQWRIWKHSURMHFWLVWRGH¿QHGLIIHUHQWDUHDVWRDOORZSHGHVWULDQÀRZVDQGYHKLFXODU ÀRZVFRQWHPSRUDQHRXVO\ZLWKRXWRYHUODSSLQJ7KHPDLQHOHPHQWRIWKHQHZWUDI¿FV\VWHPLVDELJURXQGDERXWZLWK DIRXQWDLQLQIURQWRIWKH&XOWXUDO&HQWUHLQD[LVWRWKH6KHWLWRUH'\UUDK6WUHHWWKDWZLOOPHOLRUDWHDQGVLPSOLI\WKH WUDI¿FDFFHVVWRWKHVTXDUH:KDWUHJDUGVWKHSDUNLQJV\VWHPWKHSURMHFWZDQWVWRLQWURGXFHDPXOWLOHYHOPHFKDQLFDO parking to the empty lot in the east side of the square, increasing the parking capability with more than circa 150 parking lots. Other circa 20 traditional parking lots will remain at the level of the square paving, external to the “green scenery”. The permeability of the steel structure on the ground allows the direct pedestrian access to the square from WKLVSDUNLQJORWV7KHQHZVXUIDFHGH¿QHGE\WKHVWRQHSDYLQJLVFRPSOHWHO\GHGLFDWHGWRSHGHVWULDQV,WUHFRYHUV the old function of a square, allowing people to meet and assemble. The project do not introduce vertical elements in the middle of the square to guarantee the organisation of all kind of events, concerts, projections, happenings and PDUNHWVZLWKRXWLQWHUIHUHWRWKHWUDI¿FV\VWHP 91 6<17+(6,6/(66,6025(21/<7+5(((/(0(176)255(48$/,)<,1*,/,5,$648$5(7:2&255,'256$1'$³&$6.(7´ The Corridors are empty frameworks, with evergreen or seasonal climber plants potted into hanging vases that will cover the sidelines of the element. Inside the frameworks will be realize multilevel pedestrian paths made of stairs and ramps. Pylon structures and side grids will be made of galvanized iron and the same material will be employed for stairs and ramps. It this way the project gives a sense of transparency and lightness that should be only denied in case of full covering of the grids by climber plants. The North­West corridor might be 84 meters long, 4,00 meter wide and approximately 12 meters high. It will be strongly discontinuous at the different levels to allow SDVVLQJWKURXJKDWWKHJURXQGÀRRUDSHUPHDEOHHOHPHQWWKDWZLOORIIHUSHUVSHFWLYHVLJKWDERYHWKHPRVTXHDQGWKHSUHIHFWXUH6RPH important dilatation in the path will offer space for small events, like music sessions, expositions, etc. The South­East corridor might be 126 meters long, wide and high as the North­West corridor. This element will be more continuous than the other one, to ensure the square shading during the warmest hours of the day, and also to minimize the sensation of the impressiveness of the building placed on the right side of the Municipality building. The longer extension permits to connect better this corridor to the “casket”. It will be used like pedestrian HQWUDQFHH[LWWRWKHSDUNLQJWRZHUDQGDOVRIRUWKHDFFHVVWRWKHSDQRUDPLFHOHYDWRUWKDWZLOOFRQVHQWWRUHDFKWKHDWWLFÀRRU7KLVFRUULGRU ZLOOEHFURVVHGE\WKHVWUHHWWKDWJRHVWRWKHVHDSRUWDQGZLOOVHSDUDWHWKHSDUNLQJORWVDWWKHJURXQGÀRRU7KH³FDVNHW´ 6FULJQR LVD PHFKDQLFDOSDUNLQJWRZHU7KHYHKLFXODUHQWUDQFHH[LWLVSODFHGDWWKHVWUHHWÀRRUZLWKDZDLWLQJDUHDSURSRUWLRQHGWRWKHDYHUDJHZDLWLQJ WLPHWKDWFRQVHQWWKHRSHUDWLRQRIFDUORDGLQJXQORDGLQJIURPWKHUHIHUUHGURRP7KHVFKHGXOHGWZHOYHRYHUJURXQGÀRRUZLOOVHWWKHQHZ EXLOGLQJDERXWPHWHUVKLJK$ERYHWKHSDUNLQJÀRRUVLWVKRXOGEHSODFHGRQHRUWZRDWWLFÀRRUVVHUYHGE\DSDQRUDPLFHOHYDWRUDQG¿UH escapes. PEDESTRIAN AND TRAFFIC SYSTEM REVITALIZATION FREEDOM SQUARE INTERNATIONAL COMPETITION IN DURRES 3 “SCRIGNO” THE SQUARE IS FOR PEDESTRIANS ONLY AND NOT FOR CARS! MECHANICAL PARKING TOWER 150 -180 PARKING LOTS THE PROJECT DOESN’T WANTS TO NEGATE THE VALUES OF CONTEMPORARY, BUT WANTS TO INDICATE A MORE PROPER HIERARCHY. THE VEHICULAR TRAFFIC WILL BE CONCENTRATED IN THE NORTH-WEST BORDER AND THE PARKING WILL BE ASSURED BY A MECHANICAL PARKING TOWER WITH 12 FLOORS AND CIRCA 180 PARKING LOTS. THIS VOLUME, NOMINATED BY THE PROJECT “SCRIGNO” (CASKET), WILL BE CONNECTED TO ONE OF THE TWO “GREEN VOLUMES” AND WILL BE COMPLETED IN THE TOP WITH ONE OR TWO FLOORS DESTINED TO CONTAIN RESTAURANTS AND EXHIBITION ROOMS WITH A FANTASTIC PANORAMIC VIEW TO ILIRIA SQUARE, OVER THE CITY UNTIL THE SEA. CORRIDOR 2 CORRIDOR 1 20 P ARK ING LOTS MST 08 3.6 New fragments $UFK/RUHQ]R1HWWL$UFK*ORULD$9DOHQWH$UFK0DXUL]LR%UDGDVFKLD (QJ/XLJL*XDGDJQROR(QJ$OHVVDQGUR*XDGDQJROR$UFK)UDQFHVFR*LVPRQGL $UFK'RPHQLFR3DVWRUH$UFK$OHVVDQGUD6FDUFHOOL ,1752'8&7,21 ,Q,OLULD6TXDUHLQ'XUUHVVSDFHLVWKHUHVXOWRISDUWLDORUPLVVLQJLQWHUYHQWLRQV7KH³XQ¿QLVKHG´FRQGLWLRQHPHUJLQJ when visiting this place constitutes a warning to the maker architect, but at the same time it may turn out to be an important resource to solve all question linked to its design. Unaccomplished intervention and traces of bygone days or recent past remnants give the square a perceptive dynamism due to the altimetrical articulation of the land rising towards the high built­up area on the western side and sloping down towards the customs house and the port in the south. As a result of all public function carried out along its perimeter, this place plays the role of a civil and religious acropolis. The irregular positioning of building volumes in the town center and the wide space assigned to vehicular WUDI¿FDSSHDVHWKHUKHWRULFRIWKLVJUHDWVTXDUHIRUWKHSROLWLFDOHFRQRPLFDQGFXOWXUDOFLW\JRYHUQPHQW The Iliria square project carried out in 1942 by Leone Carrmignani, an Italian architect, envisaged a rational and paci­ ¿HGSODFHDVDFRQFLOLDWRU\VLJQRIWKHLQKDELWDQWV DVVXPHG JRRGQHVV$UFKLWHFWXUHZDVJLYHQWKHWDVNWRRUGHUWKH space according to the hierarchies and models of the authoritarian town which had spread in Europe and overseas countries in the period between the two wars. As all projects imposing highly demanding (and totalitarian) formal rules, also this project – idea and proposal at the same time – could be only carried out in a fractional and incomplete way. In urban projects based on the combination of geometry and design, the part hardly contains the whole, and their SDUWLDODFFRPSOLVKPHQWLQ'XUUHVDVLQPDQ\RWKHU(XURSHDQFLWLHVGURSVIUDJPHQWVRQWKHODQGZKLFKVRPHWLPHV are extremely beautiful but incapable of producing a town unitary image, thus missing their primary purpose. The KLVWRU\RIWKLVSODFHVXJJHVWVUHVRUWLQJWRDQRSHQDQGÀH[LEOHGHVLJQRIWKHVSDFHDFFRUGLQJWRWKHFKDQJLQJQHHGVRI contemporary towns and individuals supremacy. 9(+,&8/$502%,/,7<$1'52$',1)5$6758&785(6 All city roads coming from or going to the park fork in Iliria Square, Placing underground the west branch of this MXQFWLRQWKHVTXDUHZLOOEHFRPSOHWHO\VHWIUHHIURPYHKLFXODUWUDI¿FDUFKDHRORJLFDO¿QGVFLW\SXEOLFLQVWLWXWLRQDO EXLOGLQJVDQGODUJHUSXEOLFDUHDVZLOOEHMRLQHGWRJHWKHUWKXVIRUPLQJDSHGHVWULDQFRQWLQXXP,QWKHQHZVTXDUHWKH SURPHQDGHWKRXJKWWKHDUFKDHRORJLFDODUHDVDQGWKHPDLQSXEOLFEXLOGLQJVLQ'XUUHVHQFRXQWHUVDWDQJHQWSRLQWZLWK both public and private mechanized road network. Therefore, the square becomes an infrastructural junction and gives the opportunity to change peoples approach to go through the town: from pedestrian to public transport user, from cyclist to car driver. In the east site of the town hall a multistory car park is planned in order to counterbalance the reduced number of car places due to the widening of pedestrian areas. Other ground car parks will be located along the two main roads branching off from the square northwards. 3('(675,$1&21781180$1'38%/,&,16758&7,21 The major target of our project consists in the creation of a wide public and pedestrian area equipped with new facilities as well as with public green areas for all inhabitants. The approximately one kilometre route going from the customs house to the Byzantine forum links the most important commercial road, the archeological areas, the public buildings and the intersection by public transport. The main element of this continuum will be a facility unit in the south – northward direction of the town hall. Besides visually separating the square from the road infrastructures, this facility unit will serve as public bus stop and will enclose a great number of facilities, from retail stores to garden mainte­ nance warehouses, from tourist information points to public sanitary facilities. The photovoltaic covering will supply energy autonomy for all activities. Moreover, the green area design in the centre of the square will take origin from it. Pedestrian ramps will link the square to the public buildings along the west side and will be turned into auditoriums for open – air performances, when required. $5&+$(2/2*,&$/5(01$176$1'&8/785$/352027,21 $UFKDHRORJLFDOSURVSHFWLRQDQGH[FDYDWLRQDFWLYLW\EURXJKWWROLJKWUHPQDQWVRI'XUUHVORQJXUEDQKLVWRU\7KHPRVW outstanding areas are the Roman amphitheatre in the south of Iliria Square and the Byzantine forum in the north. Our project plans them to be linked by the pedestrian area including the so – called Palace of Culture. It will be possible to enter the amphitheatre directly from the square, and from there it will be possible to see the excavation work in progress. In the future, it will be again possible to use the amphitheatre as an arena. The Byzantine forum will be enhanced by an equipped open gallery having the same design as the facility unit in the centre of the square and will enclose informative, educational and technical facilities. The Palace of Culture, standing in the north of the square, will become the centre of all cultural activities of the new urban system of Iliria Square. 94 95 ,17(*5$7('*5((16<67(0$1'3/$&(252*5$3+< ,OLULD6TXDUHLVDOUHDG\HTXLSSHGZLWKXUEDQJUHHQDUHDVPDLQO\RQWKHHGJHVWKURXJKIHHEO\DQGQRWVXI¿FLHQWO\2XUSURSRVDOFRQVLVWVLQ a double green system, which on one hand integrates the exiting system, and on the other inserts in the centre of the square a new type RIHVVHQFHVIXQFWLRQLQJDVXUEDQGHFRUDWLRQDQGKDYLQJDPLWLJDWLQJHIIHFWRQWUDI¿FDQGUDGLDWLRQDVZHOO2ZLQJWRWKHH[WHQWRIWKHDUHDV concerned, the integration of the exiting system will be carried out by means of a random location of both exiting plants and new trees along the western edge of the square and near the archaeological areas. The soil orographic variation wil be enhanced encircling all exiting EXLOGLQJVZLWKFOXVWHUSLQHVDVLQWKHPRVWIDPRXV0HGLWHUUDQHDQDUFKDHRORJLFDOSDUNV$VPRRWKURZRIPHDGRZ¿HOGVHQFORVLQJHTXL­ distant lines of evergreen forest trees will be positioned in the centre of the square at right angles to the facility unit: this will be the green KHDUWRIWKHSURMHFWDLPLQJDWUHGXFLQJDOOGLVWRUWLRQFDXVHGE\YHKLFXODUWUDI¿FDQGPDNLQJDZLGHSDYHGDUHDRIWKHVTXDUHSHUPHDEOH 96 3.7 The missing link 'LSO,QJ$UFK0DWWKLDV%DXHU%'$(QJ)+%MRUQ6RUHQ6LSSHO $UFK)LOLSHGH6RX]D:XOI.UDPHU6WHIDQ%DVVLQJ 7KHUHDVRQIRUUHGHVLJQLQJ,OLULD6TXDUHLVWKHSURPLVHRIKLVQDPH)RUÄ/LEHUW\6TXDUH´LWLVDEDVLFQHHGWRH[SUHVV the cultural heritage and also a welcoming gesture that enhances the adoption of the square by every inhabitant DQGYLVLWRU3UHVHUYLQJROGDQGFUHDWLQJQHZWUDGLWLRQVFRQWLQXHVWKHXUEDQWUDGLWLRQRI'XUUHV7RUHO\RQSUHVHUYLQJ historic tradition alone is against the nature of the city as a place where people pursue their dreams of individual and collective future. Taken for granted this means that a rich history is an obligation for innovation as investment in the IXWXUH7KHFLW\DXWKRULWLHVDQGWKHSHRSOHRI'XUUHVWDNHWKHFUHGLWIRUVXFFHVVIXOO\SXUVXLQJWKLVFRPSHWLWLRQDVD service to their city’s very own urban history and tradition: Change. +RZFDQ,OLULD6TXDUHEHFRPHDQRSHQSXEOLFVSDFHRIDXQLTXHLGHQWLW\ZLWKRXWEXLOGLQJDQREMHFW" +RZFDQ,OLULD6TXDUHEHFRPHWKHSXOVDWLQJKHDUWRIWKHFLW\FRQQHFWLQJDOOWKHDGMDFHQWDWWUDFWLRQVFRPIRUWDEOHDQG safe, without turning it into a commercial amusement park or implementing a major attractor like a modern museum RUVKRSSLQJPDOO" +RZFDQZHFUHDWHDZHOFRPLQJJHVWXUHDQGGHVLJQKXUEDQOLYDELOLW\WKDWHVWDEOLVKHVDQHZUHODWLRQVKLSZLWKWKH XUEDQKLVWRU\DQGFRQWH[WRI,OLULD6TXDUH" Our goal is to build the missing link that reanimates and contributes to the enlivenment of Iliria Square as the heart of a historic and at the same time juvenile city that puts as many people as possible in the center of it’s ambition. A V\PEROLFVSDFHZKHUH'XUUHVQHYHUVWRSV &21&(37$1'&216(48(1&(6 Already during construction Iliria Square will be attractive as an archeological excavation site with bridges as viewing SODWIRUPV:KHQ¿QLVKHGWKHQHZ,OLULD6TXDUHLVDPRGHUQLQWHUSUHWDWLRQRIWKHDPSKLWKHDWUHLQWHJUDWLQJDUFKHROR­ gical monuments and symbolizing the spirit of the city’s future. A square that will naturally program itself with Cafés, markets, concerts etc. because it’s an inviting and clearly laid out composition of spaces, atmospheres, connections and views. No building or roof on the square obstructs the orientation and presence of the surrounding buildings that form the historic urban space. A central square that is like an inner ring and an additional layer to the urban IDEULFDOORZVIRUWKHLQWHJUDWLRQRIWKHKLVWRULF¿QGLQJVGXULQJWKHH[FDYDWLRQRIWKHVTXDUH7KHVTXDUHLVVKDSHG DQGIXQFWLRQVOLNHDPRGHUQDPSKLWKHDWUHZKHUHDOOSHRSOHRI'XUUHVSHUIRUPWKHXUEDQOLIHHYHU\GD\DQGQLJKW7KH VTXDUHZLOOEHDQLFRQLFSODFHWRVHHDQGWREHVHHQ:LWKEULGJHVOLNHERXOHYDUGVIRUWKHXUEDQÀDQHXUJUHHQVSDFHV SODWIRUPVVWDLUVDQGUDPSVDOWRJHWKHUDG\QDPLFQHZSURWRW\SHRI'XUEDQODQGVFDSHLVGHYHORSLQJWKDWEULQJVWRJH­ WKHUWKHEHVWTXDOLWLHVDQGWDOHQWVRIWKHPRVWVXFFHVVIXOVTXDUHVLQWKHZRUOG6SDQLVKVWDLUV6LHQDVSDFH9HURQD atmosphere altogether will compose the unique and very special character of Iliria Square – an invitation free for all. Crosslinking Iliria Square with the adjacent hills, neighborhoods, quarters, green spaces and attractions by means of extension and connection with vegetation, urban furniture and light as a very special feature without any obstruction of the visibility of the surrounding buildings. )($6,%,/,7< ,QWKH¿UVWSKDVHRIWKHFRPSHWLWLRQZHFRQFHQWUDWHGRQWKHFRQFHSWXDODSSURDFKDQGDSDUDOOHOIHDVLELOLW\VWXG\ LQGLFDWHGWKDWWKHEXGJHWRI0LR(XURVKRXOGEHVXI¿FLHQWWRVWDUWWKHRSHUDWLRQZKLOHWKHSULYDWHVHFWRUZLOOFRQWUL­ bute through by investing in the additional programmatic spaces made available by the design concept. Shops, Café, H[KLELWLRQDQGHYHQWVSDFHSURYLGHDORQJWHUPUH¿QDQFLQJVWUDWHJ\RIWKHUHTXLUHGWRWDOLQYHVWPHQW*LYHQWKHKLVWRULF GLPHQVLRQWKDWWKLVPLOHVWRQHSURMHFWUHSUHVHQWVIRUWKHIXWXUHRI'XUUHVZHEHOLHYHWKDWWKHVXFFHVVDQGDWWUDFWLYLW\ of the whole city will be more than rewarding for the investment in this concept for Iliria Square. In the next phase ORFDOFRQVXOWDQWVDUFKHRORJLFDODGYLVHUWUDI¿FHQJLQHHUODQGVFDSHDQGYHJHWDWLRQH[SHUWVZLOOEHLQYROYHGWRIXUWKHU develop all aspects and put the conceptual design to the level of an integrated research and design study. 97 3.8 A square as bridge between history and the future Arch. Paola Rossi, Arch. Giuseppe Losurdo, $UFK$OIUHGR$PDWL$UFKHRORJLVW$GD)RVFKL (QJ,ODULD*DURIROR$UWLVW$OHVVLR$QFLOODL$UFK'DULR/HPER The concept behind the design is born out of a research method dealing with: the relation with the place, or rather with its present image the relation with history, or rather with the becoming of changes in time the relation with buil­ ding, or rather with the chance for architects to act with and leave a contemporary mark. Art and technique to qualify and recompose what has been lost by transforming what stands today the relation with the city, or rather the connec­ WLRQVDPRQJWKHVLQJOHDUFKLWHFWXUDOERGLHVLQWKHFRPSOH[WRWDOLW\WKH\IRUP7U\LQJWR¿JXUHZKDWWKLVXUEDQFRQJOR­ PHUDWLRQLVDQGZKDWLWVSRVVLEOHIXWXUHLPDJHPD\EH%(&$86(WRFRQFHLYHDQGGLVFRYHUWKHWRZQRI'XUD]]RLVWR have the certainty­hope of the beauty that the underground may reveal, the present scarcity of value in the expanse of the Square humiliates its millenary history and it is possibile to modify space, to occupy it and even to transform LWZLWKRXWGHVWUR\LQJ/,.(VFKRODUVGLVFRYHULQJIRUJRWWHQVWRULHVDQGVFXOSWRUVWUDQVIRUPLJPDWWHUDVVHPEO\LQJWKH surface of the Square by different parts, which may be done in different steps, to form a single space linking preexi­ stences, perspectives, itineraries and buildings. :+$7" $VTXDUHHQWLUHO\UHVHUYHGIRUSHGHVWULDQVJHQWO\DVFHQGLQJZKLOHFOLQJLQJWRWKHEDVHRIWKHHGL¿FHFRQWDLQLQJWKH city’s government activities. A hill descending and spreading in the pedestrian area. Archeology as historical reality but DOVRUHFUHDWHGDUW$³SDOD¿WWH´DVEULGJHWRZDUGWKHIXWXUHFDVWLQJLWVIRXQGDWLRQVXSRQKLVWRU\:RPHQDQGPHQZKR can walk, see, play, dance, rest, study…discover the city. )25(:25' 'XUD]]RODQGLQJDQGWUDGLQJSODFHRIWKHSDVWEHWZHHQ(DVWDQG:HVWDSSHDUVWRGD\DVDOLYHO\FLW\IXOORIDFWLYLW\ DQGHDJHUWRLQYHVWLQLWVIXWXUHWRJURZDQGUHQHZLWVHOIXQGHUDOODVSHFWV7KH,OOLULD6TXDUHWHVWL¿HVWKURXJKLWV historical­architectural preexistences overlooking it and through its own structure, the various rules suffered in the course of the centuries, the religious doctrines, the different lifestyles and cultures, all in a melting pot of images and SRSXODWLRQVOLYLQJWRJHWKHU7KHXUEDQUHTXDOL¿FDWLRQRIWKHVTXDUHLVXQGRXEWHGO\WKHXQUHSHDWDEOHFKDQFHWRUHFRP­ pose, in a precise identity, a strategic tie of great relevance for the city. The public use of the architectural spaces and of the prominent historical preexistences surrounding the square will be therefore enhanced, following an approach not restricted to requalifying the single “fraction of the city” but extending to reclaim the urban identity and the spirit of social living. 7+(:25.7($0 Our work team has chosen to take this particular design chance as a spur to face, along with the local political GHWHUPLQDWLRQWKHFKDOOHQJHWRUHWXUQWRWKHFLW\RI'XUD]]RLWVPDQ\VLGHGLPDJHFDSDEOHWRODXQFKDIXWXUHFRXUVH LQLQWHUQDWLRQDOLVDWLRQ)RUWKLVSXUSRVHZHKDYHIRUPHGDZRUNWHDPPDGHRISURIHVVLRQDOVVSHFLDOL]HGLQWKHYDULRXV urban sectors – as requested by the announcement of competition – who have already been able to share working methods and operative systems among them. $5&+$(2/2*< The necessity of a project aiming at making available and increasing the value of “the ascertained archaeological, cul­ tural and architectural legacy” imposes ­ at the outset – a respectful and conservational approach of what is existing. 1HYHUWKHOHVVWKHUHTXHVWFRQWDLQHGLQWKHDQQRXQFHPHQW DUW WRDOVRFRQVLGHUWKHOHJDF\³RIDSRVVLEOH¿QGLQJ´ RQFHWKHVHQVDWLRQRILPSRVVLELOLW\RIDQ\LQQRYDWLYHLGHDQRWULVNLQJWREHGLVWRUWHGE\SRVVLEOHIXWXUH¿QGLQJVZDV overcome, has advised us to design at once “an excavation area” and to make of it an integral part of the design and a base upon which to “found” the development steps of the Square and the city. This concept being present both in the design connotation and in the broad sense of cultural and economic transformations. *5((1$5($6$1'/$1'6&$3( Our proposal intends to create continuity with the surrounding landscape, or rather to bring the hill to a direct and JUDGXDOGLDORJXHZLWKWKHH[SDQVHRIWKH6TXDUH,QWKLVVHQVHWKHKLOOVORZO\RYHUÀRZVLQWRWKHQHZDUHDIROORZLQJD layout of ramps, lawns, wooded areas, vegetable decors composing a “green picture”. The balance of green spaces is in credit: the presence of trees, presently considerable but casual, has been re­arranged in the whole design precinct. (9(176$1'+$33(1,1*6 “ The role of the Square as main public, open, multi­functional city venue” is not only safeguarded but pondered over and freed from the urban road system: from exchange hub to square­system. The Square, divided in parts differing by shape and location, may be also utilized for simultaneous events. That’s why it is important to activate a series of side services with the purpose to make it become a place above all others for daily encounters. 100 ,17(*5$7,1*$1'5(&216,'(5,1*7+(%8,/7(/(0(176 Widening views whenever possible, penetrating with green and pavements means to build a new texture dialoguing with the context. The new pavement will be designed in a pattern acting as basic binder of all the elements composing the greater design area. The buildings located between the parking lot and the tower may possibly be demolished in order to free the new front and rebuild a new volume extending horizontally and dialoguing with the vertical element of the tower building and recomposing the West front of the square itself. 38%/,&$1'35,9$7(02%,/,7< 7KHSURSRVDOLQWKLV¿HOGLQFOXGHGLQWKHQHZ&LW\0DVWHU3ODQLVIRUWKHURDGV\VWHPWRSURJUHVVLYHO\EHFR­ me an exclusive service for the Square, in accordance with the provisions already adopted to pedestrianize the city centre and with the aim to form a pedestrians’ route, without interruptions, from sea to town centre. A system of parking lots, strictly planted with trees, has been planned at the North­East and North–West boundaries of the Square. 6867$,1$%,/,7< Without going into details about environmental and social sustainability criteria, to be dealt with in a subse­ TXHQWGHVLJQSKDVHZHSURSRVHDFRQFHSWERQGLQJDUWWHFKQRORJ\FXOWXUH$QXUEDQ¿WWLQJREMHFWDQHFRORJL­ cal stele as light, urban landmark, solar panel and…work of art. 101 7+('(6,*1&21&(37 To operate on the Illiria square means to work on a square located in a core context of the city where history is narrated through the layers of its events. The amphitheatre, the walls, the Byzantine castle, the forum, up to the most recent buildings such as the Mosque, the City +DOOWKH3DODFHRI&XOWXUHDQGWKH3UHIHFWXUHWHVWLI\GLIIHUHQWDJHVDQGIXUWKHUWRWKHYHU\UHFHQWRI¿FHV7RZHUWRGDWHWKHV\PERORIDFLW\ VWULYLQJWRJURZEXWKDVQRW\HWIRXQGLWVZD\DQGUHVHDUFKWKURXJKZKLFKWRH[SUHVVLWVHOI:KHWKHURQHDSSURDFKHV'XUD]]RE\VHDRU land the Square is jointly an arrival place and a hub of the main civic cultural and administrative activities. Only later are the elements left IURPKLVWRU\GLVFRYHUHGFRKDELWLQJDOPRVWXQGLVWXUEHGLQDGLVRUGHUHGFRQWH[WGHQ\LQJWKHP'HVLJQWKHQDVDQDQVZHUWRWKHQHHGIRU image expressed by a city wishing to change but through a unitarian and coherent transformation. Pondering over Illiria Square and reno­ vating it means proposing a concept and an architectural language being capable to identify contemporaneity, to create a contemporary VLJQL¿FDQWJHVWXUHEXWDOVRWRUHVSHFWKLVWRU\E\HQKDQFLQJWKHSUHH[LVWHQFHVPDUNLQJLWVPLOHVWRQHV7KHULJLGO\UHFWDQJXODUOD\XRWRIWKH 6TXDUHDOWKRXJKDOUHDG\DOWHUHGLQWKHSDVWLVPRGL¿HGLQWKHGHVLJQWKURXJKVKDSHVLQWHUVHFWLQJDQGGH¿QLQJDUHDVYLHZLQJSRLQWVDQG SRVVLEOHURXWHV:KLOHWKHERXQGDULHVWRZDUGVWKHQHZFLW\DUHEHWWHUGH¿QHGWKRVHQH[WWRWKHKLOODQGWKHDQFLHQWWRZQDUHH[SDQGHG )L[HGSRLQWEHLQJWKH0XQLFLSDOLW\6HDWZKLFKVRIWHQVDVLWLVDEVRUEHGE\WKHSODVWLFVNLQRIWKH6TXDUH 0(7+2'2):25. The design work may be planned in subsequent steps. 1. Enhancement of the Square and surrounding areas, by creating the parking lots, green areas and the tratment of the vertical walls of the existing toeìwer building. The hill and the Square melt together. 2. Expansion of the project area through the construction ofthe new volume deriving from the demolition of the East front bodies, betweeb WKHSDUNLQJORWDQGWKHWRZHUEXLOGLQJ7KHEXLOGLQJDFWLQJDVDQHZFXUYHGEDFNGURSRIWKH6TXDUHZLOOEHWKHVL]HRID³SDOD¿WWDYROXPH´ DQGDKRUL]RQWDOOD\RXWGLDORJXLQJZLWKWKHYHUWLFDORQHRIWKHWRZHU$QH[FDYDWLRQZLOOSHUPLWQHZDUFKHRORJLFDO¿QGLQJVWKHDUHDZLOO EHFRPHDQLQWHJUDOSDUWRIWKHH[WHQGHGDQGUHFRPSRVHG6TXDUH7KHSRVVLEOHDEVHQFHRI¿QGLQJVFRXOGEHUHSODFHGE\FRQWHPSRUDU\DUW marks. )ROORZLQJIXUWKHUOD\HULQYHVWLJDWLRQVWKHH[FDYDWLRQFRXOGEHH[WHQGHGEHQHDWK,OOLULD6TXDUHZKLFKFRXOGEHWUDQVIRUPHGLQWRDUHDO archeology and art museum. The Square becomes then the roof of the new museum. 4. The road system of the Square could become entirely reserved for pedestrians and make this new place unitarian and for use by foot only, in order to enhance the original concept of Square as meeting point, of social and communal exchange. ,19(670(17672,1&5($6(7+(9$/8(2)7+(648$5( 7KHWHFKQLFDOHFRQRPLFDQG¿QDQFLDOVXVWDLQDELOLW\RIWKHSURMHFWZLOOEHPDGHSRVVLEOHE\UHFXUULQJWRLPSOHPHQWDWLRQPHWKRGVLQYROYLQJ SULYDWHVWKURXJKSURMHFW¿QDQFLQJIRUPXODV%XLOGLQJWKHQHZYROXPHLQVXEVWLWXWLRQRIWKHHWKHURJHQHRXVSUHH[LVWLQJRQHDVDUHVRXUFHWR ¿QDQFHWKHSURMHFWDLPVWRHQFRXUDJHVXVWDLQDEOHGHYHORSPHQWDQGVWLPXODWHDVHULHVRISDUDOOHODFWLYLWLHVFRPSOHWLQJWKRVHRIWKH6TXDUH Starting from these assumptions, the transformation of the context may be conceived as a mosaic where the input of each new part FRQWULEXWHVWRFRPSOHWLQJWKHGHVLJQFRQFHSW7KHSURJUHVVRIWKHSURMHFWWKURXJKIXQFWLRQDOH[FHUSWVZLOODOORZDQHFRQRPLFDQG¿QDQFLDO planning aimed to the actual results of each operation. 102 3.9 Ilare Iliria Arch. Arturo Cucciolla, Arch. Sante Cutecchia, $UFK)UDQFHVFR)DUHOOD(QJ3DROR%HUORFR $UFKDHORJLVW'RPLDQD6DQWRUR6FXOSWRU9LWR0DLXOODUL ,/3$5&2(/$&,77¬ )RQGDPHQWDOHSHUXQ¶HI¿FDFHULTXDOL¿FD]LRQHXUEDQDqODPLJOLRUHFRQQHVVLRQHDWWXDOPHQWHSUHVHQWHLQPRGR frammentario, tra il Promontorio costiero, con i cospicui resti storico architettonici e la parte centrale della città. Tale connessione potrebbe comprendere un ampio territorio destinato a verde pubblico, in armonia con gli elementi di notevole interesse archeologico e architettonico presenti nella città e renderebbe possibile la realizzazione del Parco GHOOH0XUDLSRWL]]DWRQHO3LDQR8UEDQLVWLFRLQWHJUDWRSHUODFLWWjYHFFKLDGL'XUD]]R,QSLHQDVLQWRQLDFRQWDOH3LDQRLO progetto prevede la rivitalizzazione di tutta l’area comprendente la città vecchia una volta delimitata dalle Mura, piazza ,OLULDLQSDUWLFRODUHHODSDUWHSLDOWDDGRYHVWGHOODFLWWjQXRYDFKHJXDUGDLOPDUHUHDOL]]DQGRFRVuFRPSLXWDPHQWHLO 3DUFRGHOOH0XUD(OHPHQWLGLSULQFLSDOHFRQQHVVLRQHVRQROHDUHHYHUGLFKHSDUWHQGRGDOOD7RUUH9HQH]LDQDDVXG RYHVWHFRVWHJJLDQGROH0XUDDOO¶DOWH]]DGHOO¶$Q¿WHDWUR5RPDQRDEEUDFFLDQRLO&DVWHOORDUULYDQGRDGRYHVWQHOOD]RQD GRYHODYHJHWD]LRQHqSL¿WWDRYYHURVXOSURPRQWRULRFRVWLHUR,QWDOHDVVHWWRFRPSUHQGHQWHHGL¿FLTXDOLOD5HVLGHQ­ ]DGL5H=RJLO&DVWHOORO¶$Q¿WHDWUR5RPDQRLO)RUR%L]DQWLQRHWXWWHOHDOWUHDUHHLQWHUHVVDWHGDSUHVHQ]HDUFKH­ ologiche non ancora valorizzate o “scoperte”, è prevista la realizzazione di percorsi pedonali e ciclabili, una nuova YLDELOLWjFDUUDELOHFRQWUDI¿FROLPLWDWRSDUFKLOXGLFLVSD]LHVSRVLWLYLDOO¶DSHUWRHVWUXWWXUHFXOWXUDOL*OLVSD]LYHUGLVRQR caratterizzati dalla piantumazione di specie arboree ed arbustive, nonché specie erbacee perenni piuttosto che sta­ gionali, nel pieno rispetto delle specie autoctone, ma capaci di adattarsi ad un clima urbano, con una manutenzione facilitata e poco onerosa. Notevole importanza ha la progettazione dell’illuminazione: anche attraverso la luce si tende DGDUHFRQWLQXLWjDOOHYDULHDUHHGHO3DUFRYDORUL]]DQGRLQSDUWLFRODUPRGRSLD]]D,OLULDJOLHGL¿FLUHOLJLRVL &DWWHGUDOH Cattolica, Moschee, Chiesa Ortodossa), i siti archeologici che verranno alla luce e quelli esistenti, in una rifunzionaliz­ ]D]LRQH $Q¿WHDWUR)RUR%L]DQWLQR YROWDDGLQFHQWLYDUHOHDWWLYLWjWXULVWLFRFXOWXUDOLQXRYHRJLjDWWLYHFRPHLO)HVWLYDO ,QWHUQD]LRQDOHGHO&LQHPDGL'XUD]]RUHQGHQGRLOXRJKLSLVXJJHVWLYLVRSUDWWXWWRQHOOHRUHVHUDOLHQRWWXUQH/¶DUUHGR urbano, limitato a pochi e semplici elementi in materiali naturali, assume carattere non invasivo e integrato al carattere dei luoghi. Sono previste soluzioni sostenibili dal punto di vista ecologico nella progettazione degli impianti, come, ad esempio, l’energia fotovoltaica per la pubblica illuminazione. LA PIAZZA Il Palazzo della Cultura, la Grande Moschea, il Palazzo del Municipio, la sede della Prefettura, fanno di piazza Iliria LOOXRJRGLUDSSUHVHQWDQ]DSHUDQWRQRPDVLDGHOODFLWWjGL'XUD]]RHLOSLIUHTXHQWDWRVRSUDWWXWWRQHOOHRUHVHUDOLD UDIIRU]DUHWDOHFHQWUDOLWjF¶qODSUHVHQ]DLQHVVDHQHOOHYLFLQDQ]HGLDUHHDUFKHRORJLFKH )RUR%L]DQWLQR7HUPH Romane, Basilica Paleocristiana, Mura Bizantine, sepolture). 2%,(77,9,'(/352*(772 5LTXDOL¿FDUHO¶LQYDVRVSD]LDOHGHOODSLD]]DFRQQRWDQGRORLQWHUPLQLXQLWDULDJHQGRDQFKHVXLIURQWLDUFKLWHWWRQLFL UDIIRU]DUHLOFDUDWWHUHGLOXRJRSXEEOLFRDSHUWRGHOODFLWWj ,QWHUYHQLUHPRGL¿FDQGRORVXOO¶DWWXDOHPRGHOORGLPRELOLWjSXEEOLFDHSULYDWDHGLVRVWD5LGXUUHO¶LQYDVLYLWjGHOWUDI¿FR DXWRPRELOLVWLFRSHGRQDOL]]DQGRODPDVVLPDVXSHU¿FLHSRVVLELOH ­ Potenziare l’uso dello spazio pubblico per eventi di carattere collettivo, equilibrando i rapporti dimensionali e prospet­ WLFLFUHDQGRDUHHIXQ]LRQDOLDOODIUXL]LRQHSHGRQDOHSHUDWWLYLWjFXOWXUDOLSROLWLFKHDUWLVWLFKHHGHOWHPSROLEHUR ­ Connettere la piazza al sistema di spazi, percorsi pedonali­ciclabili e polarità architettoniche, archeologiche e funzio­ nali del contesto circostante, a partire dalla città vecchia e dalla collina del castello, intrecciando un dialogo compositi­ YRSLVHUUDWRFRQOHHPHUJHQ]HDUFKLWHWWRQLFKHHVWRULFKHSUHVHQWL 0LQLPL]]DUHLOQHJDWLYRLPSDWWRDUFKLWHWWRQLFRGHJOLHGL¿FLDOWLUHDOL]]DWLQHJOLXOWLPLDQQL ­ Salvaguardare e potenziare la dotazione del verde esistente nell’area di studio, garantendo e migliorando la continu­ ità ecologico­paesaggistica fra colline e piazza e aumentando le modalità di ombreggiamento naturale. L’impianto generale del progetto si basa su una maglia compositiva modulare di mt. 5,00x5,00 utilizzata come regola per la piantumazione delle specie arboree, la messa in opera delle lastricature e pavimentazioni e, in generale, per tutte le modellazioni spaziali che, si sottolinea, non prevedono la realizzazione di nuove cubature, nel rispetto del 3LDQR8UEDQLVWLFRLQWHJUDWRSHUODFLWWjYHFFKLDGL'XUD]]R/DPDJOLDFRPSRVLWLYDqVWDWDGH¿QLWDDSDUWLUHGDOODIRUPD genericamente quadrangolare del vuoto pubblico urbano e dalla conformazione della viabilità carrabile al contorno, tenendo anche conto della storia dei progetti per la piazza che comprende, fra le altre, la sistemazione prevista per ODSLD]]DGDO35*GHOGLVHJQDWDGDOO¶DUFKLWHWWR/HRQH&DUPLJQDQL3HURWWHQHUHO¶LQGLVSHQVDELOHULTXDOL¿FD]LRQH pedonale della piazza, si è prevista una viabilità carrabile al contorno, lungo i lati nord ed est, in perfetta aderenza 103 104 DTXDQWRSUHYLVWRGDO3LDQR8UEDQLVWLFRLQWHJUDWRSHUODFLWWjYHFFKLDGL'XUD]]R/DSDYLPHQWD]LRQHqSUHYLVWDFRQHVFOXVLRQHGHOO¶DVIDOWR HGLPDWHULDOLVLQWHWLFLUHDOL]]DWDGXQTXHFRQFKURPR¿EUHDPLVFHODQDWXUDOHHSHUPHDELOHLQHUWLODSLGHLSRUWDWLDYLVWDFRQODYDJJLRGHOOD miscela semiumida, cordoli e limitate lastricature in materiale lapideo rinvenienti dalle cave locali. Elemento fondamentale del progetto di ULTXDOL¿FD]LRQHqLOYHUGHGLPHGLRDOWRIXVWRQHOO¶LQYDVRVSD]LDOHFHQWUDOHGHOODSLD]]DDQFKHGLEDVVRIXVWRHGDUEXVWLYRQHOOHSDUWLODWHUDOL e del contesto circostante. Si può affermare che nel progetto, non esistendo previsione di cubature edilizie, sono proprio gli alberi e gli arbusti, oltre alle lastricature, i protagonisti pressocchè assoluti della rimodellazione architettonica. Gli alberi oggi impiantati, che danno vita ad un modesto giardinetto collocato nella parte nord­est della piazza, sono cedri che, pur apprezzabili in sé, non appaiono congrui con il tipo prevalente di verde nel VLWRLQSDUWLFRODUHFRQODÀRUDFKHFDUDWWHUL]]DODFROOLQDGHOFDVWHOOROHFXLSHQGLFLFDUDWWHUL]]DQRIRUWHPHQWHO¶DUHD,OSURJHWWRGXQTXH SUHYHGHGLVSRVWDUHLFHGULLQDOWULOXRJKLXUEDQLSLDGDWWLSHUIDUOXRJRDGXQIRUWHLQFUHPHQWRGLYHUGHQHOODSLD]]DFRVWLWXLWRGDHVVHQ]H mediterranee del tutto analoghe a quelle presenti sulla collina e nel contesto circostante: lecci, allori, ligustri, pittospori, arbusti odorosi, SLQLFLSUHVVL/DVFHOWDGLGHWWDJOLRYHUUjIDWWDVHDPPHVVLQHOODVHFRQGDIDVHGLSURJHWWD]LRQHFLzFKHLQTXHVWDVHGHVLSXzGHVFULYHUH LQYHFHqLOFULWHULRGLVFHOWDDOODOXFHGHOODULPRGHOOD]LRQHVSD]LDOHSURSRVWD,OSURJHWWRSXQWDVX¿ODULGLDOEHULG¶DOWRIXVWRTXDOLDGHVHP­ SLRFLSUHVVLIRUWHPHQWHJHRPHWUL]]DWLOXQJRGLUHWWULFLOLQHDULSHUGH¿QLUHOHOLQHHFRPSRVLWLYHIRQGDPHQWDOLGHOODQXRYDSLD]]DFRVWLWXLWHGDL ERUGLQRUGHGHVWOXQJROHVWUDGHGLWUDI¿FRSULQFLSDOHDXWRPRELOLVWLFRDGHVWLO¿ODUHVHJQDHUDIIRU]DLOERUGRYHUVRLOTXDUWLHUHRWWRPDQR *OLVWHVVL¿ODULVRQRSURSRVWLSRLSHUGDUIRUPDDGDOWULHOHPHQWLIRQGDPHQWDOLGHOSURJHWWRTXDOLLO³3DUFRGHOOHVFXOWXUHPLJUDQWL´GLFXL VLGLFHSLDYDQWLHJOLDOOLQHDPHQWLLQFDULFDWLGL³OHJDUH´PDJJLRUPHQWHOD0RVFKHDDOODSLD]]D,OSURJHWWRSUHYHGHSRLGDXQODWRDOEHUL di medio fusto, quali ad esempio i lecci, per dar vita a piantate, secondo la maglia compositiva modulare, davanti alla sede del Comune RGDYDQWLDOOD3UHIHWWXUDGDOO¶DOWURDUEXVWLHFHVSXJOLLQWXWWHOHSDUWLGLUDFFRUGRIUDJOLDVVLFRPSRVLWLYLSULQFLSDOLHOHSDUWLGLFRQQHVVLRQH FROFRQWHVWRFLUFRVWDQWH/DSLDQWDWDGL¿ODULLQROWUHqXWLOL]]DWDGDOSURJHWWRSHUVHJQDUH±HGRPEUHJJLDUHRYYLDPHQWHVHQ]DULJLGH JHRPHWUL]]D]LRQLOLQHDULLSHUFRUVLGLFRQQHVVLRQHIUDSLD]]DGDXQODWRHGDOO¶DOWUR$Q¿WHDWUR0RVFKHD)RUREL]DQWLQR&KLHVDFDWWROLFD ed altre emergenze. Il progetto valuterà l’opportunità di utilizzare la non indifferente quantità di acque meteoriche raccolte dalla piazza per DOLPHQWDUHODIRQWDQDSUHYLVWDHODUHWHGLLUULJD]LRQHWDOLDFTXHVHXWLOL]]DWHVDUDQQRQDWXUDOPHQWHSUHYHQWLYDPHQWHGHSXUDWH/HVHGXWH SXEEOLFKHVDUDQQRUHDOL]]DWHFRQEORFFKLGLSLHWUDORFDOHRSSRUWXQDPHQWHVDJRPDWLVHFRQGRIRUPHGLDVVROXWDVHPSOLFLWjHYLWDQGRLOSL possibile di ricorrere a produzioni industriali, cercando di risolvere tutti gli altri problemi dell’”arredo urbano” con pezzi disegnati espressa­ mente. 105 3.10 Piazza7Piazze Archh. Gian Paolo Roscani, Sabrina Cantalini , Adelaide di Michele, Prof. Antonio Terranova , Archaeologist Claudia Cecamore, (QJ/\VH+DQVHQ$UWLVW3DWUL]LD0ROLQDUL/LUD0XOODGHPL 7+(32,172)9,(: Often competitions for the rehabilitation of public spaces concern degraded and marginal areas, with no quality or identity. The case of Iliria square is not among them. There are many things in Iliria square. There is a fountain, with seating areas. There are small gardens, with benches and trees. There are also paved pedestrian spaces. There are many roads and car parks: more than half of the total area. There are many different buildings that surround the squa­ re and watch it from every side. Public buildings, churches, private buildings, some in good state, some not, and small business kiosks. Around the piazza (and probabily even below) surviving traces of ancient history: a concentration of archaeological evidences that has not equal in Albania, at least in urban environment. Space is ordered, public spa­ ces treated, well­pruned trees and illumination street implemented carefully. It’s a lively square, not only crossed to go elsewhere, but lived: on the steps of the fountain in the garden, during special events and occasions, but also during everyday life, many people live space of the square as space for meetings, report, rest and recreation. In the space of the square you can feel the presence of the different dimensions of the city, geographical, functional, morphological. <RXFDQSHUFHLYHWKHVHDÀDQNWKHQDWXUHRIOLJKWUHOLHISDVVHIURPRQHVLGHWRDQRWKHULQWKHFLW\FHQWHU,W¶VDSLD]]D RIWKHFLW\LQFORVHV\PELRVLVZLWKLW7KHIRXUPDLQURDGVSOXJLQWKHIRXUFRUQHUVRIWKHUHFWDQJXODUVSDFHGH¿QLQJ and breaking the four sides of the square. Each of them tells an autonomous story, the result of dynamic operations, projects and actions (but sometimes also the result of non actions and inactivities) that have conditoned the appe­ arance, sometimes permanently, or have left space for other new and interesting opportunities. Redeveloping Iliria Square means to read this superposition of layers, of presences, of suggestions, of directions. It means to exploit its richness, building the conditions that allow, now and after, the piazza to live its multiple dimensions, as if in Iliria Squa­ UHFRXOGKDSSLO\OLYHWRJHWKHUVHYHQSLD]]DV&LW\+DOO3LD]]D&XOWXUH3LD]]D%\]DQWLQH)RUXP3LD]]D3UHIHFWXUH Piazza, Mosque Piazza, Urban Walls Piazza, Roman Theatre Piazza, to whom, one by one, is important to give a planning answer. Some of them already exist. Others have to be revisioned more in depth. Others are still there and must be reconstructed. Some of them can be implemented immediately, others will need to draw a roadmap for the future. The proposed project is a Project / Programme, an instrument of action and planning, guidance and immediate operational support for the Administration in planning the action in future times, in close contact and coordination with the overall policies of rehabilitation and development resources. :+<" Renaming streets to redevelop the city Renaming streets to redevelop the city The project for the rehabilitation of the square is therefore a project that invol­ ves size and issues that belong to the arguments of the urban life. The reasons for “why to intervent” belong to the urban life. Iliria square is, along with the water front, one of the most important and characterized public spaces and ODQGPDUNVRI'XUUHV7KHLVVXHVIRUDFWLRQLGHQWL¿HGLQWKHQRWLFHRIWKHFRPSHWLWLRQDUHDOOWKHPDWWHUVRISODQQLQJ DQGXUEDQUHJHQHUDWLRQHYHQEHIRUHWKH\DUHREMHFWVRIUHÀHFWLRQRISK\VLFDODUFKLWHFWXUDOVSDFH7KHSHULPHWHURI the contest involves areas that go far beyond the area of the square, covering an entire urban area rich and layered. Issues and knots Just look at expanding the urban context of the square and operation of the city, in fact, you can see the main problems and, therefore the main reasons: ‡WKHSUHVHQFHRIDVWURQJYHKLFOHWRORDGWKHVWUXFWXUHRIXUEDQWUDI¿FDQGWKHREYLRXVFRQÀLFWEHWZHHQWKLVDQGWKH SHGHVWULDQOLIH ‡WKHPDUJLQDOL]DWLRQRIWKHPDQ\UHVRXUFHVKLVWRULFDODUFKHRORJLFDOUHVSHFWWRSXEOLFVSDFHHVSHFLDOO\LQWKHDUHDVRI UHSRUWLQJDQGDFFHVV ‡WKHVWDWHRIGHJUDGDWLRQRIWKHXUEDQDUHDVWRWKHHDVWRIWKHSLD]]DWKHPDLQXQFHUWDLQW\GH¿QLWLRQRIWKHHDVWHUQ IURQW ‡WKHJDSEHWZHHQWKHJUHHQVSDFHVRIWKHVTXDUHDQGWKHFLW\WRGD\YDOXDEOHLVODQGVEXWVHSDUDWHG ‡WKHRSSRUWXQLW\WRFUHDWHDSHGHVWULDQDQGSXEOLFVSDFHE\WKHVHDIURQWWRWKHKHDUWRIWKHFLW\ZLWKDQH[WHQVLRQ FRPSDUDEOHWRWKHFHQWUDOSHGHVWULDQDUHDVRIPDMRU(XURSHDQFLWLHV ‡WKHDEVHQFHRIDYLVLEOHV\PERORISURJUHVVDQGVXVWDLQDEOHXUEDQLQDXJXUDWHGZLWKWKHQHZ3ODQ5HGHYHORSLQJ the square means then to see together the different souls of the city and help to resolve some problems and design issues highlighted in the studies, and the content of recent Regulatory Plan. :+$7" Space of the piazza and space of the city Space of the piazza and space of the city The project reconsiders as a whole as the internal space of the square, as the space relating the square, the surrounding buildings, the archaeological sites and the spaces of the town on its whole. The articulation and the wideness of the square and of its functions, together with some structural choices as the reorganization of urban road network according to the Town Planning expectations, allow to elaborate and GH¿QHWKHSURMHFWIRUVHYHQSLD]]DVHDFKZLWKLWVRZQLGHQWLW\EXWOLQNHGRQHHDFKRWKHU(DFKRIWKHVHYHQSLD]]DV FRQVHQWVWRPDUNDQDXWRQRPRXVSODQQLQJLVVXHHDFKZLWKLWVRZQVSHFL¿FWLPHVDQGPRGHVRIUHDOL]DWLRQFRVWV SURFHHGLQJVLQYROYHGVXEMHFWV(DFKRIWKHVHYHQSLD]]DVKDVVSHFL¿FDQGGH¿QHGUHODWLRQVZLWKWKHXUEDQVSDFH and with its functions and represent a point of reference for the construction of the relations among the process of revitalization of Iliria Square and the processes of urban redevelopment triggered from the new urban policy. 106 Archaeology and History The project interacts with the archaeological theme at three levels: immediately, suggesting a close collaboration with the WHDPLQFKDUJHRIWKHH[FDYDWLRQVRI'XUUHVIRUSURJUDPPLQJDOOQHFHVVDU\DQGDSSURSULDWHYDOXWDWLRQVGXULQJWKHZRUNRQWKH QDWXUDOUHJHQHUDWLRQRIWKHSLD]]DUHDG\WRUHYLHZWKHGHVLJQDVVXPSWLRQVDQGWDNHLQWRDFFRXQWWKHRXWFRPHVRI'LDJQRVWLF campaign, if it proves exhibits or testimony worthy of being exploited and incorporated in the draft revitalization. Green and Nature 7KHVL]HLVQDWXUDOLQWKHFHQWUDODUHDVRIWKHFLW\DOZD\VGLI¿FXOWWRDGPLQLVWHUKHGUDIWUHYLWDOL]DWLRQUHWDLQVDQGHQKDQFHV the presence of Green piazza redrawing the layout and relocating the trees in an existing place in continuity with a wider pedestrian and protected space. The scheme provides for two kinds of new or redeveloped green areas. Public space The scheme provides for reorganization of the public space of Iliria Square as a whole, by moving the main urban road on the east side of the square to create the physical pedestrian continuity along the side of the hill and with the pedestrian boulevard FRQQHFWLRQWRWKHZDWHUIURQW7KLVUHFRQ¿JXUDWLRQSURYLGHVDOVRIRUWKHUHDOORFDWLRQRIWKHH[LVWLQJIRXQWDLQDVDURQGSRLQWRI WKHURDGV7KHVSDFHIDFLQJWKH&LW\+DOOLVFKDUDFWHUL]HGE\DVHTXHQFHRIHOHPHQWVDVDOLQNLQJXSSODQHDPRQJWKHHOHYDWHG VSDFHRIWKHEXLOGLQJDQGWKHOHYHORIWKHVTXDUHDQLQWHUPHGLDWHSHGHVWULDQVSDFHGH¿QHGE\DZDWHUEDVLQZLWKWLPHGYHUWLFDO jets, and, behind it, the wooded area. 107 These elements relate one each other at different levels, creating large steps and sittings capable to receive passers by and spectators for SRVVLEOHRSHQDLUVKRZVDQGHYHQWV(OHPHQWVRIXUEDQIXUQLWXUHDVOLJKWLQJV\VWHPVFDQEHORFDWHGWRERUGWKHZHVWVLGHRIWKH&LW\+DOO 3LD]]DRQWKHERXQGDU\RIWKHPRGL¿HGXUEDQURDGQRZSHGHVWULDQL]HGXVLQJWKHVDPHFULWHULDDQGPDWHULDOVRIWKHH[HFXWHGSURMHFWRIWKH boulevard. The proposed hypothesis as a suggestion provides for the possibility to use light columns feed by solar cells that incorporate, in the frontal panel, functions as info screens or similar. Function, services and pubblic space 7KHVFKHPHFRQ¿UPVWKHPDLQXUEDQIXQFWLRQVWKDWFKDUDFWHUL]HWKHVTXDUHDQGLWVVXUURXQGLQJVFRQWULEXWLQJORRNLQJWRWKHIXWXUHWRWKHLU enrichment and to the maturation of managerial consciousness of the dynamics of transformation by an articulated system of actions: ‡WKHUHGHYHORSPHQWRIWKHDUFKDHRORJLFDOVLWHVDVDQRFFDVLRQWRHQULFKWKHNQRZOHGJHDQGWKHSDWULPRQ\RIUHVWVDQGLQIRUPDWLRQVLQ view of an enlargement of the archaeological museum, and, eventually, also in view of the new building to execute along the east front of the piazza ‡WKHUHFRQ¿JXUDWLRQRIWKHVSDFHRIWKHSLD]]DDVDQRSSRUWXQLW\WRFUHDWHQHZUHODWLRQVDPRQJWKHXUEDQIXQFWLRQVE\WKHLQFUHDVLQJRI WKHZDONZD\VDQGRIWKHF\FOHWUDFNVDQGWKHUDWLRQDOL]DWLRQRIWKHDFFHVVWRWKHSXEOLFFROOHFWLYHWUDQVSRUWDWLRQQHW ‡WKHSURFHVVRIUHYLWDOL]DWLRQDVDSLORWSURFHVVWKDWDOORZVWHVWLQJDQGSXWWLQJULJKWWKHV\VWHPRIUHODWLRQVDPRQJSXEOLFDQGSULYDWH subjects inside of complex urban improvement plans. Mobility and trasportation On the side of mobility the scheme opens occasions and opportunities of great interest, mainly regarding the reorganization of the points of access to the public urban transportation, allowing the localization of a new protected bus stop (choice to be evaluated and executed together with the Administration) and creating a new about 9.000 square meters pedestrian area, including as the area of the square as the Mosque an Prefecture green hill. As regards the parking areas the scheme provides for concentrating the parking areas in three main SRVLWLRQVD¿UVWJURXSRQWKHEDFN\DUGRIWKH&XOWXUH%XLOGLQJDVHFRQGRQHRQWKHHDVWVLGHRIWKH&LW\+DOODQGDWKLUGRQHRQWKHHDVW VLGHRIWKHVTXDUHGLUHFWO\VHUYLQJWKHSHGHVWULDQVSDFH3DUWLFXODUDWWHQWLRQZLOOEHJLYHQLQSKDVHRIGH¿QLWLYHSODQQLQJWRWKHFRQWURORI the building yard’s phases, to consent the easier running of urban mobility during the works. Sustanibility The proposed project is confronted with the issue of its sustainability on several levels simultaneously: 1. sustainability of the environmental impacts 2. Affordability and procedural 3. social sustainability of the process of revitalization HOW?The feasibility as a condition of project The revitalization of Piazza Iliria in fact a complex, by extension, in way toarticulate the goals and ambitions. The question of how to pro­ ceed and achieve is of very importance, especially as concerns the potential to put into the program as necessary the completation of the physical rehabilitation interventions of the piazza’s areas. The project proposal responds to this question through two points of view related to each other, that complete the picture of sustainability of the project: The theme of sustainable economic revitalization of the interventions planned, of the mount 5 million, enough to achieve the physical intervention retraining the project for the piazza. The proposal, however, DFWLYHLQPRWLRQDQGSXWVSURVSHFWVIRUSURFHVVLQJDQGUHWUDLQLQJZKDWPD\JREH\RQGWKHERXQGDULHVVSDWLDOWHPSRUDODQG¿QDQFLDO aspects of the competition and which may require additional time for study and verify the feasibility. 108 3.11 Quantum $UFK0LOHQD)DULQD Arch. Mariella Annese, Arch. Pierangelo Izzo $38%/,&63$&(,17+(+,6725,&&,7<675$7(*,(6)255(9,7$/,=$7,21 7KHPDLQSXEOLFVSDFHRIWKH7RZQRI'XUUHVLVQRWFKDUDFWHUL]HGE\SDUWLFXODUSUREOHPVRIGHFD\$OWKRXJKVXU­ rounded by important archaeological monuments and public buildings, Iliria Square appears as a big void not very lived as social place. Our strategies of intervention aims to improve its use as a public space emphasizing the impor­ tance of this place in the earth of the city: ±'HYLDWLQJPDLQWUDI¿FURXWHVIURPWKHFHQWUHRIWKHVTXDUH7KH¿UVWVWUDWHJ\WRUHYLWDOLVHWKHVTXDUHLVLQFUHDVLQJ the pedestrian area with a new organization of car mobility. The idea is avoid to cross the square with an important WUDI¿FURXWHOHDGLQJWRWKHKDUERXUDQGWROLPLWWKHVHFRQGDU\URXWHVLQWKHQRUWKHUQDQGVRXWKHUQVLGHRIWKHVTXDUH This organization allows to free from cars the central part of the square, a pedestrian plateau which connects the western front with the most problematic eastern side. 2 – Attracting the others urban routes to the centre of the square 7KH¿UVWVWUDWHJ\LVFRPELQHGZLWKDVHFRQGPRYHWKHV\VWHPVRISHGHVWULDQURXWHVZKLFKFRQQHFWVWKHPRVWLPSRU­ tant urban places (routes of population, trading routes, tourist and cultural itineraries) cross the plateau of the square. So we have two different and interconnected systems, one static and one dynamic which interfere with each other. The system of the urban routes leading to the square will be characterised by rows of trees which will be in continuity with green areas in the central plateau. $1µ85%$1,=('¶648$5( 7KHFHQWUDOSODWHDXLVFRQFHLYHGDVDVRUWRIµVWDJHIRUXUEDQOLIH¶ZKHUHGLIIHUHQWDFWLYLWLHVKDYHSODFH¶8UEDQL]LQJ¶ the void through a hybridization of functions and activities allows people to live in different ways and moments during GD\LQHYHUFKDQJLQJFRQ¿JXUDWLRQV VKDGHGDUHDVZLWKEHQFKHVDQGFRQFHQWUDWLRQRIWUHHV ­ areas where it is possible to organize new activities: shop kiosks, tourist information centre, café, restaurants, local VWUHHWPDUNHW VSRUWDUHDV SOD\DUHDV ­ areas for events. The strategy for organization of different activities is the application of a virtual grid superimposed in the plateau to IXQFWLRQDVDPDWUL[IRUWKHGLVSHUVDORIDVHULHVRIµDWWUDFWLRQV¶ZLWKWKHLUµDUHDRILQÀXHQFH¶7KHYLUWXDOJULGFRXOGDOVR function as a matrix for the small infrastructural elements like phone booths, lamp posts, bank machines and so on. 7KHQHZSURJUDPLVLQWURGXFHGDVDVHWRIµHYHQWDJHQWV¶SUHPLVHGQRWRQRUJDQLVLQJVSDFHEXWWRVHWLQPRWLRQDQG link into larger existing processes. A series of pronounced urban experiences is created through the explorative use of space and desire lines, made up of different circulation routes and green corridors. So urban routes crossing the SODWHDXDUHDWWUDFWHGE\WKHGLIIHUHQWµDUHDVRILQÀXHQFHV¶FKDQJLQJWKHLUWUDMHFWRU\6RPHDWWUDFWLRQVDUHµSURMHFWHG¶ from the grid to the surroundings, revitalizing the most important areas around the square. Our proposal aims to set LQPRWLRQDOLYHO\SXEOLFGRPDLQE\LPSUHJQDWLQJWKHVLWHZLWKWKHTXDOLWLHVRIFRQWHPSRUDU\'XUUHVWXUQLQJLWLQWRDQ urban experience. Re­connecting urban places: archaeology and cultural heritage Tourist and cultural itineraries are very important urban routes crossing the area, surrounded by important archaeological monuments. All the historical remains will be integrated and reconnected in clear routes leading to Iliria square: the Castle, the Roman Amphithe­ DWUHWKH2WWRPDQZDOOVWKHROGWUDGLQJURXWHZLWKWKHWKHDQFLHQW+DPPDQWKH%LJ9HQHWLDQ7RZHUDQGWKH+HOOHQL­ VWLFZDOOVWKHDQFLHQW0DFFHOOXPDQGWKH%\]DQWLQH)RUR&URVVLQJWKHVTXDUHWKHVHFXOWXUDOURXWHVEHFRPHPRUH interesting because tourist can live different urban experiences and stay more in a place that reconquers its role of earth of old town. RE­CONNECTING GREEN AREAS :LWKWKHOLPLWDWLRQRIFDUWUDI¿FWKHPDLQVWUHHWVLQWKHQRUWKHUQDQGVRXWKHUQVLGHOHDGLQJWRWKHVTXDUHZLOOEHUHRUJD­ nised with a large pedestrian pavement characterized by rows of trees. These green corridors will be in continuity with the new gardens of the square with local essences and have a role of reconnection with the vegetation of the climb of WKHKLOOLQWKHZHVWHUQVLGH$µXUEDQVWDJH¶DVSXEOLFHYHQWVDQGRXWGRRUGLVSOD\V$JUHDWDUHDRIWKHQHZVTXDUHZLOO EHGHVLJQHGDVDQLQWHUDFWLYHSXEOLFVSDFHÀH[LEOHLQXVHDQGVXLWDEOHWRRUJDQL]HSXEOLFVKRZVDQGHYHQWV 5HLQWHJUDWLRQRIWKHEXLOWHOHPHQWVDQGLWVVXUURXQGLQJV7KHOLPLWDWLRQRIFDUWUDI¿FDOORZVWRFRQQHFWWKHPDLQEXLO­ dings in the eastern and western sides of the square with a wide pedestrian plateau. The city hall is connected with the pedestrian route of the Castle – Amphitheatre – Ottoman walls and provided of car park for state employees and disabled persons. The theatre in the northern side is integrated with the renovation of the archaeological area of the DQFLHQW0DFFHOOXPDQGWKH%\]DQWLQH)RURZLWKWKHUHRUJDQL]DWLRQRIWKHDFWLYLWLHVWKDWLQYDGHGWKHSXEOLFVSDFH 109 110 3.12 Suoli Sensibili Arch. Laura Mascino, Arch. Barbara Agnoletto, Arch. Giulia Lobba, Arch. Anna Paola Pola UNA PIAZZA COME OCCASIONE 8QDSLD]]DqO¶RFFDVLRQHSHULQL]LDUHDFRVWUXLUHXQFHQWURGDVRODQRQSXzFRVWLWXLUHXQVLVWHPDFHQWUDOHPDq O¶RSSRUWXQLWjSHUDYYLDUHXQDULÀHVVLRQHFKHLQYHVWHXQSURJHWWRDVFDODSLDPSLD$QFKHSHU3LD]]D,OLULDD'XUD]]R qFRVuSURJHWWDUHODSLD]]DPHWWHLQFDPSRLOSURJHWWRGHO³FHQWUR´GL'XUD]]RHWXWWHOHTXHVWLRQLOHJDWHDFRVDVLDH cosa ci si aspetta da un luogo centrale. Trasformare uno “spazio” vuoto, anche se curato e ben tenuto in un “luogo” centrale. Un posto dove andare, dove si può stare, che può trasformarsi, ospitare degli eventi, che può riempirsi, VYXRWDUVLXQOXRJRULFRQRVFLELOHHUDSSUHVHQWDWLYRLQFXLLGHQWL¿FDUVLXQOXRJRGLLQFRQWURHGLVRVWD8QDSLD]]Dq un posto dove si va, una pausa spaziale nella città. Piazza Iliria: il sistema dei grandi luoghi centrali e il “centro” città. Piazza Iliria appartiene a una duplice struttura delle centralità: il sistema dei grandi luoghi centrali e il “centro città”. (¶XQYXRWRLQPH]]RDOODSDUWHSLDQWLFDGL'XUD]]RGRYHDQFKHVHJOLHGL¿FLVRQRFDPELDWLHVRQRVWDWLULFRVWUXLWLOD PRUIRORJLDVWHVVDGHOO¶HGL¿FDWRPRVWUDODVXDVWRULD/DFLWWjGHQVDHQRQUHWWLOLQHDGRYHHPHUJRQRLQFRQWLQXD]LRQH tracce delle epoche passate, dove il suolo è carico di strati: lo strato romano,bizantino, ottomano,...e il novecento. 3LD]]D,OLULDqDQFKHLOOXRJRGLUDSSUHVHQWDQ]DGHOODFLWWjFRQWHPSRUDQHDGRYHVLWURYDQRWXWWLJOLHGL¿FLSXEEOLFLLO FHQWURGHOFHQWUR(¶XQDFHQWUDOLWjUDSSUHVHQWDWLYDVLDDOODVFDODGLWXWWDODFLWWjFKHDXQDVFDODSLFLUFRVFULWWDXQR spazio di rappresentazione funzionale e simbolica. Il progetto deve farsi carico innanzitutto di questo ruolo, vale a dire che deve strutturare una “monumentalità senza tempo”. 9,$%,/,7¬*5$'$=,21,',75$16,72 /DSULPDPRVVDSHUUHQGHUHXQYXRWRXQYXRWR³VLJQL¿FDQWH´qFKHGLYHQWLXQOXRJRGRYHVLYDQRQGRYHVLWUDQVLWD Costruire una pausa spaziale nella città.Questo è un aspetto importante perchè lo spazio del pedone, del passeg­ giare, della sosta non possono essere anche il luogo del transito. Il transito veicolare tende a diventare dominante, a SUHYDULFDUHHPRQRSROL]]DUHODYRFD]LRQHGLXQRVSD]LR3DVVDUHYHORFHPHQWHDQQXOODLOVLJQL¿FDWRRODYRFD]LRQHGL OXRJRGLVRVWDRGLDUULYRFKHLQYHFHXQDSLD]]DGHYHDYHUH3HURWWHQHUHO¶DWPRVIHUDHODGHQVLWjGLVLJQL¿FDWLFKHD questo luogo si vuole dare bisogna che l’ambito del pedone diventi prevalente. L’atteggiamento che quindi il progetto SUHYHGHGLVYLOXSSDUHqTXHOORGLXQFUHVFHQWHUDOOHQWDPHQWRQHOOD]RQDFHQWUDOH¿QRDXQDSDXVDWRWDOHQHOODSLD]]D Una sorta di graduale pedonalizzazione dell’area. La viabilità principale di attraversamento e raggiungimento della ]RQDSRUWXDOHYLHQHFRQVLGHUDWDHVVHUHTXHOODDQRUGHDHVWFRVWLWXLWDGDDVVLSULQFLSDOL 55('HVKPRUHYHHYLD (JQDWLD 4XHVWLDVVLUDFFKLXGRQRXQDUHDFKHSXzHFKHGHYHVHYXROHFDPELDUHDWWLWXGLQHGLYHQWDUHSL³OHQWD´/H VWUDGHGLDYYLFLQDPHQWRD3LD]]D,OLULDGLYHQWDQRGHOOHSHQHWUDQWLQHOO¶DUHDFHQWUDOHGRYHLOWUDI¿FRGRYUHEEHDYHUHXQ LQWHQVLWjGLJUDGRPLQRUH6LSXzLPPDJLQDUHFKHDQFKHLOVLJQL¿FDWRGLYLD6KHITHW%HMDHYLD'\UUDKFDPELHFKHOD VH]LRQHVWUDGDOHVLDUWLFROLFRQWHPSODQGRGHJOLVSD]LGLSDUFKHJJLRRVRVWDWHPSRUDQHD/HVWUDGHDUULYDQR¿QRDOOD SLD]]DPDQRQO¶DWWUDYHUVDQRXQDVHULHGLSDUFKHJJLSXQWXDOLJDUDQWLVFRQRQHOO¶LQWRUQRJOLVSD]LGLVRVWDQHFHVVDUL GLSHUWLQHQ]DGHJOLHGL¿FL&RQVLGHUDWRFKHQRQqSUHYHGLELOHXQSDUFKHJJLRVRWWHUUDQHRHFKHXQSDUFKHJJLRDUDVR all’interno della piazza andrebbe a incidere sul suo uso, si propone di portare avanti un lavoro di ricerca puntuale di SLFFROHDUHHGDDGLELUHDSDUFKHJJLRHGLULGH¿QL]LRQHGHOOHVH]LRQLVWUDGDOLULQWUDFFLDQGRGHJOLDPELWLSHUODVRVWDYHL­ colare. L’accessibilità e l’attraversamento alla piazza viene comunque garantita sul lato ovest nella direttrice nord sud e sul lato sud nell’altra direttrice. Se il passaggio di automobili viene ridotto al minimo il passaggio e l’arrivo di mezzi pubblici sarebbe invece auspicabile. 2%,(77,9,675$7(*,(($=,21,',,17(59(17235(9,67( L’obiettivo principale da raggiungere attraverso il progetto è dunque quello di ridare un “senso” compiuto a questo VSD]LR)DUORGLYHQWDUHLOOXRJRGHOODUDSSUHVHQWDQ]DLOOXRJRGRYHXQDVHULHGLIXQ]LRQLFROOHWWLYHSRVVDQRHVVHUH esplicate, dove sia possibile rintracciare una particolare atmosfera.Questo spazio deve sia garantire un piacevole uso quotidiano sia contenere degli eventi e quindi avere la possibilità di riempirsi e di essere allestito: deve essere uno spazio versatile. Inoltre quest’area è puntellata da una notevole quantità di reperti archeologici e uno degli obiettivi è rendere questi oggetti e questi spazi parte attiva della città. Il progetto non prevede esclusivamente un recupero del considerevole patrimonio culturale, ma una “rivitalizzazione” di questo. La strategia è di renderlo parte attiva nella costruzione del progetto. Le proposte portate avanti riguardano quindi la costruzione di una “atmosfera” centro, attra­ verso la graduale pedonalizazzione dell’area e la costruzione di uno spazio “speciale” all’interno di un sistema. SUOLI /DPRVVDSULQFLSDOHGHOSURJHWWRqTXHOODGLODYRUDUHFRQGLYHUVL³VXROL´,GLIIHUHQWLOLYHOOLWRSRJUD¿FLHOHVWUDWL¿FD]LRQL VWRULFKHIDQQRSHQVDUHDXQDVRPPDWRULDGLVWUDWL¿VLFLIDVFHVRYUDSSRVWHGLPDWHULDOLXUEDQL3URSULRTXHVWLVRWWLOL diventano il principale materiale di progetto. [0]Un suolo sensibile che si espande come un liquido e reagisce in modo diverso a seconda di cosa incontra e ne de­ QXQFLDODSUHVHQ]D'H¿QLVFHORVSD]LRGHOSHGRQHHWLHQHLQVLHPHLGLYHUVLRJJHWWLFKHVLDSSRJJLDQRLQTXHVWROXRJR 111 4XHVWRVXRORQRQKDXQOLPLWHQHWWRQRQGHVFULYHXQD¿JXUD precisa, è espandibile. Nell’incontrare i reperti archeologici, si FRUUXJDHIDSHUFHSLUHYLVLYDPHQWHH¿VLFDPHQWHODYLFLQDQ]D di un oggetto archeologico, quando invece passa sopra un area dove sotto sono presenti delle tracce storiche si alza come in una sorta di rimando plastico a un “architettura” che in un altro tempo era presente li. Le architetture di rappresen­ tanza: la moschea, il teatro, il municipio... determinano invece i tracciati principali che costruiscono il disegno della piazza. Queste linee saranno poi quelle che fanno funzionare il suolo:, le pendenze, gli scoli dell’acqua, la raccolta dell’acqua ecc.. Li dove sono già presenti degli alberi questo suolo sensibile si apre per contenerli, inglobando così dei giardini alberati. Sul lato est la presenza di Cedri Libanesi da l’occasione per costruire un “giardino” alberato con piante e arbusti tipici della macchia mediterranea dove il benessere della sosta è dato dall’ombra, dalla presenza dell’acqua e di panche dove sedersi. [­1] Il suolo antico. E’ il livello che contiene tutti i reperti arche­ RORJLFLORVWUDWRFKHVWDVRWWRHFKHLQÀXHQ]DTXHOORVXSHULRUH in alcuni punti emerge e diventa oggetto, in altri rimane invisi­ bile ma percepibile dalle variazioni dello strato superiore >@LSLHGLVWDOOL4XHVWRVXROROHJJHUPHQWHULDO]DWRGH¿QLVFH O¶DPELWRGLSHUWLQHQ]DGHLGLYHUVLHGL¿FLSXEEOLFLXQDVRUWDGL EDVDPHQWRFKHGDORURULFRQRVFLELOLWj6XXQVXRORSLDPRUIR VLDSSRJJLDQRGHJOLVWUDWLJHRPHWULFDPHQWHSLGH¿QLWLHFKH UHQGRQRSL³PRQXPHQWR´O¶RJJHWWRFKHYLVWDVRSUD6LUDI­ IRU]DLOFDUDWWHUHUDSSUHVHQWDWLYRGHJOLHGL¿FLSXEEOLFL4XHVWL piani contengono anche il sistema di risalita e accesso agli HGL¿FLFKHVLWURYDTXDVLVHPSUHDGXQOLYHOORPDJJLRUHULVSHWWR a quello della piazza. >@ODEDVHGHOODPRVFKHD/DPRVFKHDqO¶HGL¿FLRSRVWRSLLQ DOWRHIRUVHTXHOORFKHSLFRQQRWDTXHVW¶DUHD/¶LQWHQWRqGL UDIIRU]DUHDQFKHODSUHVHQ]DGHOVXREDVDPHQWRSLDOWR senza immaginare necessariamente la demolizione e ricostruzione di questo piano si considera però una sua valorizzazione e messa in evidenza. [3] il promontorio. Sul lato ovest lo sfondo è quello del promontorio coperto da una vegetazione formata da essenze tipiche del paesaggio mediterraneo. Qui il Piano prevede di costruire il Parco delle Mura Bizantine. Il basamento della Moschea [3] e la base del palazzo della Prefettura[2] sono l’attacco del parco alla piazza. Questo sistema di piani rialzati e inclinati contiene dei giardini di alberi che fanno da “arrivo” e “ingresso” dal parco alla piazza. ESPANSIONI ,OSURJHWWRGLVXRORFKHVLSUHYHGHSHUOD3LD]]DSXzHVSDQGHUVLLQXQDUHDSLYDVWDLQPRGRGDFRVWUXLUHXQVLVWHPD “centro città”. Come nelle città antiche la coesione dello spazio è data dalla omogeneità del suolo così si prevede che una zona fatta di oggetti e parti differenti tra loro accostate dalla storia e non da un omogeneità architettonica, diventi ricono­ scibile e unica attraverso un progetto di suolo uniforme. La prima espansione prevista è quella che individua alcuni assi stradali che arrivano alla piazza , facendoli diventare prolungamenti della piazza stessa, quasi ad agganciarla ai quartieri FLUFRVWDQWL8QDVHFRQGDHVSDQVLRQHFRPSUHQGHOHGXHYLHFKHVLDWWHVWDQRDOO¶HGLILFLRGHOWHDWURHFRUVR(SLGDPQRVTXL la pavimentazione può reagire come il suolo [0] ovvero quando incontra dei manufatti archeologici subisce delle interfe­ renze che denunciano la presenza di questi ultimi. La terza espansione prevista, riguarda un progetto di suolo ricono­ scibile che si estende nei quartieri limitrofi, nella costruzione a scala urbana non di un asse con una piazza finale ma di un’area centrale. 6267(1,%,/,7$¶/$925$5(&2120%5$/8&($&48$3,(75(«6,/(1=,2 /DSULPDDWWHQ]LRQHQHOODFRVWUX]LRQHGLXQOXRJRSXEEOLFRqFKHVLDDFFHVVLELOHHIUXLELOHGDWXWWLSRLIDUHXQSURJHWWRVRVWHQLELOHGLXQR VSD]LRDSHUWRYXROGLUHDQFKHODYRUDUHFRQPDWHULDOLFKHDLXWLQRDFRVWUXLUHGHOOHVLWXD]LRQLGLEHQHVVHUH¿VLFRVSD]LGRYHVL³VWDEHQH´ a partire dalle peculiarità del luogo: dal clima, dalla latitudine. Il progetto lavora con l’ombra, quella prodotta dagli alberi, con il fresco e la VHQVD]LRQHGLIUHVFRFKHO¶DFTXDSXzGDUHFRQPDWHULDOLFKHQRQVLVFDOGDQRFRPHODSLHWUDFRQOXFLFKHFRQVHQWRQRGLFDUDWWHUL]]DUHJOL spazi anche di sera e si alimentano attraverso tecnologie che seguono i principi del risparmio energetico. Quindi una serie di giardini albe­ UDWLSXQWHJJLDQRODSLD]]DJLDUGLQLFRQHVVHQ]H0HGLWHUUDQHHFKHFRVWUXLVFRQRGHLOXRJKLG¶RPEUD6LLPPDJLQDFKHYHQJDQRUHFXSHUDWLLQ SDUWHDQFKHLJLDUGLQLPXUDWLFKHFDUDWWHUL]]DYDQRO¶DELWDWRFLUFRVWDQWHLQPRGRGDFUHDUHWUDVSD]LSULYDWLHSXEEOLFLXQVLVWHPD¿WWRGL³SXQ­ ti verdi” che possa svolgere un ruolo di riconnessione ecologica tra le pendici collinari la fascia costiera. Tra i giardini previsti sulla Piazza, LOSLJUDQGHFDUDWWHUL]]DLOODWRDHVW8QDYHUDHSURSULDPDFFKLDGLDOEHULVRWWRLTXDOLXQDVHULHGLJLRFKLHYDVFKHG¶DFTXDDXPHQWDQR ODVHQVD]LRQHGLIUHVFRHSRVVRQRHVVHUHXWLOL]]DWLGDLEDPELQLSHUJLRFDUHODSLD]]DYXROHHVVHUHDQFKHXQOXRJRSHULEDPELQL$OEHUL DFTXDVHGXWHVWUXWWXUDQRTXHVWROXRJRFKHYXROHHVVHUHTXHOORGHOODVRVWDHGHOO¶XVRTXRWLGLDQR4XHVWRJLDUGLQRIDLQROWUHGD¿OWURHGD schermo tra la piazza aperta e il costruito del lato est che risulta essere molto disomogeneo ma che proprio grazie a questo suo carattere IUDPPHQWDWRFRQVHQWHXQDLQ¿OWUD]LRQHGHOODSLD]]DQHOTXDUWLHUHHYLFHYHUVD,OJLDUGLQRODYRUDFRPHXQD³FHUQLHUD´WUDTXHVWLGXHDPELWL urbani. 112 Luci e materiali I materiali per la realizzazione sono quelli della tradizione reinterpretati attraverso un linguaggio contemporaneo. L’illuminazione di uno spazio pubblico costruisce l’atmosfera della sera, si immagina che ci siano installazioni che usino la luce in modo artistico caratterizzando DOFXQLWUDWWLGHOODSLD]]DHFKHJOLDSSDUHFFKLLOOXPLQDQWLVLDOLPHQWLQRDWWUDYHUVRO¶XVRGHOIRWRYROWDLFRHVIUXWWLQRODWHFQRORJLDGHL/(' Rumore inquinamento 8QDOWURDVSHWWRLPSRUWDQWHQHOO¶DPELWRGHOODVRVWHQLELOLWjqTXHOOROHJDWRDOWUDQVLWRGHOOHDXWR'HFLGHUHGLODYRUDUHVXOODULGX]LRQHPDVVLPD del passaggio di macchine è sicuramente una scelta importante che aderisce a certi principi. Non si tratta solo di una scelta contro l’inqui­ QDPHQWRDWPRVIHULFRPDDQFKHDFXVWLFRIDWWRUHTXHVW¶XOWLPRFKHLQFLGHQRWHYROPHQWHQHOODFRVWUX]LRQHGHOEHQHVVHUH 9(5,),&$',)/(66,%,/,7$¶'(//263$=,2 Lo spazio di una piazza deve contenere delle pratiche legate al quotidiano, ma dare anche la possibilità di organizzare eventi, spettacoli, PDQLIHVWD]LRQLDOVXRLQWHUQR'HYHSRWHUVLULHPSLUHHHVVHUHFDSDFHGLXQVLJQL¿FDWRDQFKHTXDQGRqYXRWD6XOODWRDHVWQHOJLDUGLQRGHL FHGULqSUHYLVWRXQXVRTXRWLGLDQROHJDWRDOODVRVWDDOO¶LQFRQWURDOJLRFDUHDOORVWDUH'DYDQWLDOWHDWURHDOPXQLFLSLRPDDQFKHGDYDQWL DLUHVWLGHOIRUREL]DQWLQRVLSRVVRQRSUHYHGHUHGHOOHPDQLIHVWD]LRQLDOO¶DSHUWRODSLD]]DSXzHVVHUHDOOHVWLWD6XOODWRHVWGHOWHDWURVLSXz prevedere che i locali si espandano all’aperto, portando alla piazza una certa vivacità di vita. ,1',&$=,21,',35()$77,%,/,7$¶'(*/,,17(59(17,3523267, 5LVSHWWRDXQ¶LQGLFD]LRQHGLSUHIDWWLELOLWjO¶DVSHWWRVXFXLSLVLSXzLQGDJDUHLQTXHVWDIDVHQRQqWDQWRTXHOOR¿QDQ]LDURGDWDO¶LQGHWHU­ minatezza del progetto, ma quello temporale. Si prevedono diverse mosse del progetto eseguibili in tempi diversi, ma ognuna conclusa in se stessa e apportarice di un miglioramento. Ovvero si immaginano diverse fasi che lavorano per sommatoria in modo che anche se non si realizzano tutte l’intervento non rimane “incompleto”. Una prima fase prevede la costruzione del “giardino dei Cedri Libanesi”, e dei EDVDPHQWLGHJOLHGL¿FLSXEEOLFLXQDVHFRQGDIDVHSUHYHGHODFRVWUX]LRQHGHOVXROR>@ODSHGRQDOL]]D]LRQHGHOO¶DUHDHODGH¿QL]LRQHGHO VLVWHPDGHLSDUFKHJJLXQDWHU]DIDVHSUHYHGHODULVLVWHPD]LRQHGHOEDVDPHQWRGHOODPRVFKHDHO¶DOODFFLDPHQWRFRQLOSDUFRGHOOH0XUD Bizantine. Tutte le espansioni esterne all’area di progetto, ma che insieme a questo costruiscono un sistema centro possono avvenire in tempi ancora successivi e essere organizzate in fasi diverse . 113 3.13 European Capital of Culture 2020 Eng. Sibylla Zech, Arch. Regina Lettner, $UFK*LWWL'RUWVWDWWHU $UFKDHRORJLVW*DEULHOOH.UHPHU 8UEDQ(QJ+HOPXW.RFK Artists Mario Tercziz and Raoul Bukor ,/,5,$648$5(&8/785('855(6086(802)02'(51$57 Iliria Square is a Mirror of contemporary history. Iliria Square shows many different faces. 'HSHQGLQJRQ\RXUYLHZSRLQW\RXDUHFRQIURQWHGZLWKWKHSROLWLFDOGHFDGHVRIWKHWKFHQWXU\ ,/,5,$648$5(,1027,217+(,/,5,$175$0'XUUHV±5LQDV7LUDQD /LJKWUDLOV\VWHPVDUHYHU\VXFFHVVIXOLQVROYLQJWUDI¿FSUREOHPVDQGKHOSIXOLQXSJUDGLQJFLW\FHQWUHV7KHJURZLQJ FRQXUEDWLRQRI'XUUHVDQG7LUDQDQHHGVDQHIIHFWLYHDQGDWWUDFWLYHUDLOV\VWHP8VLQJWKHH[LVWLQJUDLOZD\V\VWHPLQ the megalopolis as a basis, a light rail system shall be developed, that uses the normal railroad tracks outside the ci­ ties, but within the cities it serves the concentrations of inhabitants, commercial services and points of interest directly. New tram systems all over Europe and America show mobility management for the city of the future. The rail system can be implemented step by step: ([WHQVLRQRIWKHWUDFNVLQ'XUUHVIURPWKHUDLOZD\VWDWLRQWRWKHFLW\FHQWHUDQGWKHOHLVXUHDUHDRQWKHVHDVLGH 2. Upgrading of the existing railway system, implementing an attractive timetable with frequent and fast light rail trains 3. Extension of the tracks in Tirana from the railway station to the university / stadium &RQVWUXFWLRQRIDEUDQFKOLQHWR5LQDVWRFRQQHFWWKHDLUSRUWGLUHFWZLWKWKHFLW\FHQWUHVRI'XUUHVDQG7LUDQD ,/,5,$648$5(,19,7$/5(/$;$7,2175$)),&$1'75$1632570$1$*(0(17 The existing road network was built step by step in the last decades and does not comply with the present needs and WKHJURZLQJURDGWUDI¿F,WLVQHFHVVDU\WRWKLQNDERXWDQHZGHVLJQRIWKHURDGQHWZRUNDQGDFOHDUIXQFWLRQDOVWUXFWX­ re. A new urban trunk road shall be built between the square near the railway station and the port entrance. The road VKDOOIROORZWKHERUGHURIWKHKDUERXUDQGWDNHRYHUWKHWUDI¿FWKDWGRHVQRWGLUHFWO\WDUJHWWKHFLW\FHQWUH7KHPDLQ IXQFWLRQRIWKHH[LVWLQJURDGQHWZRUNLVWRVHFXUHWKHDFFHVVLELOLW\RIWKHFLW\FHQWUH7KHUHVKDOOEHQRWUDI¿FWKURXJK WKHFHQWUHVRLWLVXVHIXOWRFUHDWHORRSVDQGRQHZD\VWRDYRLGWUDQVLWWUDI¿F7ZRORRSVVHUYHWKH,OLULD6TXDUH7KH loops are connected with a one way street between the Bashkia and the palace of culture. Parking space shall be allocated close to the Bashkia and near the palace of culture. '855(6±&<&/,1*&$3,7$/2)$/%$1,$ 'XUUHVLVDFLW\ZLWKDQRSWLPDOVL]HDQGEHVWVXLWHGWRSRJUDSK\IRUF\FOLQJ7KHUHLVDELJSRWHQWLDOIRUF\FOLQJDQG replacing short trips by car. A new axis for cyclists shall be created from the railway station via Iliria Square to the sea side. This axis is part of a new Transalbanian Cycle Trail along the coast, which will be a huge attraction for tourism. &\FOLVWQHHGVHSDUDWHGSDWKVLQURDGVZLWKKHDY\DQGIDVWWUDI¿F,QWKHFLW\FHQWUHF\FOLVWVXVHWKHQRUPDOURDGV 7KHVHURDGVDUHFDOPHGWRDVSHHGRIDSSUR[LPDWHO\NPSHUKRXU'XUUHVZLOOEHDQHZFDSLWDORIF\FOLQJLQ$OEDQLD DIWHU6KNRGUD DQGLQDFRXSOHRI\HDUVPD\EH'XUUHVLVWKH¿UVW ,/,5,$648$5(/,1.,1*9,6,216'855(6(8523($1&$3,7$/2)&8/785( 7KH&LW\RI'XUUHVKDVEHHQDFXOWXUDOVLWHWKURXJKRXWWKHFHQWXULHV7KHFLW\KDVEHHQNQRZQE\PDQ\RWKHUQDPHV LQGLIIHUHQWODQJXDJHVGXHWRLWVYDULHGFRORXUIXOKLVWRU\LQFOXGLQJWKH*UHHNQDPHV(SLGDPQRV ǼʌȓįĮȝȞȠȢ DQG '\UKDFFKLRQ ǻȣȡȡȐȤȚȠȞ WKH/DWLQ'\UUDFKLXPWKH%XOJDULDQȾɪɚɱWKH2WWRPDQ7XUNLVK'ÕUDoDQGWKH,WDOLDQ'X­ UD]]R:H¿QGWUDFHVDQGLPSUHVVLYHPRQXPHQWVIURPWKH$QWLTXHXSWRWKH2VPDQ(PSLUHDQG\RXQJHUDUFKLWHFWXUDO periods like art nouveau and modernism. Iliria Square will connect the past with modern times. The green arena gives VSDFHIRURSHQDLUH[KLELWLRQVRIVFXOSWXUHVODQGDUWDFWLRQDUWRUPXOWLPHGLDLQVWDOODWLRQVWKHWLPHOLQHZDONLQJSDWK FRQQHFWVDUFKDHRORJLFDOPRQXPHQWV DPSKLWKHDWHUURPDQEDWK ZLWKSUHVHQWDQGIXWXUHSODFHVRIDUWDQGLQWHUHVW WKH'802$±'XUUHV0XVHXPRI0RGHUQ$UWDYLWDODQGVWURQJLFRQIRUQHZ'XUUHVDWWUDFWV7RXULVWVDQG$UWLVWVIURP DOORYHUWKHZRUOG,OLULD6TXDUHDVDSODFHIRUDUWDQGFXOWXUDOHYHQWVLVWKHFRUHDFWLYLW\IRU'XUUHVWRDSSO\VXFFHVVIXO­ ly for the award “European Capital of Culture”, e.g. in the year 2020. Starting in 1985 with Athens, European Capital of Culture event has always been a highly popular and successful annual feature. It has a growing cultural and socio­ economic impact by the numerous visitors it has attracted and a lasting and sustainable impact on the city’s long­term cultural, economic and social development. The European Parliament agreed to continue the action of until at least 2019, with the designation of two European Capitals of Culture each year. The European capital of culture is a golden opportunity to show off Europe’s cultural richness and diversity, and all the ties which link us together as Europeans. 114 115 3.14 New Sheshi i Lirise (QJ)UDQFHVFR7HVWD (QJ)HGHULFD3RPSHMDQR (QJ)DELR'HOO¶,VROD We have started from the concept of urban quality seen as a dynamic relationship of all the elements connected to the revitalization of an area, together with other elements inserted in the context in which the area exists. The quality of a regeneration intervention is also measured by its ability to become a factor of primer and improvement of a wider and more balanced urban development. Based upon these considerations we have developed our project to the revitali­ ]DWLRQRI,OLULD6TXDUHLQ'XUUHV7KHSURMHFWZDQWVWRLQFUHDVHWKHYDOXHRIWKHSDVWLGHQWLWLHVDQGDWWKHVDPHWLPHLW DLPVWRLQWHQVLI\WKHWRXULVWDQGHFRQRPLFÀRZRIWKHFLW\WKURXJKWKHFUHDWLRQRISDWKVZKLFKLGHDOO\DQGPDWHULDOO\ reconnects the historic and archaeological monuments underlining their importance inside the urban tissue. Conside­ ring that a city with adequate public spaces can promote development, civil cohabitation, communication and social gathering, security and participation, we have decided to realize inside this sight new public spaces for socio­cultural and recreational outdoor activities, paying also attention to the economic aspect. Therefore we have tried to under­ stand the space “square” taking into account the old meaning of the term: place of trade and of mercantile activities, in this way we have reserved an area on the west side of the square to be dedicated to a public market. The cultural revitalization of the place is also done through the use of archaeological sites ,such as the amphitheatre DQGWKH)RUXPXVHGWRKROGFXOWXUDOHYHQWVLQWKLVZD\WKHVHVLWHVZRXOGQ¶WEHRQO\PRQXPHQWVWREHREVHUYHGEXW also to be lived. The environmental quality is pursued through the preservation and the improvement of the public urban green. Con­ sidering a policy of full use of the available areas which minimizes the urban expansion, that have already speculated LQWKLVFLW\ZHKDYHGHFLGHGQRWWRLQVHUWDGGLWLRQDOEXLOGLQJVLQVLGHWKHVTXDUHEXWWRLQWHQVLI\WKHJUHHQVSDFHV placing on the east side of the site a green area to act as a separé between the main road and the other important DUFKDHRORJLFDOVLWHRIWKHFLW\WKHWKHUPDOEDWKVDQGRQWKHZHVWVLGHLQIURQWRIWKHELJPRVTXHDJUHHQDUHDWKDWFDQ EHFRPHD¿OWHUWRWKLVDUHDRIFXOWSURWHFWLQJLWIURPWKHVTXDUH The creation of a water surface in the centre of the square is an integral element of the project since it makes the microclimate of the urban city mild, and its steps made of blocks of natural stones offers an alternative space to relax. 7KHWUDI¿FFRQGLWLRQVZHUHUHVROYHGSD\LQJPXFKDWWHQWLRQWRWKHVXJJHVWLRQVRIWKHFLW\PDSFRQYH\LQJWKHPDLQWUDI­ ¿FWRWKHHDVWVLGHRIWKHVTXDUHDQGOLPLWLQJWKHDFFHVVRQWKHZHVWVLGHRQO\WRUHVLGHQWVDQGORDGLQJXQORDGLQJ The architectural quality of the project is based upon three plans: ­ The challenge of modernity ,cultural diversity and the new lifestyle of the citizens. ­ The use of new technologies compatible with the environment and which reassures the saving of the resources ­ The integration and the continuity with the existent , the history of the places and the local features of the territory. It’s indeed the combination of these three aspects which attracts the potential investors and the future users. The technical quality of the project is dictated by the use of simple materials easily available and produced on the site such as wood and local stones. The stone is used in blocks for the main structure of the pathways, and the square blocks of stones are put together and sunk in the most various way to create slopes which can reach a maximum of 50 cm and they form natural seats for the users. The ledges of wood cover these blocks giving elegance and plastic continuity. The water surface is obtained digging the soil only 160 cm and reusing soil materials to bring the paving to the same level of the pathways. The square paving is made of plates of natural stones put together in a casual way, sometimes interrupted by little green spaces, in order to distinguish from the vehicular mobility spaces. The pre­feasibility of the project can be reached through a cooperation between public and private subjects. The task of gathering the parts is due to the public sector in order to incite the participation and to coordinate the common work, SURPRWLQJ¿VFDODQG¿QDQFLDOLQFHQWLYHVWRDOOWKHSDUWVLQWHUHVWHGLQWKHUHYLWDOL]DWLRQ7KHSULYDWHVHFWRULQWHUYHQLQJ GXULQJWKHSURFHVVZLWKSUR¿WDLPVVKRXOGEHDEOHWRLQWHUSUHWWKHPDLQJRDOVRIWKHUHJHQHUDWLRQ,W¶VLPSRUWDQWIRU WKHFRQFOXVLRQRIWKHSURMHFWWKDWDJRRGUHODWLRQVKLSEHWZHHQWKHSXEOLFDQGWKHSULYDWHOHDGVWRWKHGH¿QLWLRQVRI the programs that pursues the urban and architectural quality of the works in project. These are the reasons why the municipality and some private subjects of the place such as banks, entrepreneurs and tourist companies that should WDNHDGYDQWDJHDQGSUR¿WIURPWKHFRQVWUXFWLRQRIWKHSURSRVHGSURMHFW 116 117 3.15 Con Sheshi Temporary $UFK/RUHQ]R3LJQDWWL0RUDQR$UFK)HGHULFD2WWRQH $UFK0DUFR9RGRWWR8UEDQ3ODQQHU5REHUWR0DVFDUXFFL $UFK(ULF+DOGHQE\/DQGVFDSH$UFK6DVKLPLQH0DVXL C. Cellucci, S. Gruosso, P. Liguori 7KHUHGHVLJQIRU,OLULD6TXDUHLQ'XUUHVLQWURGXFHVDQGIRUFHVWRDGGUHVVVRPHEDVLFDQGLPSRUWDQWEURDGLVVXHV WKDWJREH\RQGWKHVSHFL¿FSXUSRVHRIWKLVFRPSHWLWLRQ6RPHLVVXHVQRWVSHFL¿FDOO\LQDJLYHQRUGHDUH +RZDQHZGHVLJQIRUDSXEOLFVSDFHPXVWUHODWHLWVHOIWRWKHQDWXUHRIWKHSODFHWRLWVFKDUDFWHULWVKLVWRU\LWV heritage, to its most intrinsic social, cultural and religious values and, mostly, how all these different aspects can come together into a new proposal. ­ What is a public space in our contemporary society, how a public space should be lived in and used, what is the role WKDWSXEOLFVSDFHVKDYHZLWKLQWKHXUEDQDQGVRFLDOVWUXFWXUHRIWKHFLW\DQG¿QDOO\KRZWKH\FDQHPELG\DQGUHSUHVHQW the “civitas” of a city . +RZDFRQWHPSRUDU\LQWHUYHQWLRQGRHVUHODWHLWVHOIWRVLJQL¿FDQWDQGFXOWXUDOO\GLYHUVL¿HGDUFKDHRORJLFDODQGDUFKL­ tectural remains and mostly how a contemporary design is able to activate a new life, a new economy, a new set of activities within a public space that is sorrounded by ruins. After an extended discussion within the group, we tried to distill into a LOGO a series of important concepts that were able to give answers, totally or partially, to some of the previous issues. The Logo is: VWDQGVIRU&21',9,6,21&2(;,67(1&(&211(&7,21&2+$%,7$7,21 :HIHOWWKDWWKHVHZHUHDSSURSULDWHFRQFHSWVWRUHVSRQGWRWKHH[WUHPHO\ULFKDQGGLYHUL¿HGFXOWXUHRI$OEDQLDDQGRI 'XUUHVV$OEDQLDLVWKSODFHZKHUHWKH&21',9,6,21EHWZHHQFXOWXUHVLVDUHDOLW\ERWKKLVWRULFDOO\DQGDWWKHSUHVHQW moment. it is the place where the COEXISTENCE between different religions makes the present Albania situation very interesting and possibly a model for ethinical and religious coexistence in the rest of europe. After many years of socil and political isolation, Albania is also the place for future and important CONNECTION with other cultures and RWKHUFRXQWULHV:HEHOLYHDQGKRSHWKDW$OEDQLDZLOOKDYHPRUHDQGPRUHDVLJQL¿FDQWDQGNH\UROHLQWKH$GULDWLF (XUR5HJLRQWRJHWKHUZLWK,WDO\6ORYHQLD&URDWLD0DFHGRQLDDQG*UHHFH,WLVDOVRWKHSODFHRI&2+$%,7$7,21 RIGLIIHUHQWUDFHVDQGSHRSOHRIGLIIHUHQWHWKQLFEDFNJURXQGPDNLQJDRWRI$OEDQLDDQH[WUHPHO\ULFKDQGGLYHUVL¿HG society, with people coming from East and Central Europe, from the Balkans, from the islamic world and from North Africa. As of the countries facing the mediterranean sea Albania is also a country that has witnessed the development of ZHVWHUQFLYLOL]DWLRQV$V)%UDXGHOKDVLQDYHU\HYRFDWLYHZD\GHVFULEHGLQKLVZULWLQJVWKH0HGLWHUUDQHDQLVQHLWKHU a void nor an absebce. The mediterranean is a positive space, it is the space of the encounters, of the movements, of the trades, of the connections, of the integration among different cultures, languages and heritages. Albania has always been part of it and now, with all the rights that it deserves, it wants to participate and be involved with (CON) this geo­political entity. VWDQGVIRU38%/,&63$&(RU$*25$)25803/$7($&$0323,$==$ 6+(6+UHSUHVHQWVLQWKHPRVWVLPSOHDQGSRZHUIXOZD\WKHFRQFHSWRISXEOLFVSDFH,Q'XUUHVDQGQRWIDUIURP /LULD6TXDUHDUHSUHVHQWDOOWKHPDLQVSDFHVRIKLVWRU\7KHUHLVWKH*UHHN$JRUDWKH5RPDQ)RUXPWKH%\]DQWLQH )RUXPDQGWKHUHDUHDOVRUHPDLQVDQGHYLGHQFHVRI2WWRPDQDQG7XUNLVKVSDFHVVWUXFWXUHVDQGDUWLIDFWV$WDODWHU moment and following the reconstruction after the earthquake of 1926, Liria Square acquired the important role of being the key node between the historic city and the contemporary expansion. Then, over the years Liria Square was surrounded by different public, religious, administrative and cultural buildings, making out of it the political and cultural core of the city. at the same time, it has always been a key point for all the veicular and pedestrain mobility throughout WKHFLW\JLYLQJWRLWDVLJQL¿FDQWFHQWUDOLW\IRUWKHFLW\RI'XUUHV 118 Iliria square is thus the place wehre the ³FLYLWDV´RI'XUUHVKDVEHHQUHSUHVHQ­ ted. Now it must become even more the PRGHUQDJRUjWKHPRGHUQ)RUXPWKH modern “piazza”. It is the place of the LGHQWLW\RIWKHSRSXODWLRQRI'XUUHVLWLV the place that represents the history of the city, the complexity of its culture and society, the coexistence of the different populations and religions. liria also stands for Liberty. We thus belive that the proposed vision for the space should be the combination between the representation of the “civitas” af the place and the desire for freedom. 7KHORJRVWDQGIRU&217(0325$5< RU75$16)250$%,/,7<)/(;,%,/,7< 5(9(56$%,/,7< :HEHOLYHWKDWDQ\&217(0325$5< intervention in such an historical layered context has to embody the principle of being 7(0325$5<DQGWKXVQRWRFFXS\WKH VSDFHSHUPDQHQWO\DQGDOORZWUDQVIRUPDWLRQ7KHSULQFLSOHRIEHLQJWHPSRUDU\DOVREULQJVDORQJWKHQRWLRQRI)/(;,%,/,7<VXFKWKDW DQ\LQWHUYHQWLRQKDVJUHDWSRWHQWLDOWRWUDQVIRUPLWVHOILQWRGLIIHUHQWFRQ¿JXUDWLRQVDQGXVHVDQG¿QDOO\RI5(9(56$%,/,7<VXFKWKDWDQ\ LQWHUYHQWLRQFRXOGEHEURXJKWEDFNWRLWVLQLWLDOVWDWXV:HDOVREHOLHYHWKDWWKHVXFFHVVRIDSXEOLFVSDFHVLVUHÀHFWHGLQWKHDFWLYLWLHVWKDWLW FRQWDLQV,WLVWKXVLPSRUWDQWWRHQYLVDJHDODUJHYDULHW\RIDFWLYLWLHVDOORIWKHPEHLQJFRQWHPSRUDU\EXWDOVRWHPSRUDU\DQGÀH[LEOHDVZHOO as reverible and transformable. Important activities in a public space are those that encourage social interaction, culture, entertainment and leisure. At the same time a public space needs commercial activities such as markets, shops, cafès and restourants that will reinforce the public use of it and will create the needed commercial stratum that any historical or contemporary public space needs. 675$7(*,&9,6,21 7KLVSURSRVDOSUHVHQWWZRVWUDWHJLF9,6,216FRQFHLYHGDWWZRGLIIHUHQWVFDOHV 7KH¿UVW is a strategy at the city scale, encompassing a larger picture of the city of durres. This strategy wants to connect the major public parks and green areas of the city. This proposal gives an important role to the historical axis of Rruga Epidamos will become the main pedestrian and commercial green connection between the waterfront and the park connected with it, the city centre and the proposed large Park of the Walls that extends itself behind the ancient castle towards north­west. This will create a continuous and consistent URBAN *5((16<67(0IURPWKHZDWHUIURQWWRWKHFLW\FHQWUHDQGEH\RXQGLW7KHQRUWKZHVWVLGHRIOLULDVTXDUHLVWKHQVHHQDVDQH[SDQVLRQRI this Green System, a green backdrop for the public space that contains and connects all the major historical, archaeological and present SXEOLFEXLOGLQJV7KHYHLFXODUWUDI¿FLVFRPSOHWHO\GHURXWHGWRZDUGVWKHHDVWHUQSDUWRIWKHFLW\SDVVLQJWDQJHQWLDOO\RQWKHHDVWVLGHRI Liria square. The second VWUDWHJ\LVPRUHVSHFL¿FDOO\UHODWHGWR/LULDVTXDUHDQGLWVVXUURXQGLQJVSDFHV7KLVSURSRVDOZDQWVWRFRQWUDVWWKHHQFORVHG rectangular perimeter of the square and suggest an expansion of the two longer (eastern and western) sides. This is achieved by stretching linearly the two boundaries of the space and extending beyond their borders the elements of the public space. This is done on the western VLGHE\FRQQHFWLQJWRJHWKHUDOOWKHDUFKDHRORJLFDOUHPDLQVWKHPRVTXHDQGWKHSXEOLFEXLOGLQJVLQVLGHDJUHHQVSDFHWKDWZHFDOO7+( $5&+$(2/2*,&$/3$5.DVRUWRIXUEDQEXIIHUWKDWVWUHFKHVIURPWKH5RPDQ7KHDWUHWRWKH%\]DQWLQHIRUXP2QWKH(DVWHUQVLGHWKLV will be achieved by condensing all new activities under a colonnade or arcade/ green/canopy that serves, at the same time, as a longitudinal connection and an urban buffer. 352-(&7'(6&5,37,21 )ROORZLQJWKHWKUHHFRQFHSWVHDUOLHU described which have been synthesized in the logo, the project is here presented following a sort of tripartite organization: 7KH$UFKDHRORJLFDO3DUN7KH6HVK 7KH6TXDUH 6SDFHIRUDFWLYLWLHV 1. The Archaeological Park is seen as the SODFHRI&21',9,6,21ZKHUHKLVWRULFDO social and religious values are shared and connected together. The Archaeological Park takes the eastern section of Liria square developing itself on the soft chan­ ge of level between the square and the base of the Mosque. At the urban scale, this Park is seen as an extension of the ODUJH85%$1*5((16<67(0WKDW 119 streches from the waterfront until the Park of the Walls along Ruga Epidamos. This park extension contains and connects together a series of existing historical and archaeological buildings with some of the most important public and institutional buildings. At a smaller scale, the park is seen a longitudinal connector, a visual buffer and an important presence of nature. The Park is seen as an organic entity, with more plants and local vegetation elements, organized in different green terraces, with stairs connecting towords the upper levels (the Mosque) and public paths parking the different archaeological and institutional buildings. The Park has also other programs. Circular spaces covered by metal open structures contain activities such as small concerts, events, performances, open­air exhibitions, etc. This circular spaces are covered with a metal mesh where plants and vegetation will grow and water nebulizers could be used during the summer. This will provide a set of small “cool rooms” that will create a favorable microclimate for the hot summer days. 2. The Shesh (The Square)LVWKHSXEOLFVSDFHRIFRQWHPSRUDU\'XUUHV,WVFHQWUDOORFDWLRQDQGLWVQRGDOUROHZLWKLQWKHXUEDQVWUXFWXUHRI WKHFLW\JLYHWRWKLVSODFHDSULPDU\LPSRUWDQFH0RUHRYHUWKHSUHVHQFHRIVLJQL¿FDQWEXLOGLQJVERWKIURPWKHSDVWDQGIURPWKHSUHVHQW give to this square a symbolic value that other public places do not have. Liria square represents the historical and political memory of 'XUUHVDQGWKLVFKDUDFWHUKDVWREHSUHVHUYHGDQGUHLQIRUFHG7KHSURMHFWLQWHQGVWRPDLQWDLQWKHVTXDUHHPSW\IURPIXQFWLRQV,WZLOOEH DYRLGLWZLOOQRWFRQWDLQSHUPDQHQWREMHFWVRUSURJUDPVLWZLOOQRWKDYHDVSHFL¿FVWUXFWXUHDQGLWZLOOQRWEHRUJDQL]HGIRUDQ\VSHFL¿F HYHQW,WZLOOEHWKHPRGHUQDJRUDIRUXPVTXDUH,WZLOOEHWKHVSDFHIRUWKHFROOHFWLYHPHPRU\DQG³FLWLWDV´RI'XUUHVDQGWKHVSDFHZKHUH the population will gather for daily circumstances and exceptional events. The only elements that are laid on the surface of the square are hypothetical archaeological trenches covered with glass or water that will possibly show ancient remains that are under the surface of the square. These trenches are seen as possible marks for trasversal connections between the two sides of the square, extending themselves WRZDUGVWKHDUFKDHRORJLFDOSDUNDQGWRZRUGVWKHHDVWHUQVLGHRIWKHVTXDUH+HUHWKHWUHQFKHVEHFRPHODUJHUDQGUHFXSHUDWHVRPHOHIWR­ ver spaces inside the urban fabric. These residual spaces become new gardens, possibly all self contained, as places for and leisure. Each of these “hortus conclusus” should become a natic garden, with plants and spices that will refer to the literranean culture. 3. The space for activities The eastern part of liria square is the part that is more connected to the present urban life of the city and thus the one that should contain QHZDQGFRQWHPSRUDU\DFWLYLWLHVDQGSURJUDPV$WWKHVDPHWLPHWKLVLVGHLVWKHRQHWKDWQHHGVPRUHVSDWLDOGH¿QLWLRQ&LWL]HQVRI'XUUHV must be attracted to Liria square also by new commercial activities, events, temporary markets, shops, cafes and restaurants, etc. The public life of a public space is also about socializing, shopping and entertaining in a civilized context. These function must be seen as tem­ SRUDU\DQGPXVWPDLQWDLQDFKDUDFWHURIÀH[LELOLW\DQGUHYHUVLELOLW\2XUFRQWHPSRUDU\VRFLHW\LVYHU\IDVWDQGVXEMHFWWRTXLFNFKDQJHVDQG transformations. The space for activities is thus considered as a public armature that perimeters Liria square in its eastern side. Making a reference to the public colonnade that was planned in the scheme done by L. Carmignani, the project proposes a green arcade/ canopy on the eastern side of liria square. This arcade/canopy could be seen as a simple roof, but also it could contain under it activities such as bars, restaurants, market stands, newspaper stands, etc. All these objects must be considered as temporary and conceived in such a way that could be easily dismantled. The arcade/canopy will have a green roof (possibly decorated by an artist/landscape architect) that is seen as a natural element of the square but also as a ecological device. Purched through the canopy, there are palm trees and also metal structures that support photovoltaic panels. This arcade/canopy will thus also operate as an ecological armature and create, as such as possible, clean energy, but mostly re­present the needed consciousness towords an urban ecology. 3.16 Forum $UFK(WWRUH'H/HOOLV$UFK*LDQOXFD%X]]OL(QJ9HQDQ]LR3UR]]L Archaeologist Jessika Romano, Landscape Arch. Alessia Brignardello 3('21$/,==$=,21( Per esaltare la vocazione della piazza come area centrale della città e riconoscerne il valore aggregativo e identitario, è indispensabile che essa venga interamente pedonalizzata. Una volta pedonalizzata, piazza Iliria troverebbe un na­ turale collegamento con il corso principale e gli isolati del nucleo antico ad esso prospicienti. E formerebbe con esso una vasta isola sottratta alla pressione del caos urbano e all’inquinamento acustico ambientale. $5&+(2/2*,$85%$1$ /DSUHVHQ]DDUFKHRORJLFDqO¶HOHPHQWRSLVLJQL¿FDWLYRHTXHOORSLWUDVFXUDWRGLSLD]]D,OLULDQRQDFDVRODTXHVWLRQH SRVWDGDOOHDUHHDUFKHRORJLFKHqTXHOODGHOORURFRQ¿QDPHQWRLQXQUHFLQWRFKHHVWUDSRODDOFXQLJUXSSLGLRJJHWWLGDO UHVWRGHOWHUULWRULRDELWDELOHHOLVRVSHQGHLQXQDGLPHQVLRQHTXDVLVHQ]DWHPSR$QFKHVHLOWHPDSURJHWWXDOHqGLI¿­ cile e rappresenta ancora una questione irrisolta in molte città europee, l’obiettivo è quello di estendere le campagne GLVFDYRHUHVWDXURDUFKHRORJLFRHGLLQVHULUHLUHVWLDQWLFKLQHOÀXVVRQRUPDOHHTXRWLGLDQRGHLSHUFRUVLXUEDQL9LVWDOD nascente vocazione turistica delle città, sarà opportuno prevedere un itinerario di visita guidata che metta in relazione IUDORUROHDUHHDUFKHRORJLFKHFRQ¿QDQWLFRQODSLD]]D 5,&26758=,21('(//(48,17(7($75$/, Il senso di incompiutezza dello spazio che si percepisce oggi è dovuto principalmente alla indeterminatezza dei lati OXQJKLGHOODSLD]]D/DTXLQWDYHJHWDOHqXQRGHLWHPLSLVLJQL¿FDWLYLGHOSURJHWWRUHVWDXURDPELHQWDOHGHOO¶LQWHUD FROOLQDSRWHQ]LDPHQWRDPSOLDPHQWRGHOODFRSHUWXUDDUERUHDULGLVHJQRGHOSUR¿ORGHLWHUUD]]DPHQWL 122 3.17 Carpets $UFK3LHU3DROR%DOERGL9LQDGLR$UFK0DQOLR9HQGLWWHOOL Arch. Maurizio Imperio, Arch. Paolo Micalizzi, Arch. Alfredo Passieri, Adriano Caracciolo, Simone Capra, Luigi Rebecchini, Sonila Zhezha 7KHLVVXHRIUHYLWDOL]LQJ,OLULDVTXDUHLQ'XUUHVGHDOVZLWKWKHXUEDQKLVWRU\RIWKLVVSHFL¿FVLWHZKHUHDVWUDWL¿FDWLRQ of archaeology, past urban structures and recent ones coexist without “talking” to each other. This is the image of the VTXDUHWRGD\DQRYHUVL]HGFRQMXQFWLRQRIURDGVZKHUHWKHPDLQSXEOLFEXLOGLQJVWKHUHVLGHQWLDODQGRI¿FHWRZHUV the mosque and a few leisure activities are located. The important green areas, and the archaeological sites on the borders are episodes that are not lived as part of the square today. CARPETS &DUSHWVGH¿QHDSODFHZLWKRXWWKHQHHGRIZDOOVWKHSODFHLVZHOFRPLQJ&DUSHWVFDQEHDUUDQJHGDFFRUGLQJWRQH­ eds, they invite you to rest, to talk, to meet. They become a representative space for each one of the public buildings around the square. The new Iliria square has a contemporary architecture language that “talks” to the archaeological stratus, to the representative buildings around and to the green systems. The square is intended to be the place ZKHUHSHRSOH¿QGHDFKRWKHUWDONVWD\$SODFHWRUHGLVFRYHUWKHWUDFHVIURPWKHSDVWDQGOLYHWKHHQHUJ\RI'XUUHV today. /$1'6&$3(¤*5((1%(/7 The area taken into account has precious green elements. The aim of the design is to preserve and link them with a QHZDUFKDHRORJLFDOJUHHQSHGHVWULDQZDON7KHQHZSURPHQDGHVWDUWVDWWKH%\]DQWLQH)RUXPZLWKWKHJUHHQDUHDVRI the Culture Palace, follows the west side of the square offering insights to the archaeological “carpet” and continues XSWRWKH0RVTXHJUHHQSRGLXP)URPWKLVSRLQWWKHSDWKFDQIROORZWKHZDOOVXSWRWKHFDVWOHDQG.LQJ=RJ¶VYLOODRU lead to the new access of the Amphitheatre. 02%,/,7< 7RLPSOHPHQWWKHGHVLJQWKHJHQHUDOPRELOLW\VFKHPHKDVEHHQFKDQJHGWRFDQDOL]HWKHPDLQYHKLFXODUWUDI¿FRXWRI WKHVTXDUHDUHD7KHVTXDUHEHFRPHVDSHGHVWULDQDQGOLPLWHGWUDI¿FDUHD)RUZKDWFRQFHUQVWKHUHODWLRQEHWZHHQ pedestrian and driveway areas, by following the indications provided in the competition documents, we designed the HDVWHUQDUHDRIWKHVTXDUHIRUWKHYHKLFXODUWUDI¿FWKHRSSRVLWHVLGHVLWXDWHGDORQJWKHLPDJLQDU\OLQHWKDWOLQNVWKH URPDQDPSKLWKHDWUHDQGWKHFLUFXODUIRUXPKDVDOOWKHFKDUDFWHULVWLFVWKDWPDNHLWVXLWDEOHIRUWKHSHGHVWULDQXVH furthermore this area can be used for archeological purpose, as stated before, and for the creation of a park, thanks DOVRWRWKHSUHVHQFHRIWKHOLWWOHKLOORQZKLFKWKHPRVTXHUHVWVWKLVVLGHLVVXLWDEOHIRUWKHFRQVWUXFWLRQRIDSHGHVWULDQ DUHDZKHUHWKHDUFKHRORJLFDO¿QGV¤OLNHLQWKHDUFKHRORJLFDOLPDJHVE\3LUDQHVL¤LQWHJUDWHWKHULFKQHVVRIWKHYHJHWD­ tion and of the orography. (&2120,&$/)($6,%,/,7< The revitalization of Iliria Square is part of the renovation process that the historical center and the entire city of 'XUUHVLVJRLQJWURXJK7KHQHZ6TXDUHQRZDQGUHWKLQNLQJWKH+DUERU¶VZDWHUIURQWDUHDLQWKHIXWXUHZLOOSOD\D strategic role in attracting citizens, tourism and business activities in the area. The following chart shows a preliminary DSSUDLVDOWKDWPHDQVWRJLYHD¿UVWJHQHUDOLQGLFDWLRQDERXWWKHFRVWVRIEXLOGLQJPDWHULDOVDQGZRUNVRIRXUSURSRVDO FDOFXODWHGRQDSDUDPHWULFEDVLV)ROORZLQJWKHÀH[LEOHQDWXUHRIWKHSURMHFWWKHGLIIHUHQWWKHDUHDVGHQRPLQDWHG “carpets” have been calculated as a percentage of the overall surface of the square, independently of their locations. 7KHHVWLPDWHGWRWDOFRQVWUXFWLRQFRVWLVDURXQG(XURVDQGZDVGHGXFHGIURPRI¿FLDOSULFHOLVWVDQGE\WKH comparison with other projects that share the same functional and technologic features. 6867$,1$%,/,7<$1'3$57,&,3$7,21 Modern towns feature more and more urban and architectural spaces that citizens do not feel as their own, althou­ gh they live in them. Many new spaces, even if they have a relevant aesthetic value, are often seen as something disconnected from the image of their own urban landscape. Often local communities can’t settle in the new image of WKHLUFLW\ERWKLQDQDHVWKHWLFDQGIXQFWLRQDOVHQVH7KLVPHFKDQLVPQRXULVKHVDVHQVHRIQRQ¤EHORQJLQJ%HVLGHV WKLVWKHHDV\FLUFXODWLRQRILGHDVDQGRIWHFKQRORJLHVWHQGWREULQJWRDÀDWWHQLQJRIWKHZRUOGWR$WRS\ $XJq and Turri, 1996), to a world in which geographical and cultural variety don’t exist. But how can we acknowledge peo­ SOH¶VGHPDQGVLQWKHGH¿QLWLRQRIWKHLURZQODQGVFDSH",WLVQ¶WDQHDV\WKLQJDQGZHPXVWVWUHVVWKHSRVVLELOLW\DQG capability of listening to these communities. The answer is to be found within the debate on the enforcement of the (XURSHDQ/DQGVFDSH&RQYHQWLRQZKLFKVWURQJO\PDJQL¿HVWKHUHOHYDQFHRIORFDOJRYHUQDQFHEDVHGRQWKHPDQDJH­ PHQWRISDUWLFLSDWLRQSURFHVVHVZKLFKDUH¿WIRUDPRUHDZDUHVRFLDOFRQIURQWDWLRQDQGIRUWKHSURGXFWLRQRIDFXOWXUH suitable to rebuild identities of places. Our project criteria are focused on environmental and ecological sustainability. 7KHSURMHFWSURFHVVLQJKDYHWREHKDQGOHGLQWKHIROORZLQJSDUWLFXODUDVSHFWVIRUZKDWFRQFHUQVWKH¿QDQFLDOEDFNLQJ of the proposal and of any possible further extensions of the project we suggest the use of both public and private 123 resources, with the involvement of bank foundations, which are particularly concerned in subjects related to the preservation of the historic and archeological heritage, as it occurs in this case. The contribution of private resources and sponsorships can LQVRPHFDVHVUHDFKDQDPRXQWDEOHWRIXQGPRUHWKDQRIWKHFRQVWUXFWLRQFRVWV 7KHWHUULWRULDOODEUHSUHVHQWVWKHULJKWFXOWXUDOWRROWRFDUU\RXWSDUWLFLSDWLRQDQGDUHDOVRFLDOO\¤VKDUHGSODQQLQJ 7KDQNVWRDUHDODQGSURJUHVVLYHLQYROYHPHQWRIORFDOFRPPXQLWLHVLQWKHVLWHVUH¤LGHQWL¿FDWLRQSURFHVVLWLVSRVVLEOHWRHODERUDWHSODQV accepted and felt as their own by the people. The techniques are now consolidated (from interviews with stakeholders, with questionnaires distributed to various social classes and age, the municipal forum and so on.) And that is why we prefer not to provide a single project solution but we think of various options to be submitted the evaluation of citizens. This will be the leitmotif of our participated planning process for Iliria Square . The architect, coordinator of a multidisciplinary groups oriented to the environmental, economic and social sustainability of the projects, must provide his technical capabilities to the community, in addition to the desirable artistic talent, taking care to design, however, new places. 124 3.18 Sundials Arch. Christian Coop, Arch. Thoma Papa &RPSOHWH'HVLJQ7HDP6WXDUW:DONHU$QGUHZ:HOOV ,//<5,$1.,1*'20'855(6µ,/,5,$¶648$5( 7KHUHDUHYHU\IHZFLWLHVWKDWFRXOGEHFRPSDUHGWR'XUUHVZKHQ\RXFRQVLGHUWKHLQÀXHQFHWKDWKLVWRU\KDVKDGRQDSODFH7UDFHV of different eras, architectural styles, cultures, wars, natural disasters, political systems are uniquely overlapped in the layers of its history. 9,6,21 Our main goal has been deciphering the complexity of these layers and addressing all the assets the Square enjoys in order to create a clear and admirable space. The Square will be the new brilliant image of a city in motion. It will respond to the multitude of needs the city asks for, from the simple everyday use to the monumentality of great events. The Square will become a landmark that celebrates every quality this city has to offer, from archaeology and traditional architecture to the simple pleasures of enjoying OLIHLQ'XUUHV $1$/<6,6 We have investigated: 7KHDUFKDHRORJLFDOSUHVHQFHVXUURXQGLQJWKHVLWH7KHLGHQWLW\RIWKH6TXDUH,QKHULWHGDUFKLWHFWXUHDQGIHDWXUHVRIWKHXUEDQ WLVVXH$GHWDLOHGVWXG\RIWKHVRFLDOEHKDYLRXURIWKHORFDOV$QDO\VLVRIWKH0DVWHU3ODQVIRUWKH6TXDUH,QWHUYLHZVZLWKDUFKDHROR­ gists, historians, locals We have discovered: %XLOGLQJVDQG/DQGPDUNVDUHQRWDGGUHVVHG7KHG\VIXQFWLRQDODQGXQUHDGDEOHVSDFH7KHGHVHUWFLW\FHQWUHLQDKRWVXPPHUGD\ /DFNRIVKDGRZVZDWHUVXUIDFHVDQGDWWUDFWLRQV&RQÀLFWEHWZHHQSHGHVWULDQVDQGWUDI¿F$VSDFHWKDWODFNVWKH0HGLWHUUDQHDQ VSLULWWKHFLW\GHVHUYHV1RSOHDVXUHRIDSXEOLFVSDFH1RHPSKDVLVHRQWKH3XEOLF:DON WKHPDLQHYHU\GD\HYHQWLQ'XUUHV $3352$&+ ,OLULD6TXDUHZDV¿UVWJHQHUDWHGDVDQRSHQVSDFHDGMDFHQWWRWKHPDLQJDWHRIWKH2OG&DVWOH7KLVJDWHZDVWKHOLWHUDOPDQLIHVWD­ WLRQRIWKHFKDUDFWHURI'XUUHVDVDFURVVURDGFLW\7KHWZRPDLQVWUHHWVPHHWWRGD\LQWKLVSRLQWDVXVHGWRGRWKH%D]DDUVLQWKH 2WWRPDQFLW\7KLVZDVWKHSRLQWZKHUHDQFLHQW(SLGDPQRV ZKHUHWKH,OO\ULDQDULVWRFUDF\OLYHG PHW'\UUDK WKHFLW\RIWKHKDUERXU  )URPKHUH\RXFRXOGVHHWKH$GULDWLF6HDDQGWKHKDUERXUWKHUDPSDUWVRIWKHFLW\WKH$FURSROLVDQGWKHWZRKLJKHVWSRLQWVRIWKH KLOOV9LODDQG6WDQL ZKHUHWKH7HPSOHRI$WKHQDDQGWKH7RZHURI7KHRGRUH&RPQHQHDUHEHOLHYHGWREHORFDWHG <RXFRXOGVHH WKHDSSURDFKLQJYHVVHOVDQGSUREDEO\WKHVWDUWLQJRIWKHIDPRXV9LD(JQDWLD 7+(63,5( Our intention is to evoke the Square’s history by giving back the importance to the spot where the gate was and give to this point the qualities the gate had in the past: The possibility to see the city from there. Positioning the mirrored hexagonal spire where the 0DLQJDWHZDVVHWJLYHVWKHSRVVLELOLW\WRVHHWKHPRVWLPSRUWDQWODQGPDUNVRI'XUUHVPLUURUHGLQWKLVVLQJOHHOHPHQW7KLVPLUURU ZLOOEHFRPHWKHIXWXUHODQGPDUNRI'XUUHVUHÀHFWLQJWKHSDVWRIWKHFLW\,WVKHLJKWPHWHUVUHDFKHVWKHKLJKHVWSRLQWRIWKHKLOO ZKHUHWKH9LOODRIWKH.LQJLV,WVWDUWVZLWKDVHFWLRQRIPHWHUVDQGUHDFKHVDWWKHWRSFP,WZLOOEHYLVLEOHWKURXJKRXWWKHFLW\ EXWQRWLPSRVLQJ,WVVOHQGHUIUDPHUHÀHFWVWKH0HGLWHUUDQHDQVN\ 7+((//,36(6 We borrowed the oval shape of the amphitheatre, oriented and positioned along the commercial road axis. The gesture of the opening ovals naturally brings the Mosque into the Square. The axis of the Municipality perfectly coincides with the one of the Culture Palace. In one hand the perspective of the pattern seems to be generated from the Municipality’s entry and on the other $0RLVLX3DODFHQDWXUDOO\¿QGVLWVRZQSRVLWLRQLQWKH6TXDUH3HUVSHFWLYHLVVKRUWHQHGVLPLODUWR0LFKHODQJHOR¶V5RVHWWHLQ3LD]]D del Campidoglio. 7+(681',$/ Sun, shadow and water are key elements of the city. We want to celebrate these qualities. The Square and the Spire become a single element, the world’s largest Sundial. The positions of the shadow of the Spire in each hour from midday to 6 o’clock coincide UHVSHFWLYHO\ZLWKWKHPDLQD[HVWKH0RVTXHWKHPDLQ6WUHHWVDQG¿QDOO\WKHODVWVKDGRZLVVHWRQWKHUXLQVRIWKHROG&ORFN7RZHU We intend to use the natural slope of the landscape to turn the garden on the Southern part of the Ramparts in an open air Cinema. $VZHOOLWZLOOEHDQH[KLELWLRQVSDFHIRUORFDODUWLVWVDQGVWXGHQWVIURPWKHQHDUE\)LQH$UWV6FKRROµ-DQ.XNX]HOL¶7KHVWHSVWKDW lead to the Amphitheatre are redesigned after the project of the University of Parma. In one hand these steps project the Amphithe­ atre directly into the Square and on the other, the main axis of the boulevard is projected right in the centre of this entrance. (9(176 7KH3URPHQDGH7KHPXOWLIXQFWLRQDOVSDFH7KHDUFKDHRORJLFDOZDON7KH0RVTXH*DUGHQV7KH&ORFN7RZHU*DUGHQ 126 127 3.19 In between Arch. Marino Maria Giacoma, $UFK(OHG)DJX$UFK%HVQLN$OLDM $UFK6RWLU'KDPR(QJ'ULWDQ6KXWLQD MAPPING An initial exploration of the site shows a strong complexity of urban, cultural and natural phenomena, projected WRZDUGVWKHQHHGRIDSURFHVVRIWUDQVIRUPDWLRQDFKLHYDEOHWKURXJKDPDSSLQJRISODFHV7KHLGHQWL¿FDWLRQRIVRPH ZHDNDVSHFWVDOVRDOORZVD¿UVWDSSURDFKWRWKHQDWXUDOFKDUDFWHUVORFDOL]HG 85%$1675$7(*< The landscape, intended as the relationship between natural context and the community living in it, is the starting point of the project, the central theme around which our strategy is developed. Liria square appears as bazaar in which, in Gianni Celati’s words, “groups of objects organize themselves according to a oating taxonomy, not accessi­ ble through the logic of a classication...”, an environment full of fragments assuming a meaning only by standing in it together and relating to each other. In the plan of the square the natural, man­made, urban and residential landscapes live in a well established balance, generated by the very presence of those mixed fragments. The current city center (the perimeter outlined for the intervention) is a discontinuous system, characterized by disordered elements, and it is spatially a very articulate place in which cultural, historical, archaeological and natural aspects coexist. The presence of the gap on the west side emphasizes the break between two parts of the city: the hill and the horizontal plane of the square.The break is even more complicated by the presence of an important road. The idea is to create a “urban­na­ tural” area which will belong both to the district and the city at large: a new topography to concert the dierent natures of the place, thus becoming a space where to socialize. Signs, symptoms and traces have enabled us to understand that the revitalization of this area can be achieved while maintaining its characters and highlighting the new features, such as added elements that reactivate a process of daily life. 6(&7,216675$7(*< The sections strategy allows us to regain the existing soil and build a new topography. It is our interest to work on the longitudinal section, keeping alive the “urban relations” and the continuous ow between the western and eastern parts of the city, as well as between north and south, without letting viability being a danger, while the longitudinal section puts emphasis on “urban solidity” which modies the original perimeter, the cross section allows us to gain a more evanescent character, creating a mix of complexity and permeability that closely resembles the idea of a natural landscape. The new inclined plans assume the multiple role of constituting the parking building, ensuring the crossing of the trac ow while lying as stalls, with pedestrian and bicycle crossings. The so built topography is characterized by two levels: the rst keeps the current level of the square directing trac ows towards the western side, locating parking lots in strategic places (inside the inclined planes). The second implements plans of dierent matters and consistency that hang like slopes in fronto of the big plane of the square, in ways that dier from time to time: The slope placed on the north takes origin from the Palace of Culture, it is built like a basement, (almost unfolding the entrance steps), an inclined building that hosts in its inside the passage that leads to the north­eastern road and to the new parking. 3$5.6675$7(*< The strategy is to consider those fragments as green spaces that relate to each other to constitute the system of the city park, linked to the great Byzantine walls park. The green fragments will each adopt a special connotation: beco­ ming public rooms where the green itself builds the micro­climate most suited to the activity they are related to. Such as a stop by the shady, a game room for children, cultivation of small crops gardens, testing of fragrant and colorful bushes that change their appearance depending on the season, just like the changing needs of their users. The pre­ sence of available areas, such as that posed to the north­east currently not apt for buildings, gives us the opportunity to place a compact front of trees, carrying out the desired conguration of the square as per the 1942 square plan and creating an area with a micro­climate in its own right. The trees continue their presence, although in a scarce way in the current green plan. )/2:6675$7(*< The vision proposed aims to partly keep the urban plan viability, integrating it with the slow viability. Movements: a key point of the project will be the ability to articulate and organize various types of ows in a safe and regulated way: slow, fast, longitudinal and transverse movements, which will easily allow to cross the archaeological areas and the parks, but at the same time will grant the possibility to concert all the services oered by the city, with its institutional and cultural buildings. 129 131 3.20 Tone of thickness Arch. Wataru Sakaki $UFK0XQHWDND.XERWD$UFK0HJXPL:DLGD CONCEPT The spray of the wave comes from the Mediterranean and attracts inhabitant on the seashore. On the next, That ZDYHKDVFKDQJHGLQWRQHZSHRSOH¶VVWUHDPDQG'XUHVVKLVWRU\VWDUWHG7KHZDYHRI,QKDELWDQWEHFDPHWRWKHQHZ PRYHPHQWZKLFKSRXUVLQWR,OLULDVTXDUH:HGHVFULEHWKHVWUHDPZLWKFLW\FHQWHULQ'XUHVVE\WKHWKLFNQHVV IRJ RQ WKHUHREYLRXVO\)RJWKDWLVWUDQVIRUPLQJDQDVSHFWFRQWLQXRXVO\LQWHQGDVWUDFHRIWKHFLW\PRYHPHQW$QGWKDWEHDXW\ RI)RJIDVFLQDWHVIRUXVE\UHDVRQRIHSKHPHUDOLW\LQ'XUHVV )2* The misty aspect of the plaza which changes every moment prompts public activity, and is returned to the city. The FHQWHUZLWKRXWD¿[HG¿JXUHGUDZVRXWWKHSKDVHRIQHZFLW\IRUDOOPRPHQW ­ Public Mobility In a city, the square with fog provides rest and satisfaction for people. The space isolated from roadway exists with quiet time in daily life. The landscape planned in the center is for prompting people’s activity in order to lying and sitting on street furnitures. ­ Private mobility in weekend New Iliria square shows different aspect of connectivity on weekend, such as in the new central areavarious events DUHRFFXUHGZLWKUHODWLRQEHWZHHQ)RUDQGDPSKLWKHDWHU0RUHRYHURQHRIWKHVWUHHWFRQYHUWVWRSHGHVWUHLQSUHFLQFW and that becomes large square from sea to Iliria Square eventully. ­ Pubilic mobility $QDUWL¿FLDOODQGVFDSHZLWKDKHLJKWRIPZRUNVDVDQHI¿FLHQWEDUULHUZKLFKGHIHQGVWKHVTXDUHIURPWUDI¿FDQG noise of the car. Moreover, relation with cultural heritage of the square come close by moving the car street to the east side, and the space for the life of inhabit is fully secured simultaneously. $UFKHRORJ\DQG&XOWXUDO+HULWDJH 7KHIRJDUHDVGLVWULEXWHGLQWKHVWXG\DUHDSURYLGHVDUWL¿FLDOFORXG)URPQHZ,ODULD6TXDUHWKHSURSRVDOFRQQHFWV network of historical and cultural heritage visually. And new activites discover the importance of archelogy and cultural +HULWDJHRI'XUUHV&LW\ ­ Green Areas and Ecological Landscape ([WHQGLQJWKHFOLPERIWKHKLOO\IURWLQWKH(DVWODQGVFDSHPDQLSXODWHVDQHZ,OOLULD6TXDUH7KLVDUWL¿FLDOODQGVFDSH provides and also preserves rich enviroment such as cultural heritage area and rich green landscape behind the site. %DVLFDOO\WKHRULJLQDOSODQWVRQWKHVTXDUHUHSODFHVWRQHZJUHHQODQGVFDSHZKLFKLVVFKHPHGVXUURXQGWKHDUWL¿FLDO landscape. Therefore the new Iliria Square discribed with surrounding green area wich makes relation betweeen city DQGDUWL¿FLDOODQGVFDSH 7HPSHUDWXUH'LVWULEXWLRQ To consider microclimate, that is one of the most important parts of sustainability, solar radiation level and sunlight le­ YHOZRXOGEHVLJQL¿FDQWHVSHFLDOO\LQVXPPHU(YHQZLWKVPDOOGHQVLW\RIZDWHUVSUD\HGLQWKHDLUZLOOKHOSVKDGLQJIRU a place where people want to sit down and stay for a while to make them feel more comfortable. The analysis results LPSO\WKDWWKLVV\VWHPZLOOEHDEOHWRKDYHWKHVKDGLQJHIIHFWLQDERXWVXQOLJKWOHYHOUHGXFWLRQ7KLVV\VWHPZRXOG EHDEOHWRZRUNDVHYDSRUDWLYHFRROLQJ7KHVSUD\HGZDWHUZLOOEHÀRDWLQJLQWKHDLUDQGORZHUWKHDLUWHPSHUDWXUHVR that people can feel cooler in the place. This system works well in this site where the average temperature is higher WKDQaƒ&DQGWKHKXPLGLW\LVORZHUWKDQaLQVXPPHU3ODQWLQJDWUHHKHOSVIRJJHQHUDWRUWRSURSHUO\FRRO down the square. Also tree works not only as shading device but also as a wind blocking system to prevent from fog scattering. &RQVWUXFWLRQ'HWDLO ,QWHUPVRIVXVWDLQDEOHLVVXHZHFKRVHDORFDOPDWHULDOIRUFRQVWUXFWLRQZKLFKPHDQVHI¿FLHQF\DQGYHUQDFXODU7KH surplus soil discharged from construction are reused as materials for new construction, therefore the scheme is con­ sidered from ecological and economical point of view. The architectural element of fog has not only aesthetic aspects but also environmental factor. It is the shadow shading from direct sunlight, and the environmental system which cools the skin temperature of the warmed air down. With this system of this fog, it can stay outside comfortably even at the GD\WLPHRIPLGVXPPHU)XUWKHUPRUHLWSOD\VDUROHDVOLJKWVKDGLQJDQGWKHOLJKWUHÀHFWHGGLIIXVHO\LQLWLOOXPLQDWHD city at night time 132 134 3.21 Iliria Square /DQGVFDSH$UFK6X]DQ&.HQ]OH $UFKDHRORJLVW.HQ/DZUHQFH 'XUUHVLV$OEDQLD¶VVHFRQGODUJHVWFLW\DQLPSRUWDQWVHDSRUWDFHQWHURIFRPPHUFLDOHQWHUSULVHVFRPPXQLFDWLRQV DQGWRXULVP)RUDFLW\VXFKDVWKLVDJUDQGFHQWUDOVTXDUHLQWKHKHDUWRILWVDGPLQLVWUDWLYHFXOWXUDODQGVSLULWXDO center is an important civic element for its citizens and visitors alike. As in other former communist countries, a grand central square in any Albanian city can be seen as a mean of restoring public life and public spaces in a place where communal gatherings were restricted and communal spaces neglected (Urban Land, August 2008:63). The deve­ lopment of a public space can be a means of confering community identity, fostering civic and national pride, and a means to showcase local customs and arts to visitors. '(6,*1,17(17 The focus of this preliminary planning stage is the central square, with lesser a en on paid to the surrounding areas. The aims of this project are: ­To bring focus and order to the area of the existing central square. To create a space that responds to surrounding buildings and open spaces without being an isolated island that is unresponsive to contiguous areas ­ To create a systematic structure for automobiles and pedestrians/cyclists alike. To provide orderly parking for cars, motorcyles, scooters, and bicycles. ­ To provide a multi­functional space for various activities whether active or passive, large or small, and in all seasons and weather events, day and night 7RSURYLGHDSODFHWRVKRZFDVH$OEDQLDQDUWVDQGFUDIWVDQG/RFDODQGUHJLRQDODUFKDHRORJ\DQGKLVWRU\ ­ To preserve existing landscape areas and plants, to the extent possibl ­ To create a space that respects, to the extent possible, the existing topography, and grading and drainage regimes. To develope a scheme that respects the environment and does not require vast amounts of maintenance, water, or other non­renewable resources. 2UGHU )RFXV The project area currently comprises a centralplaza with water feature and associated landscaping, separated from another plaza by a road. Wide roads and haphazard parking areas create a disorderly space that presents potential hazards to pedestrians, cyclists, and users of small, motorized transportation (i.e., mopeds, motorcycles). This design combines the existing plazas and by reducing the width and amount of roadways, provides a larger public space. The resultant, long square has a linear axis centered on the Bashkia and Palace of Culture, thereby responding to these important buildings. By providing mirrored landscape and hardscape treatments on both ends of the square, the sche­ me affords equal importance to both buildings. The landscape treatment on the southern end of the square makes XVHRIWKHH[LVWLQJSDOPWUHHVDQGÀDJSROHLQWKHPHGLDQWKDWIURQWVWKH%DVKNLD 3HGHVWULDQV $XWRPRELOHV The proposed plan offers a more system order to the pedestrian and automobile network in the project area. By re­roung Shelorja Road along the eastern side of the square and eliminating the road between the two existing plazas, there is a more coherent route for automobiles in and around the square. Additionally, parallel parking spaces on both sides of Shelorja Road and Rr. Tregtare (the road adjacent to the mosque) will replace the random parking areas. This eliminates confusion over where to park, as well as buffers pedestrians on the sidewalks from cars on the streets. Roads of consistent width further reduces confusion for drivers. Clearly demarcated pedestrian crossings are found at intersections, with one mid­block crossing between the Mosque and square. This creates a predictable situa­ WLRQIRUSHGHVWULDQF\FOLVWVDQGGULYHUVDOLNHDVDOONQRZZKHUHWRH[SHFWFURVVLQJV'HPDUFDWLQJWKHFURVVZDONVZLWK paving materials that contrast from that of the road will help signal a change in condition to drivers. Wide sidewalks FDQDFFRPRGDWHSHGHVWULDQVDQGF\FOLVWVDQGFDQEHPDUNHGIRUFODUL¿FDWLRQ5DFNVIRUELF\FOHSDUNLQJDWDOOIRXU corners of the square may encourage this form of transportation, and provide orderly bicycle parking. Multi­functional Space ³$Q\JUHDWVTXDUHKDVDYDULHW\RIVPDOOHUµSODFHV¶ZLWKLQLWWRDSSHDOWRYDULRXVSHRSOH´ 3URMHFWIRU3XEOLF6SDFH website, 2008). This proposal offers a square with various smaller spaces in an a empty to offer wide appeal. The southern portion of the square is suggested as a cafe zone with movable tables of various sizes, covered and unco­ vered, as well as movable vendor carts offering food and beverage. This area could be used by workers or residents in nearby buildings, as well as visitors to the square. This zone is envisioned as a lively area, used throughout the day DQGLQWRWKHHYHQLQJ7KHIRXQWDLQLVDOVRSURSRVHGWREHDOLYHO\DUHDZLWKVSODVKLQJÀRZZDWHU7KLVSODQSURSRVHV to remodel the existing water feature to extend out into the rest of the square. Remodeling the fountain will provide DQHOHPHQWRIWKHSDVWLQWKHQHZVTXDUHWKHIRXQWDLQJLYHVWKHVTXDUHDVWURQJLPDJH)L[HGVHDWLQJLQWKHIRUPRI benches will surround the fountain. Seating will also be available on the western side of the fountain which will be free RIÀRZLQJZDWHU7KHULPVRIWKHRUQDPHQWDOSRROVLQWRZKLFKWKHIRXQWDLQZDWHUZLOOÀRZFDQEHXVHGIRUVHDWLQJDV 135 136 can the “seat walls” enclosing the landscaping on either end of the square. The channels that connect the fountain to the two ornamental pools are shallow, rimless runnels that can be stepped over. No seating is currently proposed under the pavilion, although it is not prohibi­ WHG7KHSDYLOLRQLVHQYLVLRQHGDVDPXOWLXVHVWUXFWXUHWKDWLVRSHQRQWKHVLGHVWRDOORZIUHHÀRZLQJPRYHPHQW7KHZDWHUFKDQQHOWKDW ÀRZVIURPWKHIRXQWDLQWRWKHQRUWKHUQSRROZLOOEHEHQHDWKWKHSDYLOLRQEHFRPLQJDQRSHQFKDQQHODJDLQLQWKHDUHDRIWKHFRQLIHUWUHHV The pavilion could be used for markets, large social gatherings such as music or theatrical events with a temporary stage. Solar panels on the roof are intended to provide energy for pavilion lights, seasonal displays, the light bollards lining the channels, and other electrical ne­ HGV$TXLHWPRUHUHÀHFWLYHW\SHVHDWLQJDUHDLVLQWKH]RQHRIWKHH[LVWLQJFRQLIHUWUHHV FXUUHQWO\LQWKHVHFRQGSOD]D 7KLVDUHDZLOOKDYH changing diurnal shade and sun. Unstructured open spaces comprise the northern portion of the square, with backless benches around the ornamental pool, allowing people to chose which direction they face when seated. $6+2:&$6( The square is proposed as a showcase for Albanian arts and crafts, as well as a place to chronicle the long and storied history of the FRXQWU\DVHYLGHQFHGE\WKHZHDOWKRIDUFKDHRORJLFDOVLWHVLQWKHFLW\$UWFDQEHHDVLO\LQFRUSRUDWHGLQWRWKHVTXDUH¶VFRQVWUXFWLRQ)RU example, lecoping on the inside walls of the water channels or on the fountain can be made by local artisans and exhibit traditional or con­ WHPSRUDU\SDWWHUQV*DPHERDUGVDQGOHPRVDLFVFRXOGEHLQFRUSRUDWHGLQWRWKHVHDWZDOOVRURWKHUÀDWVXUIDFHVWRSURYLGHSHRSOHDUHDV to play together in the square. Artisans could construct benches. Temporary or permanent sculptures could adorn the square, showcasing $OEDQLDQDUWLVWVDQGDGGLQJLQWHUHVWWRWKHDUHD,QWHUSUHWDWLYHERDUGVFRXOGEHVLWXDWHGLQWKHVTXDUHWRSXOOWRJHWKHUWKHKLVWRU\RI'XUUHV which is scatered throughout the city at various archaeological sites. Especially important to highlight would be the sites closest to the square, such as the Roman forum and baths behind the Palace of Culture and the Roman Amphitheater to the southwest of the square. 6LJQDJHWKDWSRLQWVWKHZD\WRDUHDVRILQWHUHVWRXWVLGHWKHVTXDUHZLOOKHOSZLWKZD\¿QGLQJ$OVR,QWKLVPDQQHUWKHVTXDUHH[WHQGVLWVHOI into the surrounding area like the spokes on a wheel. 6867$,1$%,/,7< Every aempt was and will be made to preserve existing green spaces and existing plants in the design and construction process. The de­ VLJQSURSRVHVWRFRQWLQXHWKHWKHPHRISODQQLQJVKDGHWUHHVDORQJWKHVWUHHWZKLFKDGGVIRUPDOLW\WRWKHVTXDUHZKLOHSURYLGLQJEHQH¿WVWR humans and the ecology. Only indigenous or adapted plant materials will be proposed. To minimize cost and resources, this plan proposes to leave the existing grading and drainage and topography of the area as it is today. As such, no extensive excavation will be required to construct this plan. Construction using earthquake resistant methods is important to ensure longevity of the project. The water for the fountain, associated channels and pools is intended to be recycled back through the system via small pumps, to minimize water use. The proposition to use solar panels on the roof of the pavilion to supply energy and solar street lights are other sustainable measures. 137 3.22 Center Green $UFK-RDR$QWRQLR5LEHLUR)HUUHLUD1XQHV $UFK'RPHQLFR&RQDFL$UFK&ODXGLD/D6SDGD Arch. Altin Premti, Arch. Tamara Efthimi PRESENT SITUATION $FWLQJRQSODFHOLNHLQWKHFLW\RI'XUUHVLVDOZD\VH[FLWLQJ<RXFDQVWLOOSHUFHLYHWKHVPHOOVKHDUWKHQRLVHVDQG feel the echoes of the voices of the ancient dominations. It’s like travelling in time with open eyes: from Corinzi to 9HQH¤WLDQVSDVVLQJWKURXJK%\]DQWLQHVDQG1RUPDQVDQGDOVR$Q¤JLRLQV7XUNVDQG¿QDOO\,WDOLDQV$ORQJVWRU\ made of fusions of words, habits and costumes. The city, mindful of its past history, appears as a great metropolis, ZLWKWKHHYLGHQWUHOHYDQFHRIWKHDYHQXHVDQGWKHLPSUHVVLYH¤QHVVRIWKHEXLOGLQJV*UDGXDOO\IURPWKHRXWVNLUWV\RX arrive at Illiria Square, because of the value of the widespread city growing slowly as one approaches the centre, and so the project’s area is a point of connection and of reference for several functions: from centrality to archaeological DQGWHUULWRULDOYDOXHVIURPDGPLQLV¤WUDWLYHYDOXHVWRWKHFXOWXUDORQHV,Q,OOLULD6TXDUHDOORIWKHFLW\¶VKLVWRU\LVYLVLEOH 'XUUHV±DFLW\ZKHUH\RXSDVVWKURXJK,OOLULD6TXDUH±DSODFHRIWUDQVLW%HLQJRQO\DSODFHWKDW\RXFURVVGLPLQLVKHV WKHJUHDWSRWHQWLDOLW\RIWKHSODFH,WLVFRQ¿JXUHGDVDFRQFDYHVSDFHSUHVVHGE\WKHVXUURXQGLQJSUHVHQFHVVHYHUDO connections with the surrounding buildings and the natural orography of the ground enclose the space or throw it towards the sea, which results in an important element of the square’s life, identifying itself as the opposite pole of the forum. INTRINSIC ASPECT ,W¶VREYLRXVWKDWWKHGHVLJQKDVWREHFRQ¿JXUHGDVDPDJQHW1RWRQO\DVDVRFLDOHOHPHQWEXWDOVRDVDQHOHPHQWLQ­ WHJUDWHGZLWKLQWKHFRQWH[WSURFHHGLQJZLWKZULWLQJWKHFLW\¶VKLVWRU\DQGSURYLG¤LQJWKHSODFHZLWKDQHQHUJHWLFPDUN 1RZDGD\VWKHPDLQFKDUDFWHULVWLFRIWKHVTXDUHLVLWVODUJHGL¤PHQVLRQIUDJPHQWHGDQGFURVVHGE\ÀRZVRIYHKLFOHV DQGGLVRU¤GHUHGSDUNLQJJURZQWKURXJKIUDJPHQWVRIVLQJOHLQWHUYHQWLRQVRIXUEDQKLVWRU\ZLWKVHYHUDOH[DPSOHVRXW of scale. In that situation the pedestrians are not greeted enthusiastically in the square, indeed they are treated as intruders, and the public space loses its social function. 85%$1675$7(*< The project’s approach to the place is a succession of events. After the individuation of the main connections between the roads and of the most important public spaces, you can isolate and point out the housing structures, existing in WKHDUHD6XF¤FHVVLYHO\\RXFDQKLJKOLJKWWKHSUHVHQFHVQH[WWRVTXDUHDQGWKHUHOHYDQWJUHHQVSDFHV7KHXUEDQ strategy, the beating heart of the design’s idea, departs from the necessity to turn the intervention’s area into a SHGHV¤WULDQVSDFHDODUJHJDUGHQZKLFKDLPLVDJJUHJDWLRQ7KHVSDFHIUHHIURPWKHPHVVRIWKHURDG¶VQHWZRUN ZLOOEHGRP¤LQDWHGE\DV\VWHPFRQVLVWLQJRIDPDVVLIRIWUHHVFRQ¿JXUHGDVDQDWXUDOVROLG1RWDQRSSUHVVLYH VKDGRZEXWOHDI\ULQJVRIOLJKWVÀDVKHVRIVXQ¿OWHUHGE\ZRQGHUIXODQFLHQWIROLDJHV$QHOHJDQWDQGUH¿QHGJDUGHQ KRVWLQJQDWLYHHVVHQFHVDQGDOVRUDUHDQGHV¤WHHPHGRQHV7KHVHDVRQVZLOOFDWFKWKHJDUGHQ¶VGDLO\OLIH7LPHZLOO VKDSHZKDWHYHU0DQSODQWVDQG0DQZLOOEHWKHGLVHQFKDQW¤HGREVHUYHURIDQDWXUDOVKRZ7KLVFHQWUDOPDVVLIRI trees enables the restructuration of this large space into a system of compact areas and empty areas which qualify it, UHFRQ¿JXULQJWKHDUHDVLQIURQWRIWKHPDLQEXLOGLQJVEHVWRZLQJWKHPDQHZLGHQWLW\/DUJHÀDVKHVRIVXQZLOORSHQ XSEHWZHHQIROLDJHVULQJVRIOLJKWVZLOOÀRRGLQDOPRVWFRQIXVLQJDQGGLVRULHQWLQJ<RXH[SHULHQFHWKHVHQVDWLRQRI HQWHULQJDSODFHDQGWKHQHHGWRGLVFRYHULWWRNQRZLWEXWRQWKHFRQWUDU\OLJKWZLWKDOOLWVSRZHUZLOOÀRRGLQWRWKH places just visited. This alternation between light and shadow will reveal on the ground of the square all what happens RYHURXUKHDGV$WWKHVRLOOHYHOWKHPRYHPHQWVRIWKHJURXQGZLOORXWOLQHDGL¤DJRQDOGLUHFWLRQUHODWHGWRWKHWUHHV KLJKOLJKWLQJWKHÀX[HVWKDWZLOOFURVVWKHVTXDUHWKLVGLUHFWLRQZLOOEHLQÀXHQFHGDQGVSRQWD¤QHRXVO\PRGL¿HGE\WKH recovered pedestrian aspect. The base paving would be a covering of stone from the region which would adapt easily WRGLIIHUHQWWRSRJUDSKLFVLWXDWLRQV7KHGLIIHUHQWDU¤HDV±ZLWKVSHFL¿FXWLOLVDWLRQVLQVHUWHGLQWKLVFRQWLQXRXVSDYLQJ ZLOOEHFRYHUHGZLWKPDWHULDOV ZRRGJUDYHOSOD\JURXQGVDIHW\VXUIDFLQJ ZKLFKFRQIHUWKHPVSHFL¿FFKDUDFWHUV7KH new topography with its pleats will draw paving areas on the ground according to the different functions/aims they KRVW±SOD\¤JURXQGEUHDNDUHDVVWUHWFKHVRIZDWHU As a stone in the water thrown into a lake’s quiet waters spreads waves around, the project’s idea, thanks to the individuation of a system including trees and urban furniture, could spread into the surrounding areas, founding a real “modus operandi”. The two systems – massifs of trees and “new topography” ­ will extend with branches towards north and south, establishing a spatial and visual continuity, creating new pedestrian paths, break places that will al­ ORZWKHUHYLWDOL]LQJRIWKHVXUURXQGLQJDUHDV,WZLOOEHLQWHUHVWLQJWRREVHUYHWKHUHODWLRQVKLSVWKDWZLOOEHHV¤WDEOLVKHG EHWZHHQWKHQHZKRXVLQJDUHDVDQGWKHVSDFHVWKHP¤VHOYHV'XUUHV¶URDGVZLOOEHSDFL¿FDOO\LQYDGHGE\PDVVLIV of trees, maintaining the initial concept of “centrality” and at the same time the old “place of crossing” will be a place WRUHPDLQDW7KHVWUHQJWKRIWKLVLGHDLQLWVVLPSOLFLW\EUHDNVLQWR'XUUHV¶SXE¤OLFOLIHWUDQVIRUPLQJDVTXDUHZLWKD ZRRGLQWRDJDUGHQ7KHPDVVLIVRIWUHHVZLOOEHFRPHIHOORZVZLWKWKHSRSXODWLRQWKHSXEOLFVSDFHZLOOEHWKHZLWQHVV RIQHZHYHQWVWKHFRSHQHWUDWLRQRIVRFLDOLQWHUDFWLRQVDQGQDWXUH$JDPHRIOLJKW¶ULQJVDQGRIVSDUNOLQJÀDVKHV VFHQWVWKDWFURVVHGE\WLPHDQGVHDVRQVZLOOWXUQWKHSODFHWKHJDUGHQRI'XUUHVWKHJDUGHQRI,OOLULD6TXDUHLQWR the “green centre” of the city. 138 a b c d e ĂƐƉŚĂůƚ a b c d e /ŶƚĞƌŶĂƟŽŶĂůŽŵƉĞƟƟŽŶĨŽƌƚŚĞZĞǀŝƚĂůŝnjĂƟŽŶ ŽĨ/ůŝƌŝĂ^ƋƵĂƌĞŝŶƵƌƌĞƐ ƉĞĚĞƐƚƌŝĂŶ ĂƐƉŚĂůƚ ĂƐƉŚĂůƚ ĐŽŶĐƌĞƚĞ ƉĞĚĞƐƚƌŝĂŶ ĂƐƉŚĂůƚ ƉĞĚĞƐƚƌŝĂŶ ĂƐƉŚĂůƚ ƐĂŶĚ water ƐĂŶĚ ĐŽŶĐƌĞƚĞ ĐŽŶĐƌĞƚĞ ĐŽŶĐƌĞƚĞ ŐƌĂƐƐ ŐƌĂƐƐ ƐĂŶĚ 02 ŐƌĂƐƐ center green 3.23 Corpo presente 3URI$UFK*LQR0DODFDUQH$UFK'DYLGH*LRULR$UFK*LRYDQQL)XUODQ Arch. Alessandro Tognon, Arch. Antonio Trivellato, Migena Cara, 6WHIDQR)HUUR&LQ]LD6LPLRQL(PDQXHOH6HPSULQL6WHIDQR*DEULHOOL 2%,(77,9,(675$7(*,( Le linee guida che caratterizzano la proposta progettuale nascono dalla consapevolezza del grande valore storico, FXOWXUDOHDUWLVWLFRHGDUFKHRORJLFRWXWW¶RUDSUHVHQWLQHOODFLWWjGL'XUD]]RFRQO¶RELHWWLYRGLULVFRSULUHFHUWLHOHPHQWL SXQWXDOLHVWUDWHJLFLLQYLUWGLXQLQFUHPHQWRIXWXURGHOVHWWRUHFRPPHUFLDOHHWXULVWLFRVXSSRUWDWRGDLQXRYLSURJHWWL infrastrutturali quali il Corridoio 8, che ricalca l’antico percorso romano della via Egnatia attraverso i Balcani, ponendo 'XUD]]RLQSRVL]LRQHVWUDWHJLFDWUD2ULHQWHHG2FFLGHQWH/¶DUHDSURJHWWRFRPHPROWHDUHHSRVWHDLOLPLWLGHOODFLWWj VWRULFDVLFRQ¿JXUDFRPHDUHDFHQWUDOHHDOORVWHVVRWHPSRPDUJLQDOH,OIDWWRFKHHVVDVLDLQJOREDWDDOO¶LQWHUQR GHOQXFOHRXUEDQRQRQQHKDLQDOFXQPRGRPXWDWRO¶LPPDJLQHQpO¶XWLOL]]RqXQOXRJRSXEEOLFRLQGH¿QLWLYDFKH attende una migliore presenza, adeguata al suo importante ruolo di spazio collettivo. Un progetto per questa area UDSSUHVHQWDXQDJUDQGHRFFDVLRQHGLULTXDOL¿FD]LRQHGLXQDLPSRUWDQWHDUHDFHQWUDOHGHOODFLWWjFKHQHFRQIHULVFD XQDVVHWWRXQLWDULRULFRQRVFLELOHHGDOFDUDWWHUHSUHWWDPHQWHFLYLOH,OUXRORGLHGL¿FLLPSRUWDQWLSHUODFRPXQLWjTXDOL il Palazzo della Cultura, la Moschea Grande, il Municipio, la Prefettura, il Castello, in aggiunta ai resti dei monumenti SUHVHQWLQHOO¶DUHDGLSURJHWWRFRPHO¶DQ¿WHDWURURPDQRO¶DQWLFRPDFFHOOXPLIUDPPHQWLGLPXUDEL]DQWLQLLPSRUWDQWL presenze che devono essere di nuovo protagoniste, caratterizzano la piazza principale della città, ma che ora vista la loro eterogeneità storica e formale, sembrano non avere una comune identità che permetta a questo vuoto urbano di HVVHUHDOORVWHVVRWHPSRLGHQWL¿FDELOHHULFRQRVFLELOHPDVRSUDWWXWWR³QHFHVVDULR´/¶LPSRVVLELOLWjGLSURSRUUHXQQXRYR concetto fondativo in un area dalle così forti preesistenze storiche e archeologiche, in linea con le direttive della carta del rischio archeologico della città, strumento indispensabile per qualsiasi tipo di sviluppo urbano, spinge un possibile intervento per rivitalizzare la piazza principale verso un concetto di uso moderno dello spazio urbano. Il nuovo volto GLSLD]]D/LULDVLFRQ¿JXUHUjLQXQDVHULHGLSHUFRUVLFKHVLVYLOXSSDQRDWWUDYHUVROHJJHULGLVOLYHOOLGHOVXRORTXHVWR SHUPHWWHSXUPDQWHQHQGRXQDYLVLRQHG¶LQVLHPHXQLFDGLWXWWRORVSD]LRGLLQGLYLGXDUHVSHFL¿FDWDPHQWHRJQLVLQJROD SUHVHQ]DVLJQL¿FDWLYDGHOODSLD]]DVWHVVD,GXHDVVLFKHVLLQFURFLDQRQHOODSLD]]DSURVHJXRQRQHOOHORURGLUH]LRQL verso altri importanti direzioni, come se la nuova piazza fosse oltre che punto di incontro dei cittadini anche riferi­ PHQWRYLVLYRSHUDOWUHDUHHLPSRUWDQWLTXDOLLOSRUWRHLOFDVWHOORTXHVWLSHUFRUVLLQWHJUDWLQHOODFLWWjVWRULFDV D U D Q Q R caratterizzati da toni tenui, di modo che ne si riscopra uno spirito quasi contemplativo, alla riscoperta di luoghi antichi GLDOWRYDORUHVWRULFR,OQXRYRVSD]LRDQWLVWDQWHLOPXQLFLSLRGH¿QLWRGDXQDJHRPHWULDFKLDUDHUHJRODUHSXzRVSLWDUH VSD]LSHULOPHUFDWRRSHUVFHQRJUD¿HGHGLFDWHDVSHWWDFROLDOO¶DSHUWR4XLOHJHQWLVLWURYDQRROWUHFKHSHUO¶XVRHOH IXQ]LRQLGHJOLLPSRUWDQWLHGL¿FLSUHVHQWLDQFKHSHUTXHOYHURUXRORGHOODSLD]]DFKHRUDVLGHYHULVFRSULUHLOFRQVLGH­ UDUHOHDUFKLWHWWXUHGHJOLHGL¿FLSXEEOLFLGDOSXQWRGLYLVWDGHOVXRFDUDWWHUHSLVSHFL¿FRHFLRqO¶HVVHUHHGL¿FLFROOHWWLYL per eccellenza, riguarda essenzialmente la possibilità di usufruire degli spazi collettivi antistanti e di pensare a questi come percorsi e luoghi urbani in cui le “obbligazioni burocratiche” della vita si mescolano alla casualità e all’impre­ visto dei possibili incontri, garantendo in tal modo a questi luoghi un forte valenza civica e sociale. La ricerca di una nuova identità per piazza Liria rafforza e inventa nuove vocazioni urbane, delineandosi come una essenziale opera di completamento di ciò che abbiamo ereditato dalla storia, anche se alla luce di una nuova idea di città. E’ a partire dal QXRYRGH¿QLUVLGLVWUDGHHSHUFRUVLHGDOODORURSURSHQVLRQHXUEDQDFKHVLSXzGDUHVSXQWRDQFKHDQXRYLLQWHUYHQWL edilizi in sostituzione di certi poco consoni al luogo. In particolari zone della piazza quali quelle nel fronte nord­est, l’in­ trecciarsi di percorsi e di nuove perimetrazioni costituiranno il nuovo impianto della piazza, stabilendo chiare gerarchie HQXRYHSRVVLELOLWjVWUDGHYLVWHFRPHFRPSRVL]LRQHGLHOHPHQWLFKHSUHVHQWDQRDXQWHPSRWUDWWLFRPXQLHYDULD]LRQL QHOULVSHWWRGHLVLJQL¿FDWLFKHHVVLDVVXPRQRQHOSURJHWWR2JJLLOWHQWDWLYRLPSRUWDQWHSHUULVFRSULUHFHUWLOXRJKLVWD nella necessità di utilizzo di certi spazi considerando le nuove dinamiche della società attuale che considera i sistemi LQIUDVWUXWWXUDOLOHJDWLDOWUDI¿FRDOODVLFXUH]]DGLTXHVWLOXRJKLDOODSUHGLVSRVL]LRQLGLVWUXPHQWLDFFHVVLELOLDWXWWLDO verde, con il compito impegnativo di cercare di conservare il fascino di questi luoghi con percorsi di collegamento tra gli HGL¿FLSUHVHQWLFKHWRUQDQRDGHVVHUHVLJQL¿FDWLYLHFKHVDUDQQRDQFRUDSXQWLFDUGLQHGHOODQXRYDGLQDPLFDXUEDQD IL PROGETTO Il progetto per questa piazza ha un carattere spiccatamente urbano: un progetto che nel dare identità al luogo DWWUDYHUVRLOULSULVWLQRGLDQWLFKLSHUFRUVLHDOO¶XVRGHOYHUGHHGLVXSHU¿FLSDYLPHQWDWHGLPDWHULDOLDGHJXDWLDOFRQWHVWR va oltre i problemi contingenti che le aree stesse presentano, attraverso un’operazione chiara e leggibile, capace di ridare anche se per frammenti, una forma alla città che si va lentamente perdendo. L’idea di porre una continuità for­ male alla promenade architectural che partendo dalla roccaforte prosegue attraversando la piazza e oltre, incrociando VSD]LSHULOSDVVHJJLRSURWHWWRGDJOLDOEHULHVFDQGLWRGDDUFKLWHWWXUHDQWLFKHHSLUHFHQWLqXQDWHPDWLFDFKHSHUPHW­ WHDTXHVWLSHUFRUVLGLQRQHVVHUH¿QLDVHVWHVVLPDLQXQFHUWRTXDOPRGRGLDYHUHVHPSUHXQGLUHWWRFRQIURQWRFRQ ODFLWWjHFRQOHVXHDUFKLWHWWXUHYHUHVFHQH¿VVHGHOVXFFHGHUHGHOODYLWDGHOO¶XRPR/HQXRYHDUHHLQXRYLSHUFRUVL avranno la qualità e una caratteristica di vivibilità utili ad accogliere oltre ai residenti anche i turisti che, in un ambiente DGHJXDWRHDFFRJOLHQWHSRWUDQQRDQFRUPHJOLRDSSUH]]DUHOHPROWHDWWUDWWLYHFKHODFLWWjGL'XUD]]RRIIUH8QDSDUWL­ colare attenzione sarà data ai percorsi che interessano l’intorno della Grande Moschea e le mura bizantine, molto 141 142 VLJQL¿FDWLYHSHUFKqFROOHJDPHQWRWUDOD9LOODGHO5H=RJHODSLD]]DXQXWLOHFRQIURQWRGLUHWWRFRQO¶$PPLQLVWUD]LRQHFRPXQDOHGHOODFLWWj potrebbe indicare la strada per un recupero e un riuso di questi percorsi sino ad una piena rivalutazione del parco delle Mura in linea con le indicazioni già fornite dai primi studi già affrontati in merito. Si adotterà quindi una “ricucitura” del tessuto, uno studio di ogni singola parte di questo spazio urbano: solo i tratti comuni quali l’uso dei materiali e del verde si pongono come elementi di unione formale­paesaggistica GLRJQLVLQJROD]RQDLQWHUHVVDWD3RLRJQLIUDPPHQWRDQGUjVLQJRODUPHQWHDQDOL]]DWRFRQVLGHUDQGRODLQHU]LHGHJOLHGL¿FLVSHVVRGLVFXWLELOL che lo caraterizzano, per poi essere restituito alla città con un nuovo ruolo, con un nuovo volto. L’elemento muro che si è pensato nel lato verso la Grande Moschea, “ricuce” di fatto alcuni elementi, legando gli spazi a verde con i percorsi pedonali. Il muro da una parte contie­ QHO¶LQFOLQD]LRQHGHOWHUUHQRFKHVDOHYHUVROD0RVFKHDHROWUHYHUVRLO3DOD]]RQHOODWRYHUVRODSLD]]DLQYHFHVLPRGL¿FDGLPRVWUDQGRVL utile con l’utilizzo di panchine in pietra in appoggio su esso, ospitando pensiline in metallo ove ripararsi in attesa di un mezzo pubblico, a volte aprendosi verso scalinate e rampe, accessibili a tutti. Un approccio analogo nel modo di porsi nel rispetto delle preesistenze, si SXzDGRWWDUHQHOOHDUHHDWWRUQRRPHJOLRGLHWURLO3DOD]]RGHOOD&XOWXUDYLVWHOHLPSRUWDQWLDUHHDUFKHRORJLFKHGHO)RUR%L]DQWLQRHGHOOH Antiche Terme Romane: un nuovo riassetto qualitativo che consideri gli interessi commerciali e turistici ma che non inquini questi monu­ menti con forme inadatte e proposte azzardate, farà in modo che ogni singolo spazio, anche se non quello principale della piazza, possa IRUQLUVLGLXQDLGHQWLWjWDOHGDFROORFDUORHGLQGLYLGXDUORLQPRGRSUHFLVRHQRQSLFRPHXQTXDOFRVDFKHDYDQ]DFKHQRQqFRQVLGHUDWR ,OFHQWURGHOODSLD]]DSHUFKqQRQVLDVRORXQYXRWRXUEDQRGRYUjGRWDUVLGLFDUDWWHULVWLFKHGLÀHVVLELOLWjHYDULDELOLWjGLXVLSXzRVSLWDUHXQ mercato, può accogliere spettacoli e concerti, vi si possono applicare elementi d’arredo come delle pergole nel periodo estivo. La forza GLWDOXQHJHRPHWULHGHOODSDYLPHQWD]LRQHDVVHFRQGDJOLHGL¿FLLPSRUWDQWLHVLVWHQWLHYLGHQ]LDQGRO¶LPSRUWDQ]DGHOOHIDFFLDWHFKHWURYDQR nei vuoti loro antistanti la giusta rilevanza. Il verde domina questi spazi ma senza interferire con gli accadimenti della piazza stessa: alberi DGDOWRIXVWRSDOPHHSLDQWXPD]LRQLDXWRFWRQHUHQGRQRSLSLDFHYROHO¶DWWUDYHUVDPHQWRHODVRVWDSHUPHWWRQRDTXHVWRQXRYRVSD]LR di essere contemplato. Nel lato verso il Palazzo della Cultura, è proponibile, anche con un reciproco interesse tra privati e amministrazio­ ni, la cessione di alcune aree lungo la strada che potrebbero ospitare piccoli spazi per la vendita, in punti strategici e commercialmente DSSHWLELOL4XHVWHDUFKLWHWWXUHGDQRLVRODPHQWHDEER]]DWHGRYUHEEHURPDQWHQHUHXQDDOWH]]DFRQWHQXWDLQOLQHDFRQO¶HGL¿FDWROLPLWURIR esistente. Anche in questo caso un atteggiamento consono che esprima la propria presenza senza urtare le preesistenze, riteniamo debba essere l’unico vincolo per queste uniche aggiunte ad uno spazio urbano in cui comunque già nella situazione attuale si scorgono i principali FRQQRWDWLGLSLD]]DDQFKHVHORVWUDWL¿FDUVLGHOODVWRULDHGHJOLDFFDGLPHQWLHGLOL]LROWUHDJOLXOWLPLVYLOXSSLWXULVWLFLHLQIUDVWUXWWXUDOLFKLHGRQR RUDGLLQWHUYHQLUHHULGH¿QLUHXQRVSD]LRXUEDQRFRVuLPSRUWDQWH &216,'(5$=,21, Con una operazione di riordino e di giuste collocazioni di elementi nelle giuste posizioni, quali zone verdi, panchine, illuminazioni di tipo SXQWXDOHRSUHYLVWHSHUDUHHSLDPSLHVDUjSRVVLELOHVWDELOLUHQXRYHJHUDUFKLHFKHFRQLOWHPSRVLVRQRVPDUULWHTXHVWDFLWWjDQFKH VHFRQVLGHUDQGRRGLHUQLELVRJQLHGXVLQRQSXzSUHVFLQGHUHGDOODVXDVWRULDSLDQWLFDURPDQDHEL]DQWLQDYHQH]LDQDHGRWWRPDQD/D FRQVHUYD]LRQHGLDQWLFKLHGL¿FLRJJLFRQVLGHUDWLPRQXPHQWL GDOODWLQRPRQXPHQWXP ULFRUGR GHYHDQFKHODVFLDUHVSD]LRDGLQL]LDWLYH che permettano di esprimere i nuovi linguaggi dell’architettura moderna che in modo imprescindibile dovranno considerare e sorgere in VLPELRVLFRQODSUHVHQ]DVWHVVDGHOOHLPSRUWDQWLSUHHVLVWHQ]HGHOWHUULWRULRTXHVWHSRWUDQQRFRQLQWHOOLJHQWLRSHUD]LRQLGLDPPRGHUQDPHQWR strutturale e funzionale essere ancora utilizzati, anche con destinazioni varie e differenti. 3.24 MEDIterraneanSTRATA $UFK(WWRUH9DGLQL$UFK&DUOR3R]]L0LOWRQ/LHEHQWULWWGH$OPHLGD%UDJD (QJ9LQFHQ]R6HSH$UFK0DVVLPR'¶$UFDQJHOR Arch. Alessandro Buongiovanni 7RGD\/LULDVTXDUHVKRZVLWVHOIDVWKHUHVXOWRIDQDFFXPXODWLRQRIKHWHURJHQHRXVPDWHULDOVZKRVHVWUDWL¿FDWLRQLQ time has to be interpreted as wealth within a contemporary project capable of building functional and formal hierar­ chies through the declared sequel of choices. That is to say it is necessary to give a new aware role to the surroun­ ding architectures and that today are foreigners one to the other: the town hall, the mosque, the prefecture, the palace RIFXOWXUHWKHUHFHQWPDQ\ÀRRUVEXLOGLQJ,WLVQHFHVVDU\WRHYDOXDWHWKHFHUWDLQDUFKDHRORJLFDOSDWULPRQ\DQGWKH possible recoveries, giving continuity to a poetic route among the ancient remains, which must not feel under pressure IRUWKHSUHVHQFHRIYHKLFXODUWUDI¿FRURILPSHQGLQJROGDQGQHZEXLOGLQJV7KH¿UVWUHTXLUHGRSHUDWLRQLVDGLIIHUHQW DQGLQQRYDWLYHPDQDJHPHQWRIYHKLFXODUWUDI¿FVHSDUDWLQJLWZKHUHLWLVSRVVLEOHIURPSHGHVWULDQSDWKVVXFKDVWKH most recent and important “boulevard” leading towards the harbour, recently paved and well lighted. The square, in RUGHUWREHWKHVLWHZKHUHWRVWD\QHHGV¿UVWRIDOOWREHVHSDUDWHGIURPYHKLFXODUWUDI¿FWREHFKDUDFWHUL]HGE\WKH SUHVHQFHRIDUFKLWHFWXUHVGH¿QLQJLWEXWWREHDEOHWREHLQWHUHVWLQJHQRXJKWREHFURVVHGVXJJHVWLQJPDQ\UHDVRQV to belong it, even only as an absent­minded crossing to reach a different area or to go shopping. We have thought WKDWLQRUGHUWRREWDLQWKHVHFKDUDFWHULVWLFVWKHRQO\FKDQFHZDVWRZRUNLQRYHUODSSLQJVWUDWDGH¿QLQJDVHULHVRI OHYHOVWKHLQIHULRUOHYHORIVWUHHWVSDUNLQJVHSDUDWHGE\DUFKDHRORJLFDOH[FDYDWLRQVWKHLQWHUPHGLDWHOHYHORIFRP­ mercial spaces, capable of evoking the character of “suq” which in the historic documents gives the name to urban DUHDVQH[WWRWKHLQWHUYHQWLRQDUHDDQGQHZH[KLELWLRQVSDFHVWKHVXSHULRUOHYHOWKHVSDFHRIWKHUHDOVTXDUHFDOP sunny and shadowy. The constructional work granting the simultaneous presence of these levels is formed by a slab realized with prefabricated pre­cast concrete elements, resting on the foot of the hill facing the square, at the highest OHYHORIWKHWHUUDFHVOHDGLQJWRWKHPRVTXHDQGWKHSUHIHFWXUHIURPWKHRWKHUVLGHRIWKHIUHHVSDFHWKHVODEUHVWV on pilotis, maintaining the same level of covering and forming a new front towards the least relevant side from the DUFKLWHFWXUDOSRLQWRIYLHZ)URPWKHVODEKDQJVWKHXQGHUO\LQJOLJKWYROXPHZKLFKZLOOORGJHWKHFRPPHUFLDOVSDFHV the contemporary “suq”, characterized by the many entrances and lighting systems. So the slab has the double role of a new ground of the square, at this point completely pedestrian, and of covering of an “underground” world formed by streets, parking, the archaeological park, with openings and lighting systems on the most relevant parts of the ex­ cavations and of the commercial centre. “Living” in overlapping strata is a typically Mediterranean way, if you think of 6DVVLRI0DWHUDDQGWKHLUGHVFULSWLRQLQ³&KULVWVWRSSHGLQ(EROL´E\&DUOR/HYL7KLVVWUDWL¿FDWLRQIXUWKHUPRUHDOORZV the slab to modify at the links with the main architectural artefacts so as to establish direct relationships to grant them new opportunities: you can get to the town hall through comfortable ramps with continuity with the paved path towards the harbour and the ascent towards amphitheatre, which in so doing enters by night the composition of the central space of the city. Towards the palace of culture, whose role is discovered and re­proposed within a formative system changing it into congress centre, from the slab you get through an inclined level, a sort of cavea for performances in WKHRSHQHPEHGGHGEHWZHHQWKHVTXDUHDQGWKHEXLOGLQJWR¿QGZLWKRXWKLGLQJWKHQHFHVVDU\LQWLPDF\IRUWKHDWUH performances or the concentration for a public debate. $5&+$(2/2*<$1'&8/785$/+(5,7$*( Relevant archaeological investigations point out the presence of important Roman and Byzantine remains of the DQFLHQWFLW\LQWKHSURMHFWDUHDLQSDUWLFXODUWKHUHPDLQVRIWKHEDVLOLFD XQGHUQHDWKDQGLQIURQWRIWKHSUHIHFWXUH DQG also remains of hydraulic urban works, such as canals and wall structures. Being the project area intermediate among amphitheatre, spa and forum (or macellum), we believe that an excavation campaign may lead to interesting result. The slab is not only the new ground for a pedestrian square, but it becomes preliminary covering for the excavations, VXJJHVWLQJWKHFRH[LVWHQFHEHWZHHQDUFKLWHFWXUDODQGDUFKDHRORJLFDOFRQVWUXFWLRQVLWHLWDOVREHFRPHVSURWHFWLYH mantle of the ancient remains once they are uncovered with a variety of systems so as to be used also in a tourist way: footpaths, skylights, soil modelling, concrete realizing the tourist itinerary proposed from the Urban Plan for the &HQWUDO$UHDRI'XUUHV2QO\WKHUHDOL]DWLRQRIDQHZJURXQGZKHUHWKHFLW\OLIHÀRZVPD\JUDQWWKHIRUPDWLRQRIDQ DUFKDHRORJLFDOSDUNZLWKDSURJUHVVLYHGH¿QLWLRQDOORZLQJWKHJUDGXDOQHVVRIVWXGLHVDQGGHSWKRILQYHVWLJDWLRQVWKH archaeological city is so integrated to the urban development and is not perceived as a threatening accident. On the walls supporting the base of the hill, cut so as not to cross the excavations, a “scaena­frons” is put up showing the ¿QGLQJVDWUDGLWLRQRI6FKLQNHOYLOODVDQGRIWKHVDFUHGZDOOVE\3LUDQHVL *5((1$5($6$1'(&2/2*,&$//$1'6&$3(&217,18,7< The current arboreous presences in the square area, characteristic of the Mediterranean coast landscape, are quite poor and often down at heel: still they are saved or moved in the same urban sphere. Mainly they are lines of privets and holm oaks and some tall Lebanon cedars, as well as bushes of laurels, privets and pitosfori. New relationships between pre­existing green spaces are obtained thanks to the formation of the archaeological park. The green system suggested above the new built shell tends to realize strength lines relating the green hill spaces between the amphi­ theatre and the mosque and the small interstitial gardens (with archaeological presences) among the volumetries on the opposite side. Thus the square carries out its role of ecological connection between the hill slopes where the city ascend eastwards and the areas occupying the alluvial plain, up to the harbour and coast band. The relationships among bushes, trees and shelters tends to originate a pleasant microclimate in the various periods of the year which certainly characterizes the life of an Adriatic space, strongly inside the Mediterranean, it also forms routes and plea­ sant accesses towards the underlying “suq” and the public building surrounding the free space. 144 38%/,&(9(176$1'287'225',63/$<6 The pedestrian character of the new ground of the square grants its full versatility with relationship to various manifestations LQYROYLQJWKHFLWL]HQVRI'XUUHVDQGWKHLQWHUQDWLRQDOJXHVWVERWKWRXULVWVDQGSDUWLFLSDQWVLQPHHWLQJV7KHVTXDUHDVDSXEOLF place is open up to different valences of religious character (the mosque), civil (town hall, prefecture, conference hall), theatre DQGPXVLFDOFKDUDFWHU)RUWKLVVRUWRIDFWLYLWLHVWKHFDYHDLVHVSHFLDOO\UHFRPPHQGHGJLYLQJQHZDFFHVVWRWKHUHQRYDWHG palace of culture, with the possibility to use dressing rooms and equipments for shows in the open, whereas the indoor shows will take place within the rooms made safe according to security standards and contemporary technologies (acoustics, lighting, informatics). The structural caisson on which the slab rests becomes a long exhibiting space for temporary exhibitions where you can easily get to from the new level of the square. ,17(*5$7,21$1'5((;$0,1$7,212)7+(6855281',1*$5&+,7(&785(6 All surrounding architectures will take advantage of this new international role, especially the palace of culture which will continue to carry out this role at a more adequate level, taking part in the formation of the congress centre and lodging a library­ mediateque structured with contemporary technologies and computerized systems. The hotel is linked to the congress centre WKURXJKDLU\IRRWEULGJHVLWLVWKHRQO\FRPSOHWHO\QHZEXLOGLQJUHSODFLQJORZUXQGRZQYROXPHVDQRSHUDWLRQFRPSDWLEOHZLWK the indications of a B1 zone of the Urban Plan for 145 WKH&HQWUDO$UHDRI'XUUHVUHFHQWO\DSSURYHGIRUHVHHLQJWKHDFFRPSOLVKPHQWRIWKHEXLOGLQJSDWWHUQZLWKLQFRQWUROOHGKHLJKWV7KH mosque and the prefecture will be integrated into the new pedestrian share, making access easy for the most disadvantaged part of the community. All parking are below the new pedestrian mantle, organized in blocks according to various level of use. 38%/,&$1'35,9$7(02%,/,7<675((7)851,785($1'&$53$5.6 The streets that today meet in the square, using its “plafond” as a space “of all work” for the crossing, manoeuvres and stop, are the REMHFWVRIVHOHFWLRQDQGKLHUDUFK\VRDVWRDUUDQJHWUDI¿FFRPLQJWKURXJKDQGPDNHDFFHVVWRSDUNLQJHDV\QHYHUFURVVLQJSHGHVWULDQ paths in the archaeological park nor the pedestrian or mechanical renascent facilities, with special care to make access easy to commercial spaces or to the superior ground for people with handicap or different sensory and psychomotor abilities. The new hierarchy of the streets FURVVLQJWKHLQIHULRUÀRRULQWKHVTXDUHIRUHVHHVDPRUHLQIUDVWUXFWXUDOUROHDQGRIXUEDQOLQNIRUWKHVWUHHWFRPLQJIURPWKHUDLOZD\VWDWLRQ ZKHUHDOVRWKHFRDFKWHUPLQDODQGIHUU\WHUPLQDOPHHWWKHVWUHHWVXUURXQGLQJWKHEDVHRIWKHKLOOWDNHVRQDPRUHORFDOUROHDOORZLQJWKH integration of archaeological spaces, the development pedestrian paths, an increased ecological­landscape continuity. The system of pe­ destrian and cycling crossing of the square, made easy by slightly inclined ramps, becomes the natural accomplishment of the pedestrian ³ERXOHYDUG´UHDFKLQJWKHDUERXUUHFHQWO\SDYHGDQGZHOOOLJKWHGLUUDGLDWLQJ¿ODPHQWVRILPPHGLDWHDQGVSRQWDQHRXVDFFHVVLELOLW\WRZDUGV the amphitheatre and the mosque. (&2/2*,&$/(19,5210(17$/$1'62&,$/6867$,1$%,/,7<2)7+(352-(&7 The theme of the project of an urban space has been faced not only under an aesthetic point of view but also with strong environmental YDOHQFHZKLFKLVIXQGDPHQWDOIRUWKHYLWDOLW\DQGPDQDJHPHQWRISXEOLFVSDFHV¿UVWRIDOOWKURXJKWKHUHQDWXUDOL]DWLRQRIWKHVSDFHVWDNLQJ part in the system, by means of the introduction of water and vegetation on surfaces. The foreseen microclimate, with the new relationships between light and shadow, will offer comfort and will considerably increase the number of people frequenting the square. Beyond the use of systems of electric production with photovoltaic panels put on the shelters or on the coverings of the hotel and congress centre, the entire complex will use passive systems for the control of the microclimate of the various layers forming the square. In view of a reduction of the pollution we foresee a sustainable urban mobility which will enable everyone to have right to move but at the same time will not make worse atmospheric and acoustic pollution, vehicular congestion, accidents. 3.25 An Denken und Verwindung $UFK5REHUWR)RUWH)UDQFHVFR&DPSDLROD Arch. Maurizio Crocco, Eng. Andrea Guardo, Eng. M.L.Rosario Leante, Eng. Roberto Postorino Le intenzioni progettuali illustrate nella relazione, utilizzano una metodologia, sviluppata negli anni in ambito accade­ mico dal gruppo di progettisti, di approccio sistematico alla lettura e comprensione di un territorio, quale che sia la sua dimensione, per cogliere i caratteri distintivi di questo, in ragione del suo spessore storico di relazioni costruitesi nel WHPSRWUDXRPRHDPELHQWH/D¿QDOLWjGLWDOHOHWWXUDqTXHOODGLFRVWUXLUHD]LRQLFRQFUHWHGLWXWHODDWWLYDHVYLOXSSRGHO­ le realtà locali a partire dal patrimonio archeologico, storico ambientale che caratterizza ogni singola realtà, sia nelle VXHHVSUHVVLRQLSLHYLGHQWLFKHQHOOHWUDFFHSLGHEROL &5,7(5,0(72'2/2*,&,$1$/,6,'(//$)250$('(//(75$6)250$=,21,352&(66,',&21)250$­ =,21('(//$&,77$¶/(7785$'(,02'(//,6725,&, /DVWRULDGLXQDPELWRXUEDQRDQDOL]]DWDDWWUDYHUVRLVXRLPRGHOOLVWRULFLGLFRQ¿JXUD]LRQHSHUPHWWHGLFRJOLHUHLOFRP­ plesso spessore storico della forma della città e le caratteristiche di degrado di tali valori, e quindi di individuare alcuni RELHWWLYLVWUDWHJLFLFKHFRQÀXLVFRQRHRULHQWDQROHSUHYLVLRQLGLRJQLIRUPDGLSLDQL¿FD]LRQHHGLQWHUYHQWR ,1',9,'8$=,21('(/'(*5$'2025)2/2*,&2/(7785$'(//$)250$'(//(75$6)250$=,21, /(7­ 785$675$7,),&$7$  Obiettivo principale dell’analisi è comprendere i meccanismi di formazione e trasformazione e i caratteri tipo­morfolo­ gici della struttura urbana, e leggere le diverse preesistenze, nel contesto di un quadro di interdipendenze morfologi­ che e funzionali. La ricostruzione del processo di strutturazione della città permette così di riconoscere i caratteri della VWUXWWXUD]LRQHDWWXDOH,OODYRURVLVYROJHLGHQWL¿FDQGROHVWUXWWXUHDWWXDOLFRPHDSSDUWHQHQWLDIDVLGLVWUXWWXUD]LRQH messe in atto progressivamente dall’uomo: ciascuna fase viene individuata, come sintesi del sistema di vocazioni cul­ turali, economiche, naturali del luogo e del modo di reinterpretare queste, secondo una rinnovata relazione tra sistemi di relazione. L’area oggetto di intervento deve essere esaminata nella successione dinamica dei “modelli”, ciascuno prodotto della strutturazione antecedente e matrice della susseguente. $1$/,6,',$&521,&$,1',9,'8$=,21('(//()$6,6725,&+(('(,02'(//,'¶862 ,OSULQFLSLRGHOODLQGLYLGXD]LRQHGHOOH³IDVL´FRQVHQWHGLFRQFHQWUDUHODULFHUFDVXPRPHQWLSDUWLFRODUPHQWHVLJQL¿FD­ tivi della storia della città e di procedere successivamente alla “descrizione” della fase stessa. Particolare interesse ULYHVWHO¶RSHUD]LRQHGLWHPDWL]]D]LRQHFKHYLHQHRSHUDWDSHUFLDVFXQDIDVHHVVDFRQVLVWHQHOVRWWROLQHDUHORVSHFL¿FR (e tipico) carattere di ciascuna, individuando i caratteri maggiormente distinguibili presenti in essa ed evidenziando altresì gli aspetti di raccordo o di lacerazione che consentono il passaggio da una fase alla successiva. Ciò permette ODOHWWXUDGHOODWUDVIRUPD]LRQHLQTXDQWR³IDVH´GLFDUDWWHUHSUHYDOHQWHPHQWHGLQDPLFRQRQPHQRVLJQL¿FDWLYDGL quella ­ eminentemente statica ­ oggetto della “descrizione”. $1$/,6,6,1&521,&$6295$3326,=,21('(,02'(//,6725,&,$/02'(//2$778$/(7(1'(1=,$/( L’analisi sincronica individua la “forma” attuale e tendenziale (spontanea) del riuso con la sovrapposizione dei sistemi HVRWWRVLVWHPLVWUXWWXUDOLSLVLJQL¿FDWLYLRYYHURLPRGHOOLVWRULFLGHOO¶DQDOLVLGLDFURQLFDUHODWLYLDOO¶DVVHWWRGHOWHUULWRULRH GHOODFLWWjQHOOHHSRFKHGDOODSLDQWLFDDOVLVWHPDDWWXDOH/¶DQDOLVLVLQFURQLFDSHUPHWWHLOFRQIURQWRWUDLUXROLDWWXDOL HOHLQYDULDQWLVWRULFKHGHOODFLWWj VLVWHPLFRQVROLGDWL XQDSULPDYHUL¿FDGLXVLHPRUIRORJLHLQFRHUHQWLFRQOHTXDOLWj formali consolidate dal processo storico. 02'(//27(1'(1=,$/( Il M.T. individua la forma tendenziale ed attuale (spontanea) del riuso del territorio, con la sovrapposizione dei sistemi e sottosistemi, ricavati dalla precedente analisi, al sistema attuale. Questa analisi permette il confronto tra i ruoli attua­ OLHGLVLVWHPLFRQVROLGDWLVWRULFLXQDSULPDYHUL¿FDGLXVRHPRUIRORJLDLQFRHUHQWLFRQOHTXDOLWjIRUPDOLFRQVROLGDWHGDO processo storico 6,*1,),&$72'(/'(*5$'2'(,9$/25,025)2/2*,&, L’individuazione del “degrado morfologico”, nasce come risultato della sovrapposizione delle analisi precedenti, e rap­ SUHVHQWDXQDSUH¿JXUD]LRQHGHLSRVVLELOLLQWHUYHQWLVWUDWHJLFLGLUHFXSHURGHOOHTXDOLWjVWUXWWXUDOLWLSRORJLFKHGHOOHSDUWL che costituiscono l’ambito di intervento. Sono state individuate aree che si differenziano in funzione di tre tipologie di degrado: parziale degrado ­ le qualità tipologiche strutturali di una parte del l’ambito in oggetto sono confuse dall’at­ WXDOHDVVHWWRG¶XVRPDQRQDOWHUDWHGDLQWHUYHQWLVXFFHVVLYLDOWHUD]LRQHWLSRPRUIRORJLFDSUHVHQ]DGLLQWHUYHQWL LQFRHUHQWLFRQLFDUDWWHULPRUIRORJLFLLQGLYLGXDWLGDOO¶DQDOLVL SRVVLELOLWjGLLQWHUYHQWLGLVXWXUDHGLULGH¿QL]LRQHTXDOLWDWLYD GHJOLDPELWL FUHVFLWDLQIRUPDOHSUHVHQ]DGLLQWHUYHQWLFDVXDOLVHQ]DDOFXQDDQDORJLDFRQLFDUDWWHULPRUIRORJLFL (possibilità di interventi a carattere analogico con itessuti ele emergenze storiche). 147 ,1',&$=,21,0(7$352*(778$/, &RQ¿JXUD]LRQHSURJUDPPDWLFDGHOOHSDUWLFKHUDSSUHVHQWDLO PRPHQWRGLVLQWHVL¿QDOHGHOODIDVHDQDOLWLFD6HFRQGRLOPHWRGR strutturale, la parte non è altro che una particolare forma delle WUDVIRUPD]LRQLGRWDWDGLXQDIRUWHVWDELOLWjQHOFDVRGHOODFLWWjVLq realizzata attraverso la costante riconferma del principio di autorego­ lazione, per divenire una forma­modello. &$03,',202*(1(,7¬7,32025)2/2*,&$ Il modello programmatico delle parti rappresenta il punto di passag­ JLRGDOODIDVHSLSURSULDPHQWHDQDOLWLFDGHOODYRURDTXHOODSURJHW­ WXDOHODGH¿QL]LRQHGHLFDPSLGLRPRJHQHLWjWLSRPRUIRORJLFD GHO tessuto edilizio e del verde) attribuisce programmaticamente valori di riconoscibilità via via decrescenti all’ambito della città oggetto dello studio, che nel modello attuale­tendenziale (precedente alle azioni di progetto) si caratterizza per una sostanziale indecifrabilità di forma e di ruoli. 027,9$=,21,'(/352*(772 Benché i singoli elementi costitutivi del contesto urbano di Piazza ,OLULDLQ'XUD]]RQRQSUHVHQWLQRFDUDWWHULVWLFKHGLGHJUDGRPDWHULDOH il luogo in esame presenta, evidenze di criticità. Si propone quindi una lettura del contesto che guardi agli aspetti di degrado “tipo­ PRUIRORJLFR´HUHODWLYHSRVVLELOLVROX]LRQL/¶DWWXDOHFRQ¿JXUD]LRQH della piazza nasce, infatti, dall’impostazione ricevuta nel piano UHJRODWRUHGHOµFDUDWWHUL]]DWRGDVROX]LRQLIXQ]LRQDOLGLUD]LRQD­ OL]]D]LRQHGHLSHUFRUVLSUHYDOHQWHPHQWHFDUUDELOL'DOSXQWRGLYLVWD WLSRPRUIRORJLFRWDOHFRQ¿JXUD]LRQHLJQRUDOHVWUDWL¿FD]LRQLVWRULFKH GHOODSLD]]DUHVHDQFRUPHQRYLVLELOLGDLFUROOLGHOWHUUHPRWRGHOµ 6XOODFRQ¿JXUD]LRQHGHOµVLLQQHVWDDQFKHLOSURJHWWRGHO7HDWUR 3DOD]]RGHOOD&XOWXUDFKHQHJOLDQQLµFRQIHUPDWDOHLPSRVWD]LRQH in maniera acritica. Occorre ora mettere in discussione questo UHWDJJLRGHOµSXUFRQVHUYDQGRHYDORUL]]DQGRQHLVLQJROLHSLVRGL architettonici, per almeno due motivi: ULGDUHDOODSLD]]DOLULDXQVXRVLJQL¿FDWRSUHJQDQWHULVSHWWRDOOD YRFD]LRQHFXOWXUDOHGHOOD&LWWjGL'XUD]]R 2. relazionare lo spazio in oggetto al contesto urbano circostante ULGH¿QHQGRQHLOLPLWLHODSHUPHDELOLWjGHOOHDUHHGLWUDQVL]LRQHGDXQ lato verso la collina a Ovest, dall’altro verso la città nuova a Nord­ Est ed il porto. 5,62/8=,21('(/'(*5$'27,32025)2/2*,&2 Il progetto si pone dunque come strumento di risoluzione delle critici­ tà e, pur coordinandoli in un sistema integrato, individua alcuni ambi­ ti precisi di intervento con opportune proposte progettuali, seguendo i criteri di analisi relativi ai concetti di degrado tipo­morfologico. 7,32',&5,7,&,7$¶3$5=,$/('(*5$'2352*(7729$/2­ 5,==$=,21('(,3(5&256,$5&+(2/2*,&,(&8/785$/, Tale tipo di degrado si individua nella incongruenza fra il sistema GHOOHDUHHDUFKHRORJLFKHHODFRQ¿JXUD]LRQHIXQ]LRQDOHGHOODSLD]]D e degli immediati dintorni. Proposta: ricucitura delle aree archeologiche. Un percorso sensoriale (ed uno sopraelevato) accompagna i visita­ tori (anche con impedimenti) attraverso i principali luoghi di interesse HGHQWURORVSD]LRGHOODSLD]]D'LHWUROD0RVFKHDHOD3UHIHWWXUD giardini tematici sistematizzano il verde in una sequenza di pergo­ le e recinti per la vegetazione. Le “emergenze” ecologiche sono rispettate quasi integralmente. Il parco di margine ingloberà alcuni padiglioni nelle griglie, che costituiranno i centri museali accanto ai reperti. Questi sono importanti per offrire strutture di servizio ma DQFKHLQGRWWRDLSRWHQ]LDOLÀXVVLGLWXULVWL 7,32',&5,7,&,7$¶$/7(5$=,21(7,32025)2/2*,&$ 352*(7725,&21),*85$=,21('(//$3,$==$ /DIRUPDGHOODSLD]]DFRVuGH¿QLWDSHUPRWLYLGLYLDELOLWjFDUUDELOH QHJOLDQQLµHULFRQIHUPDWDGDOSLDQRGHOµVLVRYUDSSRQHDOOH VWUDWL¿FD]LRQLVWRULFKHRFFXOWDQGRQHODSUHVHQ]DHODUHOD]LRQHFRQ la struttura urbana stessa, evidente nella aree circostanti. 3URSRVWDULRULHQWDPHQWRGHOODSLD]]DHULGH¿QL]LRQHGHLOLPLWL 6LLQWHUYLHQHVXLOLPLWLGHOODSLD]]DSHUDQQXOODUOLHULFRQ¿JXUDUOL FRPHYHVWLJLDWUDFFHGLEDVWLRQLRPXULERUGL¿VLFLFKHGLYHQWDQR abitati dal verde e della persone. Lungo tali limiti si concentrano le DOEHUDWXUHFKHVHSDUDQRGDOODYLDELOLWj2FFRUUHUjOLEHUDUHO¶DQ¿­ WHDWURGDJOLHGL¿FLFKHORLQJDEELDQRDSUHQGRORYHUVRODVWUDGDH verso lo spazio della Piazza. Il Municipio è al centro di un duplice, spazio uno frontale ed uno che prima era un “retro” e che si rivolge DOO¶DQ¿WHDWURDDOODFRQWHPSRUDQHLWj/DIRQGD]LRQH5RPDQDOH tracce Ottomane e tutte le vicende storiche della città vengono ULYHODWHGDXQXQLFRVSD]LRHVWHVRROWUHJOLDWWXDOLFRQ¿QLGHOOD Piazza Iliria. Il progetto mira alla decongestione dei margini della piazza, sui tessuti e sulle attuale permanenze architettoniche, DQFKHQRYHFHQWHVFHFRQODULTXDOL¿FD]LRQHGHJOLHGL¿FL³VLQJRODUL´ di pregio e la demolizione coraggiosa del resto. 7,32',&5,7,&,7$¶&5(6&,7$¶,1)250$/(352*(772 ,03/(0(17$=,21('(//$5(7((&2/2*,&$5,&21(66,2­ 1((&2/2*,&$)5$/¶85%$12(/¶$0%,(17(1$785$/( /,0,752)2 /DVWUDWL¿FD]LRQHVWRULFDqLJQRUDWDGDOODFRQIRUPD]LRQHFKHOD SLD]]DHLGLQWRUQLKDQQRDVVXQWRQHOFRUVRGHOµODPRUIRORJLD è difforme dalle tracce della città ottomana, ma si discosta anche GDOSLDQRGHOµFRQHGLOL]LDHSLVRGLFDHVFRRUGLQDWD Proposta: sviluppo dei sistemi su più livelli, agendo anche sull’alti­ metria e su elementi naturali: vegetazione, specchi d’acqua. Lo spazio interno della piazza, e delle sue “appendici” si differen­ zia attraverso lievi movimenti del terreno, che si solleva quasi a mostrare i preziosi reperti. La pavimentazione, nel chiaro­scuro JHQHUDWRGDXQGLIIHUHQWHWUDWWDPHQWRVXSHU¿FLDOHULYHODOD complessità di un tessuto urbano di origine ottomana. I recinti GH¿QLWLGD¿ODULGLDUEXVWLRVHJQLG¶DFTXDVRQROHLPSURQWHTXDVL DEDVVRULOLHYRGHJOLHGL¿FL 6,17(6,'(*/,(/(0(17,&267,787,9,'(/352*(772(35,0(62/8=,21,7(&1,&+( Nuovi limiti della piazza6LLQWHUYLHQHVXLOLPLWLGHOODSLD]]DFRPHJLjGHWWRSHUDQQXOODUOLHULFRQ¿JXUDUOLFRPHYHVWLJLDWUDFFHGLEDVWLRQLR PXULERUGL¿VLFLFKHGLYHQWDQRDELWDWLGDOYHUGHHGHOODSHUVRQH,QXRYLOLPLWLFRQ¿JXUDWLGDOVLVWHPDGHOOHSHUJROHYHUGLGLVHJXLWRGHVFULWWH VRQRDG2YHVWLPDUJLQLRURJUD¿FLGLHWUROD0RVFKHDHOD3UHIHWWXUDDGHVWLOTXDUWLHUHGHO%D]DUDVXGLOPDUJLQHGHOOHDQWLFKHPXUDLQ parte riproposto con un tracciato d’acqua , alle spalle del municipio, a Est sempre dal sistema delle pergole e dei padiglioni. Connettivo omogeneizzante: nuovo orientamento dello spazio urbano/¶LQWHURRULHQWDPHQWRGHOODSLD]]DYLHQHPRGL¿FDWRSULYLOHJLDQGR ODGLUH]LRQHGLYLDGHO&RPPHUFLRLQDFFRUGRFRQODSRVL]LRQHGHOOD0RVFKHD7DOHRULHQWDPHQWRqIRUWHPHQWHHYLGHQ]LDWRGDOVLVWHPDGL pergole verdi e di padiglioni composti secondo una griglia quadrata. Le pergole possono essere realizzate con strutture lignee a sostegno di coperture lignee che fungono da brise­ soleil, da sostegno a rampicanti, da supporto a moduli fotovoltaici che assicurino l’illuminazione pubblica dello spazio. I padiglioni concepiti con struttura analoga a quella delle pergole, potranno accogliere postazioni multimediali, punti LQIRUPDWLYLVXOODVWRULDHOHVWUDWL¿FD]LRQLGHOOXRJRHGHOFHQWURVWRULFRSLLQJHQHUDOH/DYLDGHO&RPPHUFLRDVVHVWRULFRVWUXWWXUDQWH GHOQXFOHRSLDQWLFRGHOODFLWWjGLYHQWDVHJQRRUGLQDWRUHGHOORVSD]LRGHOODSLD]]DHYLHQHLQYHVWLWRGDOO¶LQWHUYHQWRSURJHWWXDOHDWWUDYHUVR un trattamento materiale analogo a quello della piazza e riconnesso fortemente a questa dal segno pedonale del percorso sensoriale di seguito illustrato Ricucitura. Un percorso sensoriale ed uno sopraelevato accompagnano i visitatori (anche con impedimenti) attraverso i principali luoghi di interesse e dentro lo spazio della piazza, questo diviene l’elemento principale di ricucitura dei diversi ambiti e delle diverse emergenze storiche, dal porto sino alla rotonda delle terme romane. L’intervento del percorso sensoriale potrebbe divenire analogico (vedi punto 2.1.1) qualora una campagna di scavi e opportuni studi ne fornissero gli elementi fondativi. Sistema della percorribilità. Pedonale Gran parte dello spazio della piazza viene pedonalizzata. L’ambito del percorso sensibile è integralmente pedonale e lo stesso diventa VRYUDSSDVVRDOODYLDELOLWjFDUUDELOHLQGXHSXQWLLQSURVVLPLWjGHOPXQLFLSLRHGLIURQWHDOWHDWUR9LDGHOFRPPHUFLRO¶DUHDOXQJRODPRVFKHD e la prefettura mantengono una carrabilità limitata. Carrabile. La viabilità carrabile proveniente dal principale ingresso di Nord­Ovest corre lungo il lato Est della piazza in sede separata, leg­ JHUPHQWHVFDYDWD XQPHWURFLUFD ,ÀXVVLGLSHUFRUUHQ]DSDVVDQGRGDYDQWLDO7HDWUR3DOD]]RGHOOD&XOWXUDFRQWLQXDQRVLDYHUVRODFLWWj nuova a Nord­Est, che verso il golfo a levante, secondo anche le indicazioni dell’ultimo piano regolatore. L’ingresso Nord­Est, nel tratto tra la rotonda delle terme e l’ingresso alla piazza, resta naturalmente carrabile anche se la pavimentazione sarà realizzata con materiali in coerenza con il plateau della piazza. 149 3.26 ICON $UFK,JQDVL5LHUD0DV'HVLJQ7HDP$UFK/XLV$ORQVR&DOOHMD Arch. Xavier Olivella, Arch. Cota Cero, Landscape, $UFK0DXULFLR5DPLUH](QYVSHFLDOLVW-RVHSK/DVFXUDLQ+LVWRULDQ(5HJXHLUR The two objectives they want the project are: 1­ The proposal for the new representative square is clean, functional and architectural. Create a great dimension to cultural, recreational, public and political through a single, continuous paved. This is a neighborhood regeneration through this urban intervention to create a new urban order clearing it, giving it life and to link both historic monu­ ments, cultural and administrative buildings in the city. It will generate a dialogue of the monumental hill to the city WKURXJKDVTXDUHWKDWKDVLWVRZQOLIHDQGVWRSEHLQJDSODFHRIWUDQVLW$KRWHORI¿FHVODUJHVKRSSLQJPDOODQGEDUV VKRXOGPD[LPL]HWKLVVTXDUHLQKLVÀDQNWKLVDVWKHOHDVWGH¿QHG,WZLOOEHWKHJDWHZD\WKURXJKWKHQHLJKERUKRRG later this square and pedestrian continuous pavement, connecting all areas until the forum Byzantine in its northern side. It will generate a new dimension in the city. 2­ The vegetation surrounding the monuments must be more permeable and enhanced by some bleachers­ramps and enlightened gardened in length to enhance and make more accessible across the hill. It will be like an extension or continuity between the ancient amphitheater and the new square. Will move the source which will be replaced by a few jets of water in which children can play and collect water at the bottom, next to the passage of cars in front of the new building, as a mirror and barrier. The passage of vehicles through the boulevard Tregtare will be restricted. Access to the square will be produced by the old gate of the large wall that is marked on the pavement and through two large masts of about 20m. The alternative passage of vehicles pass in front of the new building across the street 7URSOLQL7KHQHZEXLOGLQJZLOOÀRDWRQWKHVTXDUHWRDOORZWKHJDUGHQVRIFHGDUVDUHGLVFORVHGIRUWKHERWWRPZLWKWKH QHZERXOHYDUGEHWZHHQWKHROGDQGWKHVTXDUH7KH¿UVWEDVHPHQWÀRRUZLOOKDYHPRUHVKRSVWRGRXEOHKHLJKWIURP the square to allow in case of location of archaeological remains the power to make them visible. In turn the plant will EHVHUYLFLQJWKHQHZVTXDUHDQGEXLOGLQJ7KHIROORZLQJEDVHPHQWÀRRUVLVGHYRWHGWRSDUNLQJ 7KDWLQWXUQZLOOUDLVHWKH¿UVWLFRQRIWKH¿UVWFRDVWDOFLW\DQGSRUWRI$OEDQLDQHDUWKHEXLOGLQJWKDWIXWXUHVKRXOGEH lifted at sea on the same line of the square, next to the city in the northern part of the port and beyond this, to regene­ rate another area with a yacht club and beaches. 150 151 3.27 Iliria Netsqu@re $UFK/XFLD.UDVRYHF/XFDV 0DUFR&ODXGLR&HFHUH7DQLD'DQHOX] 0LFKHOD0DULFFKLR5REHUWR2FHUD(OLVD9ODGLOR 'HVLJQ&RQFHSW&(17(5/,.(&5266,1*32,17±1(7 7KHTXHVWLRQRIWKHUHYLWDOL]DWLRQRIWKHFHQWUDOVTXDUHRIWKHFLW\RI'XUUHV±,OLULD6TXDUH)UHHGRP6TXDUHFRPHV from the role and the importance of the place from its relation with the interventions of urban revitalization carried out by local administrations, but especially from the complexity and exemplariness of the themes that this urban site pre­ sents. All the themes that may be found in the city are there in the square. So, the plan of the square represents an extraordinary chance to put into opportunities and exemplary actions these themes, to try out innovative solutions re­ specting the fundamental urban values of the city, addressed towards the new and symbolic demands looking forward to a reply from the project. The presence of important archaeological monuments makes new opportunity to increase the culture and the economy of the city and its citizens. The square represents a space of functional and symbolic representation of a multicultural society in which there are traces of a rich and complex past and present that is an expression of a various and well­organised community both in life styles and in individual and collective behaviours. 7KLVSURSRVDOFUHDWHVDQHZVWDUWLQJSRLQWIURPWKHSDVWWRWKHIXWXUHUHGH¿QLQJWKHUHODWLRQEHWZHHQWKHULJLGLW\RI the built environment and the fragility of the everyday life. The Iliria Square should be the place where the community ZDQWVWRSUHVHQWLWVHOIIRU\RXQJDQGROG$QRSHQÀRRUZKHUHWKHXQGHUXVHGHOHPHQWVVKRXOGEHUHPRYHGDQGD new pavement can be made to stage the users. It represent the NET with crossing line of white stone between the yellow Albania stone, and it wants to be a sort of topographic connection with the different parts and souls of the city. ILIRIA NET SQU@RE The urban situation of Iliria Square is exceptional. The crossing of important urban and historical traces gives us the departure point to build up our proposal, consolidating the big central avoid as a new platform to be used for a mas­ sive arena and a domestic scale, a NET making the square more livable, increasing the services and facilities to the QHZLQKDELWDQWVRIWKHVTXDUH'XUUHV¶VFLWL]HQV7KHVTXDUHDVDUHVXOWRILWVGLIIHUHQWXVHVKDVQHYHUEHHQFRQVLGH­ red as a whole, being left incomplete throughout the years, so it is in need of a new border, expecially in the western VLGH:HDUHWU\LQJWRLQWHJUDWHWKHPRQXPHQWDOEXLOGLQJVVXFKWKH7RZQ+DOOWKHELJ0RVTXHWKH3DODFHRI&XOWXUH the Prefecture, to the public area with small changes. Our proposal is suggesting a square where every building and its space comes together, to keep public space public. At the same time, the square is brought forward from its belt, its surrounding. The belt is made out of green, shadows and buildings, existing or to be built, negotiating between congestion of the city and the openness of the square, it offers a variety of ways to enter it. At the same time, it will be very important consider the eventuality of new archaeological discoveries, and how to manage the past and the future in the same place. Our idea of the square may possible the introduction of new historical elements, they will underline the grid with more meanings. *5((1$5($6$1'(&2/2*,&$//$1'6&$3(,03257$1&( Our project wants to preserve the green areas of the study area for environmental aims. We suggest to create more JUHHQDUHDDOODURXQGWKHVTXDUHFUHDWLQJDVWURQJFRQQHFWLRQZLWKWKHH[LVWLQJE\SODQWLQJSLQHWUHHVLQD¿QHJULG and between buildings. The trees provide for shadow, for cleaning of the air from the ring road and reducing the sound of the ring road towards the centre. The grid designs all the lines of directions and shadows of people and elements, it makes connections with the sea and the hill, the past and the future, the new buildings. ,17(*5$7,21$1'5((;$0,1$7,212)7+(%8,/7(/(0(176 Our intention has considered the current functions of the square and its surroundings and the urbanistic rules about the spaces and its functions. Our proposal has been using as much as possible everything but adding a new layer of modernity that provokes a new mixture, a new reading of the existing. The square needs a new border, especially RQWKHHDVWVLGH7KHFRQ¿JXUDWLRQRIWKHQHZEXLOGLQJVDFFRUGLQJWRWKHGHVLJQRIWKHQHZSDYHPHQWRIWKHVTXDUH WULHGWREHDVROXWLRQERWKWRGH¿QHDQHZERUGHUZLWKRXWLQWHUIHULQJLQWKHH[LVWLQJEXLOGLQJ2XULGHDLVWRLQWURGXFHLQ the square other public functions as museums and temporary exhibition galleries, auditorium, music rehearsal room, ZLWKUHVWDXUDQWVDGPLQLVWUDWLYHDQGSULYDWHRI¿FHVKRWHO,QWKLVSKDVHZHGRQ¶WVKRZDSUH¤IHDVLELOLW\VWXGLHVEXW we are in contact with companies (real estate) that aim to invest here seriously, even by exchanges between public DQGSULYDWHSURSHUWLHVLQWKHHYHQWRIFRQVROLGDWLQJWKHSXEOLFKHULWDJHHVSHFLDOO\IRUWKHEHQH¿WRIWKHDUHDVRIDUFKD­ eological, cultural, historical and landscape interest, within the more general idea of urban regeneration. 38%/,&$1'35,9$7(02%,/,7<675((7)851,785($1'&$53$5.6 Our proposal has attentively considered the functioning of the square and its urban surrounding according to the SXEOLFDQGSULYDWHPRELOLW\DQGSDUWLFXODUO\WRWKHSHGHVWULDQDQGF\FOHPRELOLW\$ERXWWKHUHJXODWLRQRIWKHFDUWUDI¿F (private mobility), our idea is to put the drive lane only on the east side of the square, so to have more free space for pedestrians and cycle path. On the west side of the square we suggest the public transportation lane, with the tram 152 stop located close to stairs up to the Mosque. Some car park are located in strategic point of the square: beside the Palace of Culture, the 7RZQ+DOODQGWKHWDOOHVWEXLOGLQJRQWKHZHVWVLGHRIWKHVTXDUHEHKLQGWKH3UHIHFWXUHEXLOGLQJDQGDORQJWKHOLQHRIWKHQHZEXLOGLQJV ZLWKVRPHVSHFL¿FFDUSDUNVDUHDIRUVWDWHHPSOR\HHVDQGGLVDEOHGSHUVRQV  (&2/2*,&$/(19,5210(17$/$1'62&,$/6867$,1$%,/,7<2)7+(352-(&7 Our proposals takes care to the ecological matters, considering the effects caused by the possible demolitions, digging, routine or extra­ ordinary maintenances. The project suggestions link to alternative sources of energy, such green energy. Today, photovoltaic systems can be aesthetically integrated in buildings and other surfaces, it’s possible to cover roofs and facades contributing to reduce the energy consumption. Our project intends to use innovative photovoltaic system for the new buildings and for the square energy needs. 153 154 3.28 Urban Kilim Arch. Rossa Atena $ONHW0HVODQL.ORGLDQD(PLUL $UWLVW%ULNHQD6KNRGUD(QJ$UEHQ'HUYLVKDM(UYLQ3DFL 1. The project aims at transformation the existing pubblic square into a symbolic and representative space and instrument of urban marketing. The new space, easily identifable and communicable, also manages to recconect and valorise existing architectural DQGFODULI\LQJWKHFRQÀLFWEHWZHHQGLIIHUHQWÀRZVRIPRELOLW\ YHKLFXODUDQGSHGHVWUDLQ  7KHWDUJHWLVWKDWRIWUDQVIRUPLQJWKH3LD]]D/LULDLQWRDFRQWHPSRUDU\IRUXPDQGV\PERORI'XUD]]R¶VFXOWXUDOUHELUWK 85%$1$1$/<6,6 The Piazza Liria is currently a leftover space, the result of a succession of disconnected interventions and the XQGH¿QHGGHVLJQRIXUEDQVSDFH7KHUHLVQRFOHDUGLVWLQFWLRQEHWZHHQSHGHVWUDLQDQGYHKLFXODUÀRZVDQGWKHIRUP of the square is tied to a 19th centery ide of public space and urban parks that does not valorise or connect the exi­ sting elements of archaeology, government and religion found in the square. The square has lost the identifying and central character appropriate to the main square of a European capital. 7KHFLW\¶VQHZVWUXFWXUDOSODQVKLIWVWKHPDMRUYROXPHRIWUDI¿FWRWKHHDVWVLGHRIWKHVTXDUHPDLQWDLQLQJRQO\D reduced point of vehicular access along the side of the mosque. This separates the level area of the square from the upper area of the mosque and the urban park. An analysis of context and a deep study of current urban planning instruments reveals that the structural design plan SURSRVHVPRYLQJDOOYHKLFXODUÀRZVWRWKHHDVWVLGHRIWKHVTXDUHZLWKDVHULHVRISDUNLQJDUHDVRQWKHRWKHUVLGHRI WKHVWUHHW7KLVOHDYHVDVLQJOHODQHIRUHPHUJHQF\WUDI¿FDQGVHUYLFHIRUWKHHQWLUHVTXDUHXQLI\LQJWKHORZHUDUHDRI the square with the spaces in the upper area around the mosque and the urban park, creating a single system. 7KLVV\VWHPLVFRQQHFWHGZLWKWKHUHFHQWO\FSPOHWHG³ESXOHYDUG´WKDWOHDGVWRWKHVHDDQGDFWVDVWKH¿UVWRXWSRVW and gateway to the future urban park along the city walls. In this way the project proposes to clarify and separate SHGHVWUDLQDQGYHKLFXODUÀRZVZLWKRXWFRPSURPLVLQJWKHLUXVHIXOQHVV7KHUHVXOWLVDQHZSXEOLFXUEDQVSDFHWKDWLV not limited to the rectangular form of the square. +DYLQGH¿QHGWKHQHZVWUXFWXUDOSODQIRUWKHVTXDUHLWLVQHFHVVDU\WRWUDQVIRUPLWLQWRDV\PEROLFDQGUHSUHVHQWDWLYH space that is both easily recognisable and communicable. 7KHFRQÀXHQFHRIPXOWLSOHXUEDQD[HVZLWKLQWKHVTXDUHJHQHUDWHVDVLJQL¿FDQWOHYHORIG\QDPLVPVXJJHVWLQJWKH necessity of experiencing each of these directions within the project. '(6,*1675$7(*< %\UHIHULQJWRWUDGLWLRQDOUXJVNQRZDVNLOLPZHKDYHGHYHORSHGWKHLGHDRIWKH8UEDQ.LOLPIRUWKHH[LVWLQJVTXDUH This model is capable of trasforming this informal and colourness space into an “urban livimg room” that is noth warm and representative: a space of encounter and not only a space of passage. This horizontal space is not intended solely as the level form of the square itself, but refers to the idea of polycentric VSDFHZLWKDUHDVIRUGLIIHUHQWXVHUVSODFHGLQFRPPXQLFDWLRQZLWKRQHDQRWKHUDOORZLQJIRUÀH[LEOHXVHWKURXJKRXW the day and year. The strong iconic quality of the kilim transforms the current square into a symbolic and representative space that is capable of becoming a highly recognisable and easily communicable tool of urban marketing to be used to stimulate cultural tourism by reconnecting and valorising the existing elements of archaeology and DUFKLWHFWXUH7KH8UEDQ.LOLPDGDSWVWRLWVFRQWH[WDQGLVPRGL¿HGE\PHPRU\DQGUHPQDQWVZKLOHVLPXOWDQHRXVO\ WUDV¿JXULQJDQGUHQHZLQJLW7KH8UEDQ.LOLPUHTXDOL¿HVWKHV\VWHPRIYHUWLFDOFRQQHFWLRQVLQWKHXSSHUDUHDQHDU WKHPRVTXH7KLVV\VWHPLVVLPSOL¿HGE\WKHLQWURGXFWLRQRIDVLQJOHVWDLUWKDWDFWVQRWRQO\DVDQHOHPHQWRIYHUWLFDO connection, but a true public space, becoming an appendix of a gateway to the park along the city walls called for in the new structural plan. The space can also be used as an open ­ air theatre for temporary events. 7KHSURMHFWLQFOXGHWKHLQVHUWLRQRIQHZSODQWLQJVDQGWUHHVWRSURYLGHQDWXUDOVKDGLQJDQGGH¿QHPHHWLQJSRLQWVIRU ORFDOFLWL]HQVHQKDQFHGE\WKHLQWURGXFWLRQRIVHDWLQJDQG:,),KRWVSRWV7KHWUHHVDUHSODQWHGLQDKLJKO\UHJXODU manner, almost the ordered version of the more wild vegetation found on the promontory. The regular grid of the trees is interrupted by a void area near The Palace of Culture “Aleksander Moisiu” that can be used for various public events. 7KHUHTXDOL¿FDWLRQRIWKHHDVWHUQVLGHRIWKHVTXDUHLVDVVLVWHGE\WKHFRQVWUXFWLRQRISRO\IXQFWLRQDOEXLOGLQJVWKDW reconstruct and requalify the most abandoned side of the square. At the same time they offer the lower levels the YDULRXVVHUYLFHV EDUVUHVWRXUDQWVERRNVKRSVHWF WKDWWKHVTXDUHFXUUHQWO\ODFNV$VLJQL¿FDQWDPRXQWRIDWWHQWLRQLV focus on the sustainability of the project itself, as demostrated in the use of primary local wood and stone, a practice that stimulates local industries and reduces the ecological costs associated with the transportation of materials. 155 156 )81&7,21$/352*5$00( 7KH8UEDQ.LOLPLVQRWRQO\DSDYLQJGHFRUDWLYHV\VWHPUDWKHUWKDQDWH[WXUHRIVHYHUDOV\VWHPVWKDWGHVLJQVDQGVWUXFWXUHVWKHSXEOLF space for multiple uses. It is made by three systems that working together, achieve the functional integrational that should guarantees a maximum degree of openness and possibilities: the softscape, the hardscape and the temporary scape, within the sustainability issue, GH¿QHWKHFRORXUIXOÀH[LEOHDQGDFWLYHFLW\VFDSH Soft scape: 8UEDQSODQWLQJWUHHVKRUL]RQWDOJUHHQVSDFHYHUWLFDOJUHHQVSDFHJUHHQVSDFHXQGHUVKUXE 5HFUHDWLRQSOD\JURXQGSOD\JURXQGF\FOHWUDFN 3. Water body: interective water feature. Hard scape /LJKWKRUL]RQWDOOLJKWLQJYHUWLFDOOLJKWLQJ 7HFKQLFDOGHYLFHV )XUQLWXUHVHDWLQJVWDQGLQJO\LQJ Temporary scape 7HPSRUDU\H[KLELWLRQHYHQWV DFWLYHVSDFHVORFDWHGLQIURQWRILQGRRUIXQFWLRQVVXFKDVEDUVUHVWDXUDQWVVKRSVGLVSOD\VSDFHVHWF 6RFLDOVSDFHUHOD[ 6XPPHUVKDGLQJ &RPXQLFDWLRQ:,),DUHD,QIRDUHD 157 3.29 Crescere a strati Arch. Santo Marra Arch. Pietro Alessandro Latella Arch. L.M. Giuseppa Polimeni IMPRESSIONI &RQIURQWDUVLHSHQVDUHGLRSHUDUHLQXQFRQWHVWRFRVuFRPSOHVVRHYDULRDSULPRDFFKLWRqVSLD]]DQWH'XUD]]R risulta quanto mai “ricca” per la compresenza di una moltitudine di componenti culturali, storiche, politiche, sociali, FKHVWUDWL¿FDWHVLQHOFRUVRGHLVHFROLQHKDQQRGHWHUPLQDWRODFRQIRUPD]LRQHDWWXDOH,OSDWULPRQLRDUFKHRORJLFRGHL monumenti convive con quello edilizio (non privo anch’esso di valori storico­antropologici) in una sorta di commistio­ QHHVRYUDSSRVL]LRQHGLWHVVXWLWLSRORJLHHOLQJXDJJLGDLTXDOLULVXOWDGLI¿FLOHULQWUDFFLDUHO¶LGHQWLWjSUHYDOHQWHWHDWUL romani, case medievali, moschee, chiese, edilizia contemporanea, abitazioni minime vivono una sorta di caos calmo lasciando sperare in una possibile armonia dell’unità nella diversità. Questa commistione/ricchezza, che alla prima visita dei posti ci ha disorientati, è diventata poi guida alla ricerca dell’essenza del luogo, segnato dalle numerose YLFHQGHVWRULFKH DQWLFKHHUHFHQWL PDLQÀXHQ]DWDDQFKHGDOO¶LPSRQHQWHSDWULPRQLRPRQXPHQWDOHSUHVHQWH/D SULPDFRVDGDIDUHqVLFXUDPHQWHULSRUWDUHDOODOXFHSHUTXDQWRSLSRVVLELOHLOSDWULPRQLRDUFKHRORJLFRGL'XUD]]R risultano essere molti infatti i progetti di scavo archeologico che riguardano la città, nati anche dalla cooperazione di numerosi organismi internazionali e delle Università (italiane ed albanesi), alcuni dei quali già conclusi come quelli FKHKDQQRULJXDUGDWRO¶DQ¿WHDWURQHOO¶DPELWRGLXQSURJUDPPDVWUXWWXUDWRGLULTXDOL¿FD]LRQHXUEDQD 3LDQRGL5HFXSHUR DUHDDQ¿WHDWUR³3URJHWWRSHUOD5HDOL]]D]LRQHGHO3DUFR$UFKHRORJLFR8UEDQRGL'XUUHV´$GGHQGXPDOO¶$FFRUGRGL &RRSHUD]LRQH,QWHUQD]LRQDOHSHUODVDOYDJXDUGLDGHOSDWULPRQLRDUFKHRORJLFRGL'XUUHV DOWULDQFRUDGDUHDOL]]DUHH che interesseranno anche l’area dell’attuale Piazza Liria, oggetto della presente proposta. 9(56248$/(3,$==$" La piazza è l’elemento ordinatore del disegno della città, non solo in senso urbanistico ma anche in senso sociale e culturale. La piazza in passato, vasta o piccola che fosse, è stata sempre uno spazio circoscritto e fortemente progettato (dall’Agorà greca o meglio da “plateia” sostantivale di Platys, vasto, largo, ampio, al foro romano, la piazza centrale che rappresentava come nell’Agorà il fulcro della vita della comunità ma anche il suo simbolo per cui doveva essere maestosa e pulita, quindi assumeva dimensioni elevate, costruita con un porticato e connessa al tempio assu­ mendo così anche il ruolo di vero centro geometrico della città storica, alla piazza medievale racchiusa dalle cortine edilizie, dal recinto di case talora interrotto dal Palazzo comunale o dalla Chiesa, alla piazza rinascimentale, luogo di JLXVWDSSRVL]LRQHUDI¿QDWDGLRJJHWWLDUFKLWHWWRQLFLFKHGLDORJDQRWUDORUR FRQWHQLWRUHGLGHWHUPLQDWLYDORULVRFLDOL FLVL abitava o ci si andava per le funzioni religiose o civili, vi si facevano affari con i mercati o ci si recava per necessità di ULFKLHVWHHGLVXSSOLFKHDLSRWHUL LQRJQLFDVRHUDLOOXRJRLQFXLVLLQWHVVHYDQRUDSSRUWLHUHOD]LRQLHGHUDQRSURSULR questi a rendere necessaria la piazza. La possibilità di praticare rapporti sociali in uno spazio pubblico riconosciuto è andata via via perdendosi con l’evoluzione della vita politica, sociale ed economica e questo ha inciso profondamente VXOO¶LPPDJLQHGHOODSLD]]DFRQWHPSRUDQHDFKHqDOODULFHUFDGLXQDQXRYDLGHQWLWjIRUVHHUURQHDPHQWHSLOHJDWD alle necessità di promozione turistica che di una nuova forma di socialità. Le indicazioni dei Piani Regolatori, i modelli matematici, le normative urbanistiche di certo non riescono a interpretare l’armonia dei luoghi nè a fornire in termini espressivi una concreta risposta alla necessità di spazi simbolici, vivibili, belli e funzionali. Attesa la necessità oggi GLULJHQHUDUHODSLD]]DODULÀHVVLRQHFLSRUWDDGLPPDJLQDUHFKHVRORXQSURJHWWR³YHUR´ LQWHVRFRPHQDVFHQWHGDO luogo) può riscattare il luogo stesso e non necessariamente un progetto “perfetto”, che invece può risultare autorefe­ renziale, rischiando di cancellare il luogo. L’ANTE­OPERAM Sheshi Liria, per le funzioni pubbliche presenti, rappresenta la piazza in senso originario (su di essa si affacciano gli HGL¿FLSLUDSSUHVHQWDWLYLGHOODFLWWj0XQLFLSLR0RVFKHD3UHIHWWXUD3DOD]]RGHOOD&XOWXUD HGLQVHQVRXUEDQLVWLFR corrisponde alla piazza dell’antico insediamento romano (gli scavi mostrano che risulta proprio a ridosso dell’antico IRUR 3LYROWHWUDVIRUPDWDGDOOHYLFHQGHVWRULFKH GLGRPLQD]LRQHVLVPLFKHSROLWLFKHHFF RJJLODSLD]]DULVSRQGH SXUWURSSRSLDOOHHVLJHQ]HG¶XVRGHOODFLWWjPRGHUQDFKHVSHVVRSULYLOHJLDLSHUFRUVLVWUDGDOLHODPRELOLWjFDUUDELOH LQYHFHGHOVLPERORHGHOODVRFLDOLWjLQGXFHQGRDOSDVVDJJLRSLFKHDOODSHUPDQHQ]D$OORVWDWRDWWXDOHO¶DUHDVXOOD quale bisogna dare una risposta, si presenta come un vuoto urbano carico di potenzialità (vedi appunto le rovine URPDQH ODVXSHU¿FLHGLLQWHUYHQWRULVXOWDPROWRHVWHVDHGDLFRQ¿QLSRFRGHOLQHDWLRFFXSDWDVRSUDWWXWWRGDOODYLDELOLWj HGDL¿QLGLXQ¶LQGLFD]LRQHSURJHWWXDOHLSUHGHWWLHGL¿FLSXEEOLFLFKHYLVLDIIDFFLDQRULVXOWDQRSRVWLDGXQDTXRWDULDO]D­ ta rispetto a quella del piano viario. AZIONI *OLRELHWWLYLFKHLQWHQGLDPRSHUVHJXLUHVLLGHQWL¿FDQRFRQOHVHJXHQWLD]LRQLSULQFLSDOL VWDELOLUHODFRQQHVVLRQHWUDODFLWWjDWWXDOHHODVXDVWRULDUHQGHQGRYLVLELOHLOSURFHVVRGLVWUDWL¿FD]LRQH ­ riappropriarsi della piazza e della sua funzione pubblica migliorando la qualità urbana (in generale gli spazi pubblici e il verde in città sono venuti meno per le continue trasformazioni urbane che hanno saturato il suolo con processi HGL¿FDWRULQRQVHPSUHUHJRODPHQWDWL  158 ULFHUFDUHO¶LGHDIRU]DFKHSRQJDXQVHPHJXLGDSHUXQSHUFRUVRGLULTXDOL¿FD]LRQHHWUDVIRUPD]LRQHGHOODFLWWjSUHFRQL]]DQGRFRQHVVDOD “visione al futuro” prescelta orientata verso la sostenibilità e lo sviluppo culturale. CONCEPT /DVWUDWHJLDSURJHWWXDOHULFKLDPDQGRLOFRQFHWWRGLVWUDWL¿FD]LRQHVWRULFD PDQRQGLPHUDVRYUDSSRVL]LRQHRFFXOWDQWH SURSRQHXQDSLD]]D a strati. Tre livelli, tre funzioni principali, tre età storiche: ­ la quota inferiore svela la monumentalità della città romana attraverso un itinerario archeologico che verosimilmente si può tradurre in un 0XVHRVLDSHUFRQVLVWHQ]HHFRQWHQXWLFKHSHUPRGHOORGLIUXL]LRQH ODTXRWDGHOO¶DWWXDOHSLD]]DVDUjFDUDWWHUL]]DWDGDOO¶HVLJHQ]DGHOODULRUJDQL]]D]LRQHGHOWUDI¿FRYHLFRODUHULGRWWRDOO¶HVVHQ]LDOHDWWUDYHUVR GHLSHUFRUVLFDUUDELOLFKHVRUYRODQRSRVVLELOPHQWHOHDQWLFKHURYLQH ­ la quota superiore (la “visione al futuro”) è la piazza civica vera e propria, una membrana dalla forma generica (perchè variabile a seconda dei vincoli e delle necessità che scaturiranno) che, come un complesso di elementi megalitici, sormonta i precedenti livelli. 2SSRUWXQDPHQWHOHVXHHVWUHPLWjPHWWRQRLQFRQQHVVLRQHWXWWLJOLHGL¿FLSXEEOLFL LFXLDFFHVVLFRPHDFFHQQDWRFRPSDWLELOPHQWHDOQXRYR livello proposto, si trovano rialzati dal piano stradale) e gli stessi con i livelli inferiori, ora al piano stradale, ora al piano degli scavi. Non và WUDVFXUDWRO¶DVSHWWRHPR]LRQDOHGHOQXRYROXRJRLQFXLFLVLLPPHUJH ODSHUFH]LRQHGHOIUXLWRUH 9LqFRPSUHVHQ]DGLDQWLFKHURYLQHHFLWWj PRGHUQDLOULFKLDPRWXULVWLFRHODTXRWLGLDQLWj,O0XVHRDUFKHRORJLFRVFDWXULUjGDJOLVFDYLFRPHLOSURJHWWRDUFKLWHWWRQLFRXUEDQLVWLFRVDUj calibrato in ragione dell’esito dei ritrovamenti. Saranno stabilite nuove gerarchie e relazioni spaziali tra preesistente acclarato e preesisten­ WHGDVYHODUH/DFLWWjDQWLFDULWURYDWDHULRUJDQL]]DWDGDUjXQDPDJJLRUHHQXRYDIUXLELOLWjGHOSDWULPRQLRPRQXPHQWDOHORVWHVVRDQ¿WHDWUR ad esempio, potrà essere riutilizzato per ospitare eventi di grande richiamo (concerti, rappresentazioni teatrali, ecc.). La nuova viabilità FRPSHQHWUHUjODSLD]]DGLSUHVXQ]LRQHVFXOWRUHDDGHVVDVDUjDWWULEXLWDODUHVSRQVDELOLWjGHOULFKLDPRDUFKLWHWWRQLFR&KLDWWUDYHUVDOD SLD]]DVXOSLDQRYLDULR LQWHUPHGLR DYUjODVHQVD]LRQHFKHLQTXHOSXQWRDFFDGHTXDOFRVDGLLPSRUWDQWHDOGLVRWWRO¶DQWLFDFLWWjDOGLVRSUD la città futura. 3.30 Landscape levels $UFK&DUPHOR%DJOLYR$UFK/XFD*DORIDUR$UFK)DEUL]LR*ORULRVR Arch. Manuela Gentile, Arch. Chiara Scocco /$1'6&$3(/(9(/6 $QHZYLVLRQIRUWKHIXWXUHRI'XUD]]RUHTXLUHVWRUHWKLQNSLD]]D/LULDDVWKHPDLQSXEOLFVSDFHIRUWKHFLW\DQGIRULWV FRPPXQDOOLIH,QWKH0HGLWHUUDQHDQFXOWXUHWKHSLD]]DKDVDOZD\VEHHQWKHV\PERORIDPXOWLFXOWXUDOVRFLHW\LQRUGHU to look at the future of a continuously culturally and socially transforming country we also need to give a glimpse at LWVSDVWDQGLWVWUDGLWLRQ7KHSLD]]DFRPHVWRUHSUHVHQW¿UVWRIDOODSODFHWRUHODWHXQGHUGLIIHUHQWSRLQWVRIYLHZVR that it needs to be equipped with recreation facilities and open to an always different use of the space. Our design LQWHQGVWRVKDSHWKHVSDFHWUDFNLQJGRZQWKHGLIIHUHQWÀRZVLQWHUDFWLQJRQWKHDUHDDQGVWUHQJWKHQWKHPWKURXJKWKH realization of a natural anthropicalized landscape. CONCEPT to imagine the piazza on two different levels: ),567/$1'6&$3(/(9(/UHSUHVHQWHGE\WKHQDWXUDOODQGVFDSHWKURXJKWKHGHQVL¿FDWLRQRIWKHH[LVWLQJSODQWLQJRI WUHHVVRWRFRQ¿JXUHWKHSLD]]DDVDQDWXUDOODQGVFDSHYROXPHLQRUGHUWRFUHDWHDJDWKHUHGDQGVKDGHGHQYLURQ­ ment. An appropriate choice of plants and essence organization will create always changing views according to the season, so to use the natural landscape to produce a chromatic variation and always changing aperture to the city. 6(&21'/$1'6&$3(/(9(/WKHXUEDQVSDFHLVVKDSHGE\WKHPRYHPHQWRIJULGZLWKDQDOZD\VGLIIHUHQWJHRPHW­ ry, where each cell is characterized by a different material, stone, water, grass and different plant essences: each cell represent a tridimensional micro­landscape. 161 3.31 Folding Arch. Michele Cro’ 'HVLJQ7HDP/DQGVFDSH$JU$ODLQ(QQLR$VFDUHOOL $UFKDHRORJLVW0+HOHQD0DUFKHWWL$UFK$OEHUWR&UR¶ Since his “nomenclature” this place shows a clear and evident contradiction but also a strong wish to be a presence in the citylife and a simbol for the inhabitants. The square that keeps the name of and old Balkan population, the “Iliria”, was realized after a devastating earthquake in 1926. As continuing the “messy” action of the nature, the urban reas­ sessment was done in the following years anticipating the new modern structure of the city with a new urban designer project in 1942. Nothing was presaging the presence of a similar place, hypothesized in his classical connotation and absolutely new in an oriental city character, as a result of a long Ottoman domination. In less than 80 years the ancient site, represented by a small open place just outside the Ottoman walls boundaries, VWUHWFKHGRXWRIDQ\SODQQLQJUXOHVEHFDPHWKHFRQÀXHQFHRIWKHFLW\XUEDQIDEULF +LJKFODVVEXLOGLQJVDUFKDHRORJLFDOUXLQVDQGWKHPDLQXUEDQIXQFWLRQOHDQRXWRQWKHSOD]DDVWKH7RZQ&HQWHU the Great Mosque, the Culture Building, the Prefecture, the Great Roman Amphitheater, the Ottoman Walls and the Byzantine churches, so “Iliria” square is today the heart of the city. The square currently seems like an incomplete space, full of memories that messily remerge at its borders. The di­ mensional relationships of the façades front are now contaminated by new buildings from recent speculative develop­ ments, increasing the fragmentary sense of space. In such a landscape character with a countless presence of dissonant signs and dominated by a strong cultural FRQWUDGLFWLRQZULWWHQLQWKHDQFLHQWIDEULFRIWKHFLW\KLVYDJXHQHVVTXDOL¿HVDJUHDWYDOXH,QRIIHUVWKHFKDOOHQJHRID third choice as a real opportunity to seek in this ambiguity a new reference image of the building fabric. So we conceived a space that assumes the classical idea of the square in horizontal extension as much as a simple VXUIDFH7KHQHZIROGHGVKDSHLVRYHUODSSLQJDQGUHSODFLQJWKHH[LVWLQJVSDFH$VRUWRIÀ\LQJFDUSHWHQGRZHGZLWK XQLI\LQJDQGFRQIRUPLQJVWUHQJWKDVZHOODVWKHHYRFDWLYHSRZHURIWKH³ÀLJKW´RIOLJKWQHVV This is also a vague link to the oriental culture and an useful classical reference to the public function of the city: the folded surface is a synthetic action towards the horizontal layer of the city, developed by north­south axis to contain the principal historical and administrative buildings. ,QWKHRSSRVLWHGLUHFWLRQWKHÀRRUVORSHVRQWKHZHVWHUQVLGHWRFRQWDLQWKHODUJH³%RXOHYDUG´GRPLQDWHGE\WKH%LJ 0RVTXHDQGE\WKHOXVKJDUGHQVRI'XUD]]R¶V3URPRQWRU\$GHHSLQFLVLRQRQWKHFLW\¶VSODQFRUUHFWVDQGDUUDQJHV the eastern side of the square, which now complaints a jagged and disjointed border. The large concave area generated in the new square set up two longitudinal layouts. Complying with the current perception of space, the west side is like a “walking” dynamic place, connecting the principal city routes. The eastern VLGHLVVOLJKWO\WLWOHGDQGLVGH¿QHGE\DGLIIHUHQWÀRRUDUHVWLQJSODFHVKDGHGE\WKHWUHHVZLWKDFOHDUVHSDUDWLRQWR the side road, on a different height level. The square is visually divided without solution of continuity, and the new open area strengthens the possible use of public and collective spaces and offers the opportunity to host different political, theatral and musical shows. 7UDI¿FLVPDQDJHGIROORZLQJWKHFXUUHQWXUEDQSODQQLQJUXOHVEXWNHHSLQJWKHGLIIHUHQFHEHWZHHQWKHVXUIDFHV¿QLVKHV RQWKHQRUWKVLGH IDYRULQJWKHSHGHVWULDQPRELOLW\DQGDOVRFKDQQHOLQJWKHFDUÀRZWKURXJKWKHXVHRIVWUHHWERXQGD­ ULHV%\WKHZD\DOOWKHVHFRQGDU\DQGVHUYLFHSDWKVZLOOEHRQWKHVDPHW\SHRIVWRQHÀRRULQJZLWKRXWDQ\IXUWKHU signals contaminating the unity. 7KHVTXDUHLVUHOHDVHGE\WUDI¿FLVVXHVDQGKDUPRQL]HGLQWKHQHZXUEDQFRQWH[WE\PDUNLQJDQHZ³JHRJUDSK\´ with a unitary system that’s be able to express a high recognition value. Some minor signs and the green structure overlap the general layout, spatially driven by articulating the basic plan of the square which surrounds the gardens around the Culture Palace. The green system assumes clearly the role of ecological connection between the hill slopes to the east, and the districts facing the port dock and the coastal area. 7KHWUHHURZVGH¿QHDVWULSWKDWLVVHDRULHQWHGDQGSURYLGHPRVWRIWKHVKDGHIRUWKHVTXDUH7KH\LQWHUVHFWDWUHHURZ of “prunus” marking the north­south axis connecting the Byzantine­Ruins and the Amphitheatre by shaping a new form on the square. By tracing new roads on the eastern side we determined an urban structure that has an articulated shape on the exi­ VWLQJEXLOGLQJVERUGHUVZKLFKZLOOEH¿OOHGZLWKDGHQVHYHJHWDWLRQLQRUGHUWRDOOHYLDWHWKHGLVSURSRUWLRQDWHSUHVHQFH RIWKHUHVLGHQWLDOWRZHUQHDUWKH0XQLFLSDO2I¿FH The eastern side becomes a green border where we can put treerows that will reach the coastline passing through the old districts The Culture Palace access is also changed, reducing the entrance stairs and organizing a new side­ garden, bringing it back to an equal connection with the city. 163 165 3.32 Void ')UDQFLVFR-DYLHU+LJXHUD<HOD '$OHMDQGUR3HUH]0DUWLQH] 'HVLJQ7HDP+&3 $UTXLWHFWRV$VRFLDGRV +RZVKRXOGWKHUHODWLRQVEHWZHHQSULYDWHDQGSXEOLFVSDFHLQWKHFLW\EHFRQFHLYHGWRGD\":KDWLVWKHVWDWXVRI WUDQVLWLRQVSDFHVLQWKHVHQHZUHODWLRQVEHWZHHQWKHKXPDQVFDOHDQGWKHXUEDQRQH"+RZWKHGHVLJQRIDVSDFHFDQ KHOSDVWKHRQHWKDWRFFXSLHVXVWRXQGHUVWDQGLQJWKHFLW\RIZKLFKLWIRUPVDSDUW"7KRVHDUHWKHTXHVWLRQVRILWHP IURPZKLFKZHDSSURDFKWKHSUHVHQWSURMHFW)RUGH¿QLWLRQ³PDMRUVTXDUH³LWLV³WKHRQHWKDWFRQVWLWXWHVWKHSULQFLSDO core of the urban life in the villages and cities “. The transformations carried out in the bosom of a society produce HTXDOO\FKDQJHVLQWKHZD\RIGHDOLQJRIOLYLQJDQGHQMR\LQJWKHVHVSDFHV)URPDOZD\VWKH\KDYHEHHQSODFHV of meeting, places of celebration in community, of trade, of stay ... And in it there remain represented the different estates of the municipal, social and cultural life of the cities. It is exactly what we try with our offer of intervention: to SXWLQYDOXHWKHDUFKLWHFWXUDOVRFLDODQGFXOWXUDOZHDOWKRIDFLW\DV'XUUHV,QWKLVVSDFHKHDUWRIWKHFLW\WKHUHDUH SUHVHQWHDFKDQGHYHU\RIWKHHOHPHQWVHQXPHUDWHGE\WKH'LFWLRQDU\WRGH¿QHWKHFRQFHSWRIVTXDUHDQGDVLWFDQ­ QRWEHRWKHUZLVHDQ\DFWLRQLQWKLVVSDFHSDVVHVVLPSO\DQGRIWKHDVZHOO NQRZQDVSRVVLEOHIRUPIRUUHYHDOLQJWKH PXOWLFXOWXUDODUUD\RIWKHVRFLHW\RI'XUUHVDQGUHLQIRUFLQJWKHSODFHDVPLWLQJVSDFHLQDQRSHQHGDQGFRVPRSROLWDQ FLW\DVWKLVRQH,WLVWKHFRQWRRXUOLQHV±±DUFKLWHFWRQLFSUHVHQFH ZKLFKWUDGLWLRQDOO\GHFLGHXUEDQSK\VLRJQRP\WKLV “architecture of walls”, this predominance of form contrasts with another onne, a posible architecture of the ground plane which privileges the content, the use changing according to social mutations (as opposed toaa form which, once GHFLGHGLVGLI¿FXOWWRPRGLI\ $SURMHFWUHYHDOLQJEOXUHGDPELJXRXVFRQWRXUVUDQGRPRUYDJXHIRUPVÀXLGVSDFHV between outside and inside and a comunion with nature forged precisely through these new transition spaces, elastic DDQGÀH[LEOH«JHQHUDWHGWKURXJKWKHUHGH¿QLWLRQRIIWKHVWDWXVRIWKHFRQWHPSRUDU\SXEOLFVSDFHDQGLWVUHODWLRQZLWK the prexistinng. Architecture should not be viewed as an isolated or solid object, but as part of the continuous void in which it is immersed, consisting of complex solids generating an indisolublle whole in urban settings. Architecture as VROLGYROXPHQRQO\KDVPHDQLQJZKHQLWDWWHPSWVWRGH¿QHSDUWRILWVRZQYRLGWKHH[WHULRUDQGLQWHULRUVSDFHVWKDW FRQWDLQLW7KHYRLGFDQEHFRQVWUXFWHGDQGGH¿QHGDVDFRQWLQXXPÀRZLQJIURPWKHQDWXUDOYRLGWRWKHEXLOWVROLG intermediate projections, such as terraces, balconies and viewing points. Consequently what remains outside of the VROLGLHWKHYRLGEHFRPHVWKHPRVWVLJQL¿FDQWVSDFLDOFRPSRQHQWIXQFWLRQLQJDVWKHRUGHULQJGHYLFHRIWKHVSDWLDO FRQWLQXXP7KHVSDFHGH¿QHGE\WKHFRQWDLQHUVLVG\QDPLFHQWLWLHV2QHVKRXOGEHDZDUHRIWKHPRYHPHQWRIWKH WUD¿FDQGKRZLWFLUFXODWHVDQGFDQVXGGHQO\GLVDSSHDUWKURXJKDKROHRUVPDOORSHQLQJ2QHLVDOVRDZDUHRIWKH effects of sunlight and gravity and how the container is shaped by topography, water and vegetation. We are talking about the sequential or continuous void: a continuous space intermediate projections, such as terraces, balconies and YLHZLQJSRLQWV&RQVHTXHQWO\ZKDWUHPDLQVRXWVLGHRIWKHVROLGLHWKHYRLGEHFRPHVWKHPRVWVLJQL¿FDQWVSDFLDO FRPSRQHQWIXQFWLRQLQJDVWKHRUGHULQJGHYLFHRIWKHVSDWLDOFRQWLQXXP7KHVSDFHGH¿QHGE\WKHFRQWDLQHUVLVG\­ QDPLFHQWLWLHV2QHVKRXOGEHDZDUHRIWKHPRYHPHQWRIWKHWUD¿FDQGKRZLWFLUFXODWHVDQGFDQVXGGHQO\GLVDSSHDU through a hole or small opening. One is also aware of the effects of sunlight and gravity and how the container is shaped by topography, water and vegetation. 166 167 168 3.33 Nell’ombra delle città Oliver Gachwetz $UFK0LFKDHO.OHLQ$UFK&KULVWLDQ+DLG $UFK1LFROH5DNHU'DQLHO=LPPHUPDQQ '855É6+,6725,&$/&,7<,1&+$1*( 'XHWRVXFHVVLRQRIPDQLIROGFXOWXUHVSROLWLFDOV\VWHPVDQGHSRFKVWKDWDOOKDYHEXLOWXSUHDQGXQEXLOWWKHKLVWR­ ULFWRZQRIWKHFLW\WRGD\¶VDSSHDUDQFHRI'XUUsVFRPHVFORVHWRDHGL¿HGFROODJH7KHVXSHULPSRVLWLRQRIERWK corroborative as well as contradictionary understandings of the city builds up ­in spite of variety and heterogeneity ­ an integrated whole as it is characteristic for grown city patterns that date back into ancient times. Iliria square seems despite or even because of major spatial interventions in the last century densely interweaved into its surrounding fabric. This almost organic order is can be best described by the term of “conglomerate ordering” by Alison and Peter Smithson: a space consisting out of differing sensual levels ­in terms of age, appearance, altitude of the surrounding, WKHRSHQSODLQDVZHOODVWKHQLFKHHWFWKDWLQLWVHQWLW\FDQQRWEHFDSWXUHGDW¿UVWVLJKWKDVQRFOHDUGLUHFWLRQEXW a strong connection towards its surrounding, holds historic sections as well as alterations and before all, stands out as an adaptive organic logic due to its ability for bearing spontaneous add­ons and tear­offs. Continuity in building at any epochs, the discovering­while­building, as happened in the case of the Culture Palace Aleksander Moisiu and the excavation of the Roman Baths prove this theory. In respect thereof, changing the existing square and adding a FRQWHPSRUDU\SRVLWLRQWKDWUHVSHFWVWKHKLVWRULFIDEULFHTXDOVMXVWDIXUWKHUOD\HULQWKHJURZQFROODJHDQLQWHUYHQWLRQ into the centre as a whole easily stands, furthermore is even supported by. As well, as this kind of intervention could take care of the archeological aspect of the sight and respects any potentially hidden further structure. CIRCULATION 7KHH[LVWLQJ,OLULD6TXDUHVHHPWREHRQHKXJHSODLQUHVHUYHGIRUFDUWUDI¿FZLWKVRPHLQWHUVSHUVHGEXWKDUGO\WR UHDFKWUDI¿FLVODQGV%\SDVVLQJWKHPDLQURXWHHDVWZDUGVDQGHPEHGGLQJWKHOLQNWRWKHWHPSRUDU\RSHQ557UHJWDUH allows for safe pedestrian and bicycle circulation and an open public plaza. Access of public institutions is easily pro­ vided by the open, clearly laid out surface. A strong connection between the sea and the city centre is built up by esta­ blishing the public square as spatial terminal of the RR. Tregtare. This street could serve as a temporary promenade. On that score, freedom Square works as an intra­urban node and distribution device. *5((1(5< To equip the square with a green volume links up dispersed green spaces to green corridors pervading the whole urban fabric. A network of green paths and volumes enriches local biodiversity as well as the quality of intra­urban life. The vertical volume of the Iliria Square is going to be built out of boxshaped Platanus trees. Growing up to a height of about 20 metres, these Mediterranean local trees (Platanus orientalis) provide provide the square with light shadow. 6867$,1$%,/,7< 1s+LMHQs4\WHVWLQRSHUDWHVGLIIHUHQWDVSHFWVRIVXVWDLQDELOLW\(FRORJLFDOHFRQRPLFDOFXOWXUDODQGVRFLDOVXVWDLQDEL­ lity have to be issues strongly covered for designing an intervention on Iliria square. (&2/2*< &RQFHUQLQJHFRORJLFDOLVVXHVWKHSURMHFWVWURQJO\IRFXVHVRQSHGHVWULDQDQGELF\FOHFLUFXODWLRQLQVWHDGRIFDUWUDI¿F This shapes a different image of the city and points out a strong and necessary statement. Public space instead of FDUWUDI¿F3LQHVIRUPXODWLQJDÀRDWLQJJUHHQYROXPHGHJUDGHSROOXWDQWVSURWHFWIURPVXQDQGVXSSO\FRPIRUWDEOH micro­climate. The steel structure providing infrastructure for e.g. lighting can be furnished with attached sources for renewable energy. Interlinking existing green spaces establishes a continuous network of green corridors over the urban fabric. CULTURE Building under the prevailing historic circumstances requires subtlety and respect for the cultural heritage. Both, the grid of the steel frame as well as the planted trees are highly adaptive in case of further possible discoveries and cautious in their appearance. (&2120< 'XUUsV¶QHZ,OLULD6TXDUHZLOOEHWKHQHZIDFHRIDFLW\(FRQRPLFDOO\DSSHDUDQFHDPHQLW\YDOXHRIVRMRXUQDQG a focus on the historic heritage of the main plaza of the old town of the city should not be underrated as all attract ORQJWHUPEDVHGDQGHQYLURQPHQWDOO\VHQVLWLYHWRXULVPLQVWHDGRISULFHGXPSLQJPDVVWRXULVP+LJKYDOXHRIVRMRXUQ attracts furthermore different programs that revive the city’s core and – as a consequence ­ lead to an increase of purchasing power. 169 62&,(7< 7UDQVIRUPLQJ,OLULD6TXDUHLQWR)UHHGRP6TXDUHSRLQWVRXWWKH topic of social sustainability since it is about the representation RIDFKDQJLQJVRFLHW\$FFRUGLQJWR+HQU\/HIHEYUHVSDFHLV DFWXDOO\SURGXFHGDQG'XUUsVVHHPVWRVHUYHDVDQLOOXVWUDWLYH Model: Every epoche, every political system used urban space DVEXLOWKHJHPRQ\1s+LMHQs4\WHVWLQXVHVDQRQKLHUDUFKLF grid and trees for blurring these insignia of power as a contempo­ UDU\ODQJXDJHRI)UHHGRPDQG(TXDOLW\7KHEXLOW0DVVUHPDLQV visually but loses the dominant leading position. To end up on this PRVWLPSRUWDQWLVVXHDVLWLVDERXWWKHLQKDELWDQWVRI'XUUsVWKH proposal encourages individual appropriation of space and new performative uses of the city. Its main actor is not design but the performer. Open space has to be given to the public allowing for a new political socitey to emerge in this respect, open space serves as a sign of social culture. Or, to make a long story short, to say in your words ­your main guiding principle of your competition­ it DOORZV'XUUsVQHYHUWRVWRS 170 171 3.34 Freedom at the center $UFK*LRYDQQL&D¿HUR$UFK0DULDOXLVD&LSULDQL Arch. Claudia Morri , Arch. Bernhard Neulichedl, Arch. Elisa Montalti )RU$56$UFKHR6LVWHPL&RRSHUDWLYH/RUHQ]D%URQ]RQL $UWLVW)UDQFR3R]]L 7KH)UHHGRP6TXDUHLVWKHKHDUWRIWKHFLW\RI'XUUHV It’s very close to the Adriatic Sea and to the harbour so it seems to be a window on the world for all Albania. It’s very important for the tourists arriving by sea. The square has to be a “visiting card” for the tourists, a meeting place and representative hall for the citizens, a point of interest for the archaeologists. WHY the revitalization of the square is so important? Because the square is: ­ the joint between the different urban systems (historic centre, general urbanization, park of the Bizantine walls, coast DQGKDUERXU  WKHMRLQWEHWZHHQWKHGLIIHUHQWIXWXUHWUDQVIRUPDWLRQV ­ the joint between different orographic and urban structures with different use of the ground (harbour, hill, coast, UHFODLPHGSODLQEXLOWDUHDVDUFKHRORJLFDOVLWHV  ­ the joint between different ecological systems and green lines (parks, avenues with trees, squares­gardens, small JUHHQOLQNV  WKHMRLQWEHWZHHQKLVWRULFDOFXOWXUDODQGDUFKHRORJLFDOVLWHVDQGWKHFHQWUHRIWKHWRXULVWLFURXWHV ­ the joint between public and private mobility, pedestrian and cycle mobility and it’s very close to the future city SDUNLQJV DUHSUHVHQWDWLYHVSDFHIRUWKHPRVWLPSRUWDQWLQVWLWXWLRQDODQGFXOWXUDOEXLOGLQJVLQWKHFLW\ 7KH7RZQ+DOO7KHELJ Mosque, The Prefecture, The Palace of Culture “Aleksander Moisiu”) HOW this intervention can be executed? 7KHSURMHFWLGHQWL¿HVWZRKXEV WKH7RZQ+DOODQGWKH3DODFHRI&XOWXUHYHU\LPSRUWDQWEXLOGLQJVLQWKHSROLWLFDODQG FXOWXUDOFLW\OLIH 7KHSURMHFWGUDZVWZRELJVTXDUHVIRUHDFKEXLOGLQJVRQHIRUWKH7RZQ+DOODQGRQHIRUWKH3DODFH of Culture. These two squares are meant to become a stage for big events, a representative hall for the buildings, a meeting point where to sit and stop during the day and the night. The level of the squares will be lower than the level of the eastern road thanks to two steps­seats, so it will be possibile to sit looking the square and the hill as a background. Two trasversal pedestrian links mark the square and they join the different areas at east (Ottoman buildings) and at west (the Prefecture and the Mosque). The paving wants to be a a work of art with the artistic tecni­ TXHRIWKHDQDPRUSKRVLV7KHSODWIRUPVZLOOEHLPSUHVVHGE\QDWXUHDQGVHD¶VVKDSHVGUDZQDFFRUGLQJWRVSHFL¿F geometrical rules. WHAT can be carried out for the revitalization of the square? The project wants to organize the space with natural elements (water and vegetation) from the surroundings. A network of arrow canals draws the space and it calls to mind the network of drainage canals in the municipal land. 7KHVHFDQDOVOLQNWKHODQGWRWKH$GULDWLFVHD)UHHGRP6TXDUHLVWKHFRQQHFWLRQ¶VSRLQWEHWZHHQWKHORFDOJHRJUD­ SK\DQGWKHKLVWRU\RIODQG¶VXVHLQ'XUUHV7KHFDQDOVORRNDVWKH\FRPHIURPDZDWHUZDOODWWKHZHVWHUQHGJHRI the square and they become water pools or jets. Water can be an attractive factor, a natural cooling element during WKHVXPPHUDQGDSRLQWRIUDLQZDWHUSLFNLQJGXULQJWKH\HDU:LWKUHJDUGWRWKHYHUWLFDOZLQJVWKHVTXDUH¿QGVQHZ borders thanks to the vegetation, which goes down from the hill and it comes into the square up to the eastern sur­ URXQGLQJV*UHHQZLQJVGH¿QHWKHVTXDUHVWRZDUGVWKHURDGVDQGWKH\FUHDWHRDVLVZKHUHWKHSHRSOHFDQVWRSDQG relax. Also the grass extends all over the square and natural green spots spread on the paving. The mediterranean YHJHWDWLRQZLOOGH¿QHQHZVSDFHZLWKRXWEXLOWZLQJV7KHVTXDUHIURPWKHDUFKDHRORJLFDOSRLQWRIYLHZ 7KHSURMHFWIRUWKHUHYLWDOL]DWLRQRI)UHHGRP6TXDUHLQ'XUUHVLVIRUDQDUHDZLWKKLJKDUFKDHRORJLFDOYDOXHDOUHDG\ important site for the touristic­cultural routes. The square is surrounded from important archaelogical buildings in the XUEDQFRQWH[W,QWKHVRXWKHUQSDUWWKH5RPDQ$PSKLWKHDWUH EHJLQQLQJRI,,FHQWXU\D& ZDVIRXQGHGE\9DQMHO Toçi in the Sixties of the last century. Since 2004 it has been object of escaviations and researches by the Italian $UFKDHRORJLFDO0LVVLRQRIWKH8QLYHUVLW\RI3DUPD,QWKHZHVWHUQSDUWWKHUHDUHWKH%L]DQWLQHZDOOVRIWKH9,FHQWXU\ a.C., already restored with a pedestrian way and gardens. In the north­western of the square, there is the macellum or IRUR DWWKHOHYHOPWXQGHUWKHURDGOHYHO ZLWKPDUEOHÀRRUDQGFROXPQVFRPPLVVLRQHGPD\EHE\DQHPSHURU Close to the Palace of Culture, there are the Roman thermal baths. These archaeological areas are nowadays in de­ FD\DQGWKH\ZRXOGQHHGDYDORUL]DWLRQ,QWKHHDVWHUQSDUW UXJD+7URSOLQL GXULQJWKHFRQVWUXFWLRQRIDUHVLGHQWLDO EXLOGLQJLQPDQ\URPDQUXLQV PD\EHZKDUHKRXVHV ZHUHIRXQGFORVHWRDURXQGVWUXFWXUHPD\EHD+HOOHQLVWLF lighthouse of the city (at the level of 2 or 3 mt. undeground). 172 $FFRUGLQJWRWKHVHHOHPHQWVWKHVTXDUHPD\EH¿OOHGDQDUHDRIELJFHQWUDOLW\LQWKHDQFLHQWWLPHV0D\EHKHUHWKHUHLVDOVRWKHDQFLHQW foro, nowadays not discovered. Anyway other archaelogical roman elements could be at the depth of 2 or 4­5 mt. Under these meters, there could be greek ruins at 4­6 mt. of depth. Ottoman construction could be in a depth of 1 mt. underground and structures or necropo­ OLV 9;,FHQWXULHV FRXOGEHLQDGHSWKRIPW7KHSURMHFWGRHVQ¶WIRUHVHHH[FDYDWLRQVLQGHSWKVRLWWDNHVDORZDUFKDHRORJLFDOULVN Anyway not very deep excavations could show ancient structures, which could be involved from the green and vegetation, in a kind of archaeological gardens. Financial aspects Building is not allowed in the square. Anyway, in the second phase it will be also possible to suppose exchanges between public and pri­ vate properties in the event of consolidating the public heritage, within the more general idea of urban regeneration. And it will be possible VWXG\SURMHFW¿QDQFLQJDERXWWKHVXUURXQGLQJDUHDVLQDGLVFXVVLRQZLWKWKHSXEOLFDGPLQLVWUDWLRQ 173 3.35 Roots of memories Miguel Meirinhos 'HVLJQ7HDP6HQLRU$UFK3HGUR/RSHV Junior Arch. Pedro Oliveira 7+(522762)0(025< 'XUUHVLVDFLW\ZLWKDQXQGHQLDEOHSUHVHQFHRIKLVWRU\,W¶VOD\HUHGFRPSRVLWLRQDQGWKHDOOWKHFURVVLQJVSURGXFHGE\ WKHFXOWXUDOKLVWRULFDOLWLQHUDULHVEXLGDYHU\³(XURSHDQDWPRVSKHUH´7KHPRWWRFKRVHQUHÀHFWVWKDWRPQL±SUHVHQFH a phenomenon thet raises from time and space, that supports and irrigated the urban life. It is very common in historical/monumental cities the need of a plan, an adequate thought and vision to put things in a ULJKWSHUVSHFWLYHLW¶VDQRUPDOVWDJHLQWKHRIVXFKDQFLHQWFLWLHVWKDWKDYHVRPHGHYHORSPHQWVGH¿QHGE\FRQVWUDLQWV or built on wrong concepts/visions. Those, produce a kind of “noise” that don’t allow the inhabitants to see and hear their city, in a clear way. It is very clear in Liria square this presence of elements and compositions that don’t seem to belong there, or were made to solve very circumstantial problems. The circulation scheme, the drawing of the central small gardens and fountains and the presence of some anonymous, probably clandestine buildings prove this analysis. ORGANIC vs. RATIONAL The words written before demonstrate the need of an outside vision, that generates a plan for the square and it’s contiguous spaces, as a whole, measuring what has been done and suggesting some new concepts. Therefore, it is assumed by us that all the projects and plans have a role in our proposal. 2XUVWUDWHJ\LVWRVHHZKDWDUHWKHWKLQJVWKDWGH¿QHWKLVXUEDQSODFHLW¶VDWPRVSKHUHUHLQIRUFHWKRVHFKDUDFWHULVWLFV clean up some of the “noises” that turns thing less clear, but always considering what has been done. We don’t see as an adequate posture to destroy many buildings and don’t take into consideration the recent Master Plan and some VSHFL¿FSODQV'HPROLWLRQSURFHVVHVDUHVRPHWLPHVQHFHVVDU\EXWXVXDOO\UDLVHYHU\FRPSOLFDWHGOHJDOTXHVWLRQV that slows and conditionates development. In the 2007 Master Plan, we were specially interested in the Infrastructural and Mobility Plan, in the cultural itinerary and in the Project of the Park of the Byzantine Walls and Re Zog palace. %ORRNLQJWR'XUUHVFLW\E\DHULDOSKRWRVSODQVSURMHFWVDQGSLFWXUHVLWZDVTXLWHFOHDUWRXVWZRGLIIHUHQWQDWXUHVLQ the urban tissues. Looking west, we see a very organic composition, in a more accidental territory, more heteroge­ neous buildings and where the natural presence is remarkable. Looking east, the regular drawing of the streets and EORFNVUHÀHFWVDPXFKPRUHUDWLRQDODQGKXPDQL]HGRFFXSDWLRQ7KLVSDUDGR[WKDWFRQVWLWXWHVWKHFLW\DQGWKH/LULD Square is its strongest and most special characteristic. The reinforcement of this paradoxical condition is the base of our strategy. &(175$/&21',7,21 When we look to central spaces in the cities all over the world, whether historical (usually geometrical) centers or the new peripheral centers, there are three main vectors in their constitution: accessibility, functional diversity and formal exposure. Accessibility brings the problem of how to combine the different kinds of mobility in a city: private and public transportation, by car, bus, underground, foot, bicycle, skate, ... We have noticed that the square is a major and im­ SRUWDQWSLHFHRIWKHPRELOLW\FDUSX]]OH7KHFRPPRQFRQÀLFWEHWZHHQFDUVDQGSHGHVWULDQVEHWZHHQSDVVLQJE\DQG staying, appears. To solve it, we propose a tunnel that crosses the square, separating the different speeds and ways RIPRYLQJDURXQG:LWKWKDWLW¶VSRVVLEOHWRJDLQVSDFHDQGIUHHGRPLQWKHSHGHVWULDQ XUEDQ OHYHODQGHI¿FLHQF\LQ the car (underground) level. In the underground, we also drew a big parking lot, always necessary in cities. When we look at Liria square, the buildings that around it show not onl the functional diversity but also the importance WKDWWKH\KDYHPDLQ3XEOLF$GPLQLVWUDWLRQ&XOWXUDO+LVWRULFDO5HOLJLRXVDQG3OD\IXOSURJUDPV6RLWVHHPHGWRXV WKDWWKHUHZDVMXVWRQHXUJHQWQHHGLQWHUPVRISURJUDPWKHFRPPHUFLDORQH,QRUGHUWRIXO¿OWKLVQHHGZHSURSRVH the construction of a market, a space that helps to establish relations between the square and the east side of the city, that assures the access to the underground parking lot and specially, that brings a strong urban atmosphere, very common throughout the world. In our proposal, we also thought about two other buildings, but with a “private soul”, that may allow to pay back some of the investment, but mainly to draw a richer and more dignifying urban front. In these we have already introduced the last point of this triangle: formal exposure. This one is the most polemic and ambiguous, and, of course, where architects have bigger role. “Organic vs. Rational” relation will make, as we see it, a very interesting occupation of the urban space. The reinforcement of the organic west side typology, must pass by WKHSURORQJDWLRQRIWKH3DUNRIWKH%\]DQWLQH:DOOVDQG5H=RJSDODFHEULQJLQJLWWRWKH¿UVWOLQHRIWKH'XUUHVXUEDQ scene. The accesses from there to the square, from the square to the Roman Amphitheatre, from the square to the Mosque, etc, are already there and their winding form makes them perfect to this scenery. This channels, like roots when ou see them from top, should be composed in a very informal way, where benches, stairs, green platforms, small gardens, viewpoints,.... have a big role. On the other hand, the east front, the attitude is diametrically oppo­ site. We suggest a much more common approach to squares design, a strong presence of built environment, but a presence that sure needs a shift. When we walk in a city, it’s normal to see all kind of buildings and environment, with different sizes, attitudes, relation to the public space. That’s what a city is all about: diversity. But the city’s central 175 square is a kind of visit card, the face of the city and it is very clear that it must be a very dignifying and vibrant VSDFH+HUHZHFDQQRWDIIRUGWRDFFHSWEXLOGLQJVDOPRVW illegal and that seem to don’t care about the square where they stand in. We propose two buildings, besides the market building, that assure a more dignifying drawing of the east front, a permeable frontier, that closes the square, in one hand, and laces in an hierarchy the communication between the square and the city. In the actual set, it is noticed a difference of direction/ali­ gnments between the north side of the square (Palace of &XOWXUH DQGWKHVRXWKVLGH &LW\+DOO ZKLFKFRQWULEXWHG as we interpreted it, in a division of the square in two parts. This division may also be explained by dimension of the square ì, that, when divided becomes more proportioned. )RUWKLV VHFRQG UHDVRQZHGHFLGHGWRNHHSWKLVGLYL­ sion, seeing it has a more reasonable and proportioned occupation. In this sense, it’s also possible to keep a big amount of trees in the square. It is normal, when we are in a historical – monumental city, to see a very geometrical GUDZLQJRISXEOLFVSDFHZKHUHV\PPHWU\SHUVSHFWLYHVDQGSURSRUWLRQVUXOHV:HEHOLHYHWKDWLQWKLVVSHFL¿FFDVHZLWKDOOWKHGLIIHUHQWYL­ sions and attitudes that have built Liria, and in an Age where some of the ancient values and ideas don’t seem to be so dear to the shifting society, the project we drew launches some new conception (or roots) about urban design. URBAN (multiple) SCALE(S) In the urban phenomenon, the complexity raises things to a whole different level, as we speak of a space that involves a big amount of different people, perspectives, ideas, speeds, channels, objects, buildings. It’s complexity also arrives from the hierarchy’s that each urban case contains, and from the relationships between all the elements that constitutes them. That is what we call the “multiscalarity” (multiple scale) of urban space. Each elements, big or small, planned or spontaneous, has a role, and has implications. So, it is quite important that we understand that Liria Square must be a very effective spot in the way it works and functions in day­to­day life, with the closer buildings, with those who pass by, those who seat there for a while, those who work there, etc. and also in it’s regional, national, maybe global role. Being, in it’s conception, an ad­hoc project, and not an original plan, there are certain points of the invention that have very sensitive pro­ blems. It is assumed by us that our project is porosities, but it’s not a superposition of an idea. So, in the places where the big public space PHHWVWKHVPDOOVFDOHHGL¿FDWLRQLW¶VQHFHVVDU\WKDWLQIXUWKHUSKDVHVWKHGUDZLQJLVPDGHZLWKELJVHQVLELOLW\7KHUHPXVWEHVSDFHVWKDW contemplate good access to these “domestic” spaces, but also to build a strong urban image, with well designed urban furniture, parking VSDFHVDQGLQWHJUDWLRQRIWUHHVDQGQDWXUDORFFXSDWLRQV7KHHPHUJHQFHRIWKHPDUNHWDVDVRUWRI¿UVWOLQHSURWHFWLQJWKHKDUVKDQG straight relationship between the housing buildings in the east side, the drawing of the space between the palace of Culture and the interior RIWKHEORFNDQGWKH³VHWWLQJIUHH´RIWKH&LW\+DOOJLYLQJKLPDSURSHUVHWIRUDQLQVWLWXWLRQDOEXLOGLQJLOOXVWUDWHVLW7KLVUHÀHFWVDFRQFHUQ WKDWLVPDQ\WLPHVIRUJRWWHQDQGWKDWXVXDOO\UHVXOWVLQDKDUGUHVLVWDQFHDQGVRPHWLPHVFRQÀLFWEHWZHHQWKHSRSXODWLRQDQGWKHSODQQHUV The dialog (s), literal and theoretical established by the politics and the general population, by the public and the private, is essential for an integrated and positive work. It is much easier to ask people some concessions if they are part of the project/city. The whole “Organic – rational” concept seems, therefore, as something that is understandable in all of its scales and conceptions, and, at the same time, it brings XSWKHVSHFL¿FQDWXUHRIWKLVFLW\RIWKLVVTXDUH,W¶VZKDWLWPDNHVLWVSHFLDOLW¶V/DQGPDUN 5()(5(1&(6 $OWKRXJKZHLQVLVWLQPHQWLRQLQJWKHVSHFLDOFKDUDFWHURIWKHVSDFHDQGRIWKHHQYLURQPHQWVWKDWVXUURXQGWKH/LULDVTXDUHLQ'XUUHVSUH­ senting them as the main theme or projects that by their concepts or by their forms and materials demonstrate the ambiance that we aim. )RUWKHZHVWVLGHZLWKDPRUHQDWXUDOFKDUDFWHUWKHSURMHFWIRU%RWDQLF*DUGHQRI%DUFHORQDE\&DUORV)HUUDWHUFRQVWLWXWHVLWVHOIDVD good illustration of our aim: from the shapes of the “streets”, the platforms, ramps, to the material used. The Market building should reveal an idea of an emergence, something that grows from the ground, showing a great attachment to the horizontal force that is present here. The waves of the Casa da Música in Porto, Portugal, by OMA, example this kind of shape. 35(±)($6,%,/,7< By reading this text, and after looking the drawings presented by us, it is clear that our project repre­ sents an ambitious stand, but also a realizable one. ,WWULHVWRUHGXFHFRQÀLFWVWKDWPD\HPHUJHHYHQ presenting the whole process as something where the general population can participate. We believe the biggest concern, in our proposal, would be the construction of the tunnel and of the (underground) parking lot, in terms of resources demanded. The rest of the invention is very simple, and doesn’t involve any particular construction skills. In what concerns the investment part, all the new programs suggested seem to be susceptible of being arran­ ged with public – private contacts, where privates could assume the building of the housing buildings and even the market, always with close supervision of the city’s urban interests. And if – because there is no interest in this kind of solution – these con­ tracts are not realised, the core of our intervention is always possible and simple to realize. 176 7+(522762)0(025< 6HHPLQJDWWKHEHJLQQLQJDFRPPRQ±SODFH DELWQRVWDOJLFDOVR RXUPRWWRKDVLQWKHHQGDYHU\VLJQL¿FDQWDQGPXOWLSOHPHDQLQJ 5RRWVRIWKHKLVWRULFDOKHULWDJHWKDWEXLOG'XUUHVPHPRU\URRW±VKDSHGDFFHVVHVLQWKHZHVWVLGHURRWVWKDWZHODXQFKIRUWKHIXWXUH0HPRU\¶VRIWKHSDVWDUHDOUHDG\KHUHPHPRU\¶VIRUWKHIXWXUH DUHODXQFKHG%HFDXVH³'XUUHVQHYHUVWRS´ 177 3.36 Di natura urbana 'RWW$UFK)HGHULFR,DFKHOOD(QJ6WHIDQR)DYD $UFK)DELR'DLQHOOL$UFK0LUNR0DULQR 'DOODOHWWXUDGHOO¶LQWRUQRGDOO¶DQDOLVLGHOOHUHOD]LRQLHGHLÀXVVLFKHVLJHQHUDQRDWWRUQRDSLD]]D,/,5,$VLqULOHYDWR che l’area allo stato attuale, rappresenta un vuoto urbano, uno spazio frammentato, quasi casuale fatto di suggestioni passate e senza nessuna relazione concettuale che leghi i diversi elementi. La piazza è parcheggio e snodo della YLDELOLWj/HGXH]RQHVLVWHPDWHDYHUGHDOFHQWURQRQVRQRVXI¿FLHQWLDGHWHUPLQDUQHLOUXROR,FRUSLGLIDEEULFDFKH si affacciano sullo spazio aperto non generano relazioni ne fronti capaci di determinarne i reali limiti.La sensazione immediata è quella di elementi che tentano di scivolare verso un centro ma che ne restano ai margini. 2%,(77,9, 5HDOL]]DUHXQEDULFHQWURYHUGHQHOODFLWWjXQHOHPHQWRIDWWRGLQDWXUDYLYRHGLQJUDGRGLPRGL¿FDUVLQHOWHPSRH nello spazio . Un sistema vivente e autonomo dal quale si generano tracciati verdi di distribuzione e di guida verso le DUHHSLHVWHUQHGHOODFLWWj ­ Trasformare i fronti esistenti ,da volumi costruiti in elementi naturali. *HQHUDUHXQ³ERVFRXUEDQR´FKHIDFFLDGDIRQGDOHFKHSURWHJJDGDLUXPRULGHOWUDI¿FRFKHVFKHUPLGDOFHPHQWRH riconnetta i margini. (VDOWDUHJOLHGL¿FLDWWHVWDQWLVXOODSLD]]DDWWUDYHUVRXQDQXRYDYHVWHFKHOLXQLIRUPLFKHOLPHWWDLQGLUHWWDUHOD]LRQH tra loro e li renda di immediata lettura da parte dei fruitori. ­ Collegare concretamente e concettualmente le emergenze archeologiche presenti . STRATEGIE 'DOORVWXGLRGHOVLVWHPDGHOYHUGHVLqULOHYDWRODQHWWDSUHGRPLQDQ]DGHOO¶HOHPHQWRFRVWUXLWRQHLFRQIURQWLGLTXHOOR naturale. La realizzazione del “ BARICENTRO “ verde proprio nella piazza centrale della città genera operatività lega­ te alla sensibilizzazione su questo tema, alla denuncia di bisogno di “ NATURA” all’interno dello spazio urbano. ',³1$785$´85%$1$SHUFKpQRQqYHUGHLQFRQWUROODWRSHUFKpQRQqVSRQWDQHRPDqO¶HOHPHQWRQDWXUDOHXWLOL]]DWR come materiale da costruzione, come generatore di pieni prospettici e non come semplice condimento marginale di VSD]LYXRWL JHQHUDWRGDOODFLWWj *OLHGL¿FLSLDOWLFKHLQFRPERQRVXOODSLD]]DVDUDQQRDQFK¶HVVLWUDVIRUPDWLLQRU­ JDQLVPLYHUGLDWWUDYHUVRLOULYHVWLPHQWRGHOOHIDFFLDWHFRQYHUGHYHUWLFDOH/¶HGL¿FLRGHO0XQLFLSLRLOSDOD]]RGHOOD&XO­ tura, la Prefettura e la Moschea devono esser relazionati con il vuoto costituito della nuova piazza, per questo si sono creati dei volumi trasparenti che li inglobano, con la doppia funzione di rinnovamento prospettico e di regolarizzazione compositiva. I nuovi volumi penetrano la piazza con decisione e ospitano funzioni di ristoro, giardini d’inverno, spazi HVSRVLWLYLWHPSRUDQHLHFF/DQRWWHGLYHQWDQRVXSSRUWLSHUHYHQWLVFKHUPLLQIRUPDWLYLDVFDODXUEDQD¿QRDQFKHDGL­ YHQWDUHFRPXQLFD]LRQHSXEEOLFLWDULD8QDSDVVHUHOODLQTXRWDFKHFROOHJDLGXHVLWLDUFKHRORJLFLGHOO¶DQ¿WHDWURURPDQR e del foro bizantino , rende concretamente attuata la connessione tra loro e genera un percorso altimetrico che lega JOLVSD]LOLPLWUR¿DOODPRVFKHD SLDOWL HODSLD]]D,OWUDI¿FRYHLFRODUHVDUjVSRVWDWRQHOVRWWRVXRORPDTXHVWRVROR per denunciare l’esigenza di non far percorrere la piazza alle auto. In fase di approfondimento potrebbe esser trovato XQSHUFRUVRDOWHUQDWLYRLQVXSHU¿FLH,QVLQWHVLLOSURJHWWRqJHQHUDWRGDOYHUGHFKHGLYHQWDIURQWHHPRGXODWRUHYLVLYR *OLHGL¿FLVLIDQQR³VWUDGD´WUDODYHJHWD]LRQHSHUIDUVHQWLUHLOSURSULRUXRORULVFRSHUWR 178 179 /DXQFKRI&RPSHWLWLRQ([LELWLRQDW0RLVLX7HDWKHULQ'XUUHVWK2FWREHUGXULQJWKH;)RUXPRI$GULDWLFDQG,RQLDQ&LWLHV La mostra relativa al bando di concorso nel Teatro Moisiu in occasione del X Forum delle Città dell’Adriatico e dello Ioni, Durazzo,28 ottobre 2008. 4 The second phase of competition/ La seconda fase del concorso 4.1 The project demand for the second phase of competition/ Le domande di progetto della seconda fase di concorso 1. Preliminary remarks 7KLVGRFXPHQWGH¿QHVSUHFLVHO\WKHSURFHHGLQJVRIWKHVHFRQGSKDVHRIWKH FRPSHWLWLRQIRUWKH5HYLWDOL]DWLRQRI,OLULDVTXDUHLQ'XUUHVDQGVRLWHQODUJHV DQGLQWHJUDWHVZKDWKDVEHHQODUJHO\GH¿QHGLQWKHLQLWLDOQRWLFHRIFRPSHWL­ tion, available at KWWSZZZLOLULDVTXDUHFRPSHWLWLRQRUJSDJLQHEDQGRJDUDKWPO This QRWLFHZLWKUHJDUGWRWKHSRLQWVSHFL¿HVWKDW “The groups admitted to the second phase of the competition are required WRSURGXFHDGH¿QLWLYHSURMHFWWRDSUHFLVHDQGGHWDLOHGVFDOHDFFRUGLQJWR DZRUNSURJUDPPHWKDWZLOOEHGH¿QHGDWWKHHQGRIWKH¿UVWSKDVHRIWKH FRPSHWLWLRQHYHQLQUHODWLRQZLWKWKHLGHDVDQGWKH¿UVWSURSRVDOVFROOHFWHG )LUVWRIDOOWKHSURMHFWLVH[SHFWHGWREHFDUULHGRXWLQQRIHZHUWKDQ tables A0 size, completed with a plastic to a suitable scale( no fewer than scale 1:500), a technical planning report with the necessary economical estimates and of feasibility. The groups admitted to the second phase of the competition have to declare at the moment of their acceptance for the participation at this phase of the competition the presence of the following SURIHVVLRQDO¿JXUHV 1. general architect 2. landscape architect 3. archaeologist 4. urban network engineer 5. expert of feasibility of urban projects 6. artist (visual arts and of communication)” 7KHVHJXLGHOLQHVRIWKH¿UVWSKDVHDUHFRQ¿UPHGDQGSUHFLVHO\GH¿QHGDW the following points. The groups admitted to the second phase of the competition are required to examine closely and improve the planning proposals, even in relation with the general or precise remarks of the jury of the competition written in WKH¿QDOPLQXWHV7KHUHLVDOVRWKHSRVVLELOLW\WRLQWURGXFHQHZHOHPHQWV DQGSURSRVDOVLQUHODWLRQZLWKWKH¿UVWSKDVHSURSRVDOVEXWUHVSHFWLQJWKHVH JXLGHOLQHVDQGWKRVHSURYLGHGE\WKH7HFKQLFDODQG6FLHQWL¿F&RPPLWWHHRI the second phase. 2. Innovation requested The second phase proposals ­except for the respect of the urban rules and their congruousness to the prescriptions of the Plan for the Central Area and WRWKHSURYLVLRQVRIWKH¿HOGWRGD\RSHUDWLQJDUHUHTXLUHGWRFRQFHQWUDWH attentively, more than the attention demonstrated in the initial plans, on the IROORZLQJHOHPHQWVRISODQQLQJLQQRYDWLRQDOUHDG\SDUWO\GH¿QHGLQWKHLQLWLDO notice of competition: a. the innovation of the technical administrative procedures even in relation with the acquisition of new private soils by the public property, the restitution of the illegal ones, the running and maintenance of public VSDFHVSURGXFHGDQGGH¿QHGE\WKHSURMHFW b. the innovation in the relationship between the preservation and enhancement of the historical and archaeological estate and the production of new public space, especially for the areas that have a monumental LQWHUHVWLQWKHFRPSHWLWLRQDUHDEXWDOVRIRUWKHQHZDUHDV c. the innovation in the promotion of public, pedestrian and cycle mobility V\VWHPVLQVLGHWKHVTXDUHDQGWKHFHQWUDOXUEDQDUHD d. the innovation referring to the materials, the techniques and the feasible procedures environmentally sustainable used in the plan. The International Jury of the competition will value the planning proposals of the second phase especially in relation with the four new elements of 182 1. Premessa Questo documento precisa l’iter procedurale della Seconda fase di Concorso della competizione internazionale per la Rivitalizzazione di Piazza Liria in 'XUD]]RDVYLOXSSRHLQWHJUD]LRQHGL quanto già stabilito nel bando iniziale di concorso, disponibile alla pagina (http://www.iliriasquarecompetition.org/pagine/ EDQGRJDUDKWPO e successive. Tale bando, al punto 13 (http://www.iliriasquarecompetition.org/pagine/13_Se­ FRQGDIDVHB&RQGL]LRQLGLDFFHVVR .html ) precisava che: “I gruppi ammessi alla seconda fase di concorso saran­ QRWHQXWLDSUHVHQWDUHXQSURJHWWRGH¿QLWLYR in scala accurata e di dettaglio, secondo un programma GLODYRURFKHYHUUjGH¿QLWRDOWHUPLQHGHOODSULPDIDVH di concorso, anche in relazione alle idee e alle prime proposte raccolte.In prima istanza, si prevede che tale progetto dovrà essere svolto in non meno di 5 tavole di formato A0, corredate da un plastico di scala adeguata (non meno di scala 1:500), di una relazione tecnico progettuale, corredata delle necessarie stime economi­ che e di fattibilità. I gruppi ammessi alla seconda fase di concorso dovranno dichiarare al momento della loro accettazione alla partecipazione di tale fase di concor­ VRODSUHVHQ]DGHOOHVHJXHQWL¿JXUHSURIHVVLRQDOL 1. architetto generalista 2. architetto paesaggista 3. archeologo 4. ingegnere delle reti urbane 5. esperto di fattibilità dei progetti urbani 6. artista (arti visive e della comunicazione) Tali indicazioni di prima fase sono confermate e meglio GH¿QLWHDLSXQWLVHJXHQWL I gruppi ammessi alla seconda fase del concorso sono tenuti ad approfondire e a migliorare le proposte progettuali presentate, anche in relazione alle osservazioni formulate dalla Giuria di &RQFRUVRQHOVXRYHUEDOH¿QDOHVLDGLFDUDWWHUHJHQH­ rale che riferite ai singoli progetti. E’ ammessa anche la possibilità di introdurre nuovi elementi e proposte rispetto alle proposte presentate in prima fase, nel rispetto però di tali indicazioni e di quelle fornite dal Comitato di Indirizzo Tecnico 6FLHQWL¿FRGLVHFRQGDIDVHGLFXLDSSUHVVR 2. Innovazione richiesta Le proposte di seconda fase ­ fatte salve il rispetto delle norme urbanistiche e la loro congruità alle prescrizioni del Piano per l’area Centrale e alle norma­ tive di settore attualmente operanti ­ sono tenute a concentrarsi con particolare attenzione, in misura maggiore di quanto dimostrato nei progetti iniziali, sui seguenti elementi di innovazione SURJHWWXDOHJLjLQSDUWHGH¿QLWLQHOEDQGR iniziale di concorso: a. l’innovazione delle procedure tecniche amministrati­ ve, anche in relazione all’acquisizione di nuovi suoli privati alla proprietà pubblica, alla restituzio­ ne di quelli occupati illegalmente, alla gestione e alla manutenzione degli spazi pubblici SURGRWWLHGH¿QLWLGDOSURJHWWR b. l’innovazione nel rapporto tra tutela e valorizzazione del patrimonio storico – archeologico e LQQRYDWLRQ7KHVHFULWHULDZLOOEHVXEMHFWRIVSHFL¿FZRUNVKRSVEHWZHHQWKH PHPEHUVRIWKH,QWHUQDWLRQDO-XU\DQG7HFKQLFDODQG6FLHQWL¿F&RPPLWWHH 3. Assignment to the planners of the second phase 7KH¿YHVHOHFWHGJURXSVIRUWKHVHFRQGSKDVHRIWKHFRPSHWLWLRQZLOOHQWHU into an agreement for the advisory assignment with the promoting body of WKHFRPSHWLWLRQ 'XUUHV0XQLFLSDOLW\ DWWKHEHJLQQLQJRIWKHVHFRQGSKDVH DFWLYLWLHV7KLVDVVLJQPHQWZLOOQHHGWKHGUDZLQJXSRIDGH¿QLWLYHSODQWREH presented with the following papers: 1. Plan and context. The table contains the general framing of the plan and other interpretative schemes useful to mark out the relations of the project with the context according to the urban and local scale, to scale 1:500, and sundry, in A0 size WDEOH 2. Soil plan. The table contains the general planimetry, scale 1:200, with the heights and SUREDEOHEXLOWXSHOHPHQWVZLWKVLJQL¿FDQWVHFWLRQVDQG SUR¿OHVSURVSHFWVDQGGHWDLOHGXUEDQVHFWLRQVLQFOXGLQJWKHPRQXPHQWV and the most prestigious buildings, scale 1:200 and sundry all composed on 2 tables A0 size, depending on the attached scheme. 3. Archaeology, green areas, urban landscape. The table contains the planimetric indication of the urban services, the archaeological areas and new excavation areas, with the indication of the expected interventions (enclosures, stop and travelling elements, street fur­ niture, communication systems and spreading of the property also with the green areas, the existent and planning line of trees and the environmental compatibility systems even in relation with the landscape and the context, in WKHFRUUHFWVFDOHV VFDOHVFDOHDQGVXQGU\  4. Planning details. The table contains the details of the built elements, of the street furniture elements, of the technical devices, of the urban services (network and servi­ FHV VFDOHDQGVXQGU\ 3ODQQLQJSUH¿JXUDWLRQV It is the table of tridimensional visions of the proposed intervention. The tables 4 and 5, except what explained in the previous points, have free composition and content, the tables 1, 2 and 3 will be drawn up in conformity ZLWKWKHVFKHPHVDQGWKHLGHQWL¿FDWLRQRIWKHVWXG\FRQWH[W Added to these drawings: D7KHWHFKQLFDOSODQQLQJUHSRUW b. The estimate of quantities of the expected works, eventually integrated with schemes and graphs for the calculation and the measurement of each SURSRVHGSODQQLQJXQLW c. The tridimensional plastic model of the project, scale 1:250, in relation with the intervention area of the second phase, by the delimitation enclosed. The technical planning report, written in 30 typewritten pages A4 format, and eventually integrated with drawings and schemes, will contain the following chapters: a. the expected innovation of the technical administrative procedures even in relation with the acquisition of new private soils by the public property, the restitution of the illegal ones, the running and maintenance of public spaces SURGXFHGDQGGH¿QHGE\WKHSURMHFW produzione di nuovo spazio pubblico, in particolare per le aree di interesse monumentale già presenti nell’area di concorso, e quelle di nuova FRVWLWX]LRQH c. l’innovazione nella promozione di sistemi di mobilità pubblica, pedonale e ciclabile, all’interno GHOODSLD]]DHGHOO¶DUHDXUEDQDFHQWUDOH d. l’innovazione in termini di materiali, tecniche e procedure realizzative ad elevata sostenibilità ambientale adoperate nel progetto. La Giuria internazionale di Concorso, valuterà le propo­ ste progettuali di seconda fase in relazione soprattutto ai quattro elementi di innovazione introdotti. 7DOLFULWHULVDUDQQRRJJHWWRGLVSHFL¿FLVHPLQDULGL lavoro e di partecipazione, tra i componenti della Giuria Internazionale e il Comitato di Indirizzo 7HFQLFR6FLHQWL¿FRGLFXLDSSUHVVR 3. Incarico ai progettisti di seconda fase I cinque gruppi selezionati per la seconda fase del Concorso saranno chiamati a stipulare all’inizio delle attività di seconda fase una convenzione per l’incarico di consulenza con l’Ente Banditore del Concorso (Co­ PXQHGL'XUD]]R 7DOHLQFDULFRULFKLHGHUjODUHGD]LRQH GLXQSURJHWWRGH¿QLWLYR nella forma dei seguenti elaborati: 1. Progetto e contesto. La tavola contiene l’inquadramento generale del progetto e ogni ulteriore schema interpretativo ritenuto QHFHVVDULRDTXDOL¿FDUHLUDSSRUWLGHOSURJHWWRFRO contesto alla scala urbana e locale, alla scala 1:500 e altre scale, su tavola in formato A0. 2. Progetto di suolo. La tavola contiene la planimetria generale di progetto, alla scala 1:200, con le quote e l’individuazione di HYHQWXDOLHOHPHQWLGLFRVWUXLWRFRQVH]LRQLHSUR¿OLVL­ JQL¿FDWLYLSURVSHWWLHVH]LRQLXUEDQHHGLGHWWDJOLRFRQ LQVHULPHQWRGHLPRQXPHQWLHGHJOLHGL¿FLGLPDJJLRU pregio storico culturale, alla scala 1.200 e varie, com­ posta su due tavole in formato A0, secondo lo VFKHPDDOOHJDWR 3. Archeologia, verde, paesaggio urbano. La tavola contiene l’indicazione planimetria delle opere a rete, dei sottoservizi, delle aree archeologiche e delle eventuali aree di nuovo scavo, con indicazione degli interventi previsti, (recinzioni, elemen­ ti di sosta e di percorrenza, arredi, sistemi di comuni­ cazione e divulgazione del patrimonio), comprensiva anche delle opere a verde, delle alberature esistenti e di progetto, e dei sistemi di compatibilità ambientale di progetto, anche in rapporto ai sistemi di paesaggio e al contesto, nelle VFDOHSLXWLOLHDSSURSULDWH VFDODHYDULH 4. Dettagli progettuali. La tavola contiene i particolari di dettaglio degli ele­ menti costruiti, degli elementi di arredo, dei dispositivi tecnici, delle apparecchiature urbane di servizio (reti e sottoservizi), scale 1:200, 1:100, 1:50, 1:20 e varie. 3UH¿JXUD]LRQLSURJHWWXDOL (¶ODWDYRODGHOOH9LVLRQLWULGLPHQVLRQDOLDFDUDWWHUH generale e di dettaglio dell’intervento proposto. Le tavole 4 e 5, fatto salvo quanto indicato nei punti precedenti, hanno composizione e contenuto libero, le tavole 1, 2 e 3 verranno redatte secondo gli schemi e O¶LGHQWL¿FD]LRQHGHLFRQWHVWLGLVWXGLRIRUQLWDLQDOOHJDWR $WDOLHODERUDWLJUD¿FLDQGUDQQRDJJLXQWL 183 b. the innovation in the relationship between the preservation and enhancement of the historical and archaeological estate and the production of new public space, especially for the areas that have a monumental inte­ UHVWLQWKHFRPSHWLWLRQDUHDEXWDOVRIRUWKHQHZDUHDV c. the innovation in the promotion of public, pedestrian and cycle mobility V\VWHPVLQVLGHWKHVTXDUHDQGWKHFHQWUDOXUEDQDUHD d. the innovation referring to the materials, the techniques and the feasible procedures environmentally sustainable used in the plan. e. the division of the project into intervention units, even in relation with their IHDVLELOLW\DQGWKHHFRQRPLFDQG¿QDQFLDOHQJDJHPHQWRIHDFKSODQQLQJ action, with schemes in scale 1:500 and sundry. All texts of the tables and drawings will be written in english. &RQVWLWXWLRQRID7HFKQLFDODQG6FLHQWLÀF&RPPLWWHH In order to carry out the activities of the second phase, a technical and VFLHQWL¿FFRPPLWWHHKDVEHHQHVWDEOLVKHG,WLVFRPSRVHGE\WKHIROORZLQJ persons: ,QJ$GULDQ&HODGHSX\PD\RURI'XUUHV 'U$IULP+RWLDUFKDHRORJLVW &KLHIUHVSRQVLEOHRIWKH8UEDQ2I¿FHRI'XUUHV0XQLFLSDOLW\ 3URI3LHUR5RYLJDWWL'$573HVFDUD8QLYHUVLW\ This Committee executes some important functions in the procedures of the VHFRQGSKDVHRIWKHFRPSHWLWLRQVXFKDVWKH¿QGLQJRIVWXGLHV LQIRUPDWLRQGDWDDQGFDUWRJUDSKLHVWKHSUHOLPLQDU\GH¿QLWLRQRIWKH FULWHULDRI¿QDOVHOHFWLRQRIWKHSURSRVDOVWKHFRRUGLQDWLRQDQGWKH organization of workshops between the planners, the citizens, the experts and the interested people involved in the program of the competition. This Committee avails itself of the collaboration of Sara Santoro, director of WKH,WDOLDQ$UFKDHRORJLFDO0LVVLRQLQ'XUUHVRI3DUPDXQLYHUVLW\ 5. Workshops The following workshops are expected: 1. meeting workshop with the city and its inhabitants 2. meeting workshop with the enterprises and the economic subjects active LQWKH¿HOGRIWKHXUEDQUHFRYHU\DQGQHZFRQVWUXFWLRQV 3. workshop with the representatives of the Institutions of protection and enhancement (institute of culture monuments, archaeological institute) and ZLWKWKHUHVHDUFKVWUXFWXUHVRSHUDWLQJLQWKH¿HOG (university, NGO, developing and international cooperation agencies). All these activities will be open to the citizens, in particular to the university students and to the technical secondary school students (building surveyors, master contractors) and so they will be public. The competitor groups are invited to participate at the single workshop ZLWKDWOHDVWRQHRIWKHLUGHOHJDWH7KHZRUNVKRSVFDOHQGDUZLOOEHGH¿QHG GXULQJWKH¿UVWPHHWLQJEHWZHHQWKHFRPSHWLWRUVDQGWKH7HFKQLFDODQG 6FLHQWL¿F&RPPLWWHHRIWKHFRPSHWLWLRQ 6. Awaited result of the second phase 7KHUHVXOWRIWKHVHFRQGSKDVHRIWKHFRPSHWLWLRQLVWRSURGXFHDGH¿QLWLYH SODQWKDWKDVWRUHVSHFWWKHFRQGLWLRQVRIHFRQRPLF¿QDQFLDOWHFKQLFDOSUR­ cedural and administrative feasibility and also the environmental and social endurableness. This project must also have clear elements of innovation compared to the previous criteria. The jury, by its unappealable judgement, can also decide not to award the ¿UVWSUL]HRIWKHFRPSHWLWLRQRUQRWWRH[HFXWHWKHZLQQHUSURMHFW(DFK decision is also up to the Mayor of the city and the competent Authorities of public works. 184 D/DUHOD]LRQHWHFQLFRSURJHWWXDOHGLSURJHWWR b. Il computo metrico estimativo di massima delle opere previste, eventualmente integrate da VFKHPLHJUD¿FLGLULIHULPHQWRSHULOFRQWHJJLRHOD PLVXUDGHOOHVLQJROHXQLWjGLSURJHWWRSURSRVWH c. il plastico tridimensionale di progetto, in scala 1:250, UHODWLYRDOO¶DUHDGLLQWHUYHQWRGH¿QLWDSHU la seconda fase, secondo la delimitazione in allegato. La relazione tecnico progettuale di progetto, dovrà contenere, all’interno della dimensione massima di 30 cartelle dattiloscritte in formato A4, eventualmente inte­ JUDWHGDHODERUDWLJUD¿FLHVFKHPLLVHJXHQWLFDSLWROL a. l’innovazione prevista delle procedure tecniche am­ ministrative, anche in relazione all’acquisizione di nuovi suoli privati alla proprietà pubblica, alla gestione e alla PDQXWHQ]LRQHGHJOLVSD]LSXEEOLFLSURGRWWLHGH¿QLWLGDO SURJHWWR b. l’innovazione prevista nel rapporto tra tutela e valorizzazione del patrimonio storico – archeologico e produzione di nuovo spazio pubblico, in particolare per le aree di interesse monumentale già presenti nell’area GLFRQFRUVRHTXHOOHGLQXRYDFRVWLWX]LRQH c. l’innovazione prevista nella promozione di sistemi di mobilità pubblica, pedonale e ciclabile, DOO¶LQWHUQRGHOODSLD]]DHGHOO¶DUHDXUEDQDFHQWUDOH d. l’innovazione in termini di materiali, tecniche e proce­ dure realizzative ad elevata sostenibilità ambientale adoperate nel progetto. e. l’Articolazione del progetto in unità di intervento, anche in relazione alla loro eseguibilità e all’impegno HFRQRPLFRH¿QDQ]LDULRSXEEOLFRGLRJQLVLQJRODD]LRQH di progetto, corredata da schemi in scala 1:500 e varie. Tutti i testi delle tavole e degli elaborati testuali saranno redatti in lingua inglese. 4. Costituzione di un Comitato di Indirizzo Tecnico 6FLHQWLÀFR $L¿QLGHOODPLJOLRUHVYROJLPHQWRGHOOHDWWLYLWjGLVHFRQ­ da fase, è costituito un Comitato di Indirizzo Tecnico 6FLHQWL¿FRFRPSRVWRGDOOHVHJXHQWLSHUVRQH ,QJ$GULDQ&HODYLFHVLQGDFRGL'XUD]]R LOUHVSRQVDELOHFDSRGHOO¶8I¿FLR8UEDQLVWLFRGHO&RPXQH 3URI3LHUR5RYLJDWWL'$578QLYHUVLWjGL3HVFDUD Tale Comitato svolge funzioni di indirizzo nelle proce­ dure di seconda fase del Concorso, attivandosi per il UHSHULPHQWRGLVWXGLLQIRUPD]LRQLGDWLHFDUWRJUD¿H per il migliore svolgimento della competizione, la GH¿QL]LRQHSUHOLPLQDUHGHLFULWHULGLVHOH]LRQH¿QDOH delle proposte, il coordinamento e l’organizzazione dei seminari di lavoro e di partecipazione tra i progettisti, i cittadini, gli esperti e i portatori di interesse coinvolti dal programma del concorso. Tale comitato si avvarrà anche della collaborazione della prof. Sara Santoro, GLUHWWRUHGHOOD0LVVLRQH$UFKHRORJLFD,WDOLDQDD'XUD]]R dell’Università di Parma. 5. Seminari di lavoro e di partecipazione Sono previsti i seguenti seminari di lavoro e di parteci­ pazione al progetto: :RUNVKRSGLLQFRQWURFRQODFLWWjHLVXRLDELWDQWL 2. Workshop di incontro con le imprese e i soggetti economici attivi nel campo del recupero urbano e delle QXRYHFRVWUX]LRQL 3. Workshop con i rappresentanti delle Istituzioni di 7XWHODHGL9DORUL]]D]LRQH ,VWLWXWRGHL0RQXPHQWLGL Cultura, Istituto Archeologico) e con le strutture di ricerca operanti sul campo (Università, NGO, agenzie di sviluppo e di cooperazione internazionali). Tutte queste iniziative saranno aperte alla partecipazione dei cittadini, in particolare degli studenti universitari e delle scuole superiori di settore (geometri, periti edili) ,GHQWL¿FDWLRQRIWKHWDEOH3ODQDQGFRQWH[WVFDOHDQGVXQGU\$IRUPDW ,GHQWL¿FD]LRQHWDYRODQ±3URJHWWRHFRQWHVWRVFDODHYDULHIRUPDWR$ ,GHQWL¿FDWLRQRIWKHWDEOH±6RLOSODQVFDOHDQGVXQGU\WDEOHV$IRUPDW ,GHQWL¿FD]LRQHWDYRODQ±3URJHWWRGLVXRORVFDODHYDULHVXGXHWDYROHIRUPDWR$ 185 7. Timing of the program The planners will be invited to take part at the various workshops organized in accordance with the following calendar: D)LUVWVHPLQDU2FWREHULQLWLDOPHHWLQJRIWKHVHFRQGSKDVH H[KLELWLRQDQGSXEOLFSUHVHQWDWLRQRIWKH¿UVWSKDVHSURMHFWVPHHWLQJZLWK WKHWRZQVSHRSOH b. second seminar: November 18, workshop with the representatives of the Institutions of Protection and Enhancement (Institute of Culture Monuments, Archaeological Institute) and with the research structures RSHUDWLQJLQWKH¿HOG 8QLYHUVLW\1*2GHYHORSLQJDQGLQWHUQDWLRQDO FRRSHUDWLRQDJHQFLHV  FWKLUGVHPLQDU'HFHPEHU¿QDOZRUNVKRSZLWKWKHPHHWLQJRIWKHWRZQZLWK its inhabitants, city associations and collective interest associations. The competitors will have to send to the competition secretariat, penalty their exclusion from the competition, all the materials of the competition(A0 size tables, texts and plastic models) by the deadline of Wednesday, January 28. The drawings will be put up on a rigid support such poliplat and must include the motto of the competition and the names of all members of the group of participation, according to the schedule attached. The presentation of the projects to the international jury will take place in public. The competitor groups are required to prepare a presentation on this matter together with visual and audiovisual, lasting up to 30 minutes. This presentation will be KHOGLQWKHJUHDWKDOORIWKH3DODFHRI&XOWXUHRI'XUUHVRQ7KXUVGD\-DQXDU\ 29. After this presentation the international jury will meet behind close doors to discuss the proposals and to agree on the draft winner of the competition. 7KHUHVXOWZLOOEHGHFODUHGE\WKH+RQRUDU\3UHVLGHQWRIWKHMXU\WKHPD\RU RI'XUUHVDWDSXEOLFFRQIHUHQFH Meeting Secretariat: ,QD;KDNRQL6SHFLDO2I¿FHIRUWKHSURMHFWVRIWKH2OG7RZQRI'XUUHV All tables will contain a cartouche marked on the bottom horizontal margin, containing, within a rectangular space high 6 cm and 841 cm long the headli­ ne of the competition, the title of the drawing, as indicated earlier, the motto of the competitor group and the names of all competitors in the group with WKHLUWHFKQLFDOSURIHVVLRQDOTXDOL¿FDWLRQV 'XUUHV7RZQKRPHQRYHPEHUDurazzo, sede municipale, novembre 2009 e avranno carattere pubblico. I gruppi partecipanti al Concorso sono inviati alla partecipazione ai singoli seminari con almeno un loro delegato. Il Calendario dei :RUNVKRSVDUjGH¿QLWRQHOFRUVRGHOODSULPDULXQLRQH tra i gruppi partecipanti e il Comitato di Indirizzo Tecni­ FR±6FLHQWL¿FRGHO&RQFRUVRVWHVVR 5. Esito atteso della seconda fase L’esito di questa seconda fase di concorso è TXHOORGLSURGXUUHXQSURJHWWRGH¿QLWLYRGLFXLVLDQR state accertate per intero tutte le condizioni di fattibilità HFRQRPLFR±¿QDQ]LDULDWHFQLFD procedurale e amministrativa, nonchè la sostenibi­ lità ambientale e sociale. Tale progetto deve inoltre contenere evidenti elementi di innovazione rispetto DLFULWHULSUHFHGHQWHPHQWHGH¿QLWL/D*LXULDDVXR insindacabile giudizio, può anche propendere per la non aggiudicazione del primo premio del Concorso, o, ancora, per la non eseguibilità del progetto eventualmente dichiarato vincitore. Ogni decisioni in tal senso compete inoltre al Sindaco della Città e alle autorità competenti in materia di opere pubbliche. 6. Tempistica del programma I progettisti saranno inviati a partecipare a seminari di lavoro, presumibilmente organizzati secondo il seguente calendario: a. primo seminario: 27 ottobre – Meeting iniziale di seconda fase, mostra e presentazione pubblica dei SURJHWWLGLSULPDIDVHLQFRQWURFRQODFLWWDGLQDQ]D b. secondo seminario: 18 novembre – Workshop con i UDSSUHVHQWDQWLGHOOH,VWLWX]LRQLGL7XWHODHGL9DORUL]­ zazione (Istituto dei Monumenti di Cultura, Istituto Archeologico) e con le strutture di ricerca operanti sul campo (Università, NGO, agenzie di sviluppo e di cooperazione internazionali). FWHU]RVHPLQDULRPHVHGLGLFHPEUH:RUNVKRS¿QDOH di incontro con la città e i suoi abitanti, associazioni cittadine, associazioni di interesse collettivo. I concorrenti dovranno far pervenire, pena la loro esclusione dal concorso, tutti i materiali di concorso (tavole in formato A0, testi e plastico) alla Segreteria Organizzativa del Concorso entro la data limite di mer­ FROHGuJHQQDLR*OLHODERUDWLJUD¿FLGRYUDQQRHVVHUH montati su supporto rigido tipo poliplat, e dovranno contenere l’indicazione del motto di concorso e i nomi­ nativi di tutti i componenti il gruppo di partecipazione, secondo lo schema in allegato. La presentazione dei progetti alla Giuria Internazionale avverrà in pubblico. I gruppi concorrenti sono tenuti a preparare al riguardo una presentazione corredata di immagini e di audiovisivi, della durata massima di 30 minuti. Tale presentazione verrà svolta QHOODVDODJUDQGHGHO3DOD]]RGHOOD&XOWXUDGL'XUD]]RLO JLRUQRJLRYHGuJHQQDLR'RSRWDOHSUHVHQWD]LRQHOD*LXULD Internazionale si riunirà a porte chiude per discutere delle proposte presentate e per concordare sul progetto vincitore della Competizione. Il risultato verrà proclamato da Presidente 2QRUDULRGHOOD*LXULDLOVLQGDFRGHOODFLWWjGL'XUD]]RLQ pubblica conferenza. Segreteria organizzativa del Meeting: ,QJ,QD;KDNRQL8I¿FLR6SHFLDOH3URJHWWL&LWWj9HFFKLD ,QJ3LHUR5RYLJDWWL'$57)DFROWjGL$UFKLWHWWXUDGL3HVFDUD Tutte le tavole conterranno un cartiglio apposto sul bordo inferiore, orizzontale delle tavole, contenente, all’interno di uno spazio rettangolare alto sei centimetri e lungo 841 centimetri, l’intestazione del concorso, il titolo dell’ elaborato, secondo le indicazioni precedenti, il motto del gruppo concorrente e i nomi di tutti i con­ FRUUHQWLGHOJUXSSRFRQOHULVSHWWLYHTXDOL¿FKHWHFQLFR professionali. 186 Title of Competition, available at web page/Intestazione del concorso, scaricabile alla pagina: http://www.iliriasquarecompetition.org/image/bookmark.jpg Project area for plastic model, A0 format/ 1:500 ,GHQWL¿FD]LRQHDUHDGLSURJHWWRSHULOSODVWLFRIRUPDWR$ scala 1:500 187 4.2 The ancient monuments around the square/ I monumenti antichi intorno alla piazza 1. The Roman amphitheater The current situation The monument has been brought to light for almost 2/3, but the DUHQDLVVWLOOLQYDGHGE\WKHFROOXYLWKDWIRUFHQWXULHVKDV¿OOHGWKH basin. The south east third is occupied by buildings, partially forming a urban calc, partially illegal (especially the most recent ones). The excavations of the Italian Mission are located in the southern portion, which in 2004 has been freed from some ruined buildings after their demolition. A street surrounds the building on the western portion, going up to the level of the upper gallery (the third). Even heavy vehi­ cles drive it to access the houses at the hill of the castle, without any consideration for the danger of passing on empty galleries wich have been clearly highlighted by the Mission’s geophysical perspections. Several restoration work has been made until now: those following the discovery of 1966, whose limits are generally marked by advertising glass splinters, but wich also closed some galleries too full of rubble WREXLOGDSXEOLFZDONZD\VDIHO\WKRVHRIE\1$72IRUFHVZKLFK were not limited to cleaning of the arena but did also some consoli­ dation, and those really unfortunate in 2003, operated by the Institute RI0RQXPHQWVRI&XOWXUHXQGHUWKHGLUHFWLRQRI.DUDMVNDMDQGUHVWRUHU .0LKRZKRKDYHGLVWRUWHGWKHLPDJHRIWKHFDYHDZLWKSDWFKLQJFH­ PHQWDUWL¿FLDOO\FRORUHGUHEXLOGLQJIDQWDV\YDXOWHGURRIVLQWKHWXQQHOV including the northern main gallery, obliterating or altering irreversibly WKHDUFKDHRORJLFDOVWUXFWXUHVPRUHFRQ¿QHGDQGSXQFWXDOUHVWRUDWLRQ was conducted in 2007­2008 by the Institute of Monuments of Cultu­ re, to sustain some vaults and channel the waters of the upper road to prevent them unloading into the monument. Still serious conservation problems remain:most of all the stagnation of water above the arena and in the lower gallery, water coming from the percolation of the whole monument that acts like a big bowl of rainwater. This water puts at serious risk the Byzantine mosaics of the chapel and the structures found at lower altitudes. IGM 1928, the footprint of amphitheatre in the topography/ ,*0O¶LPSURQWDGHOO¶DQ¿WHDWURQHOODWRSRJUD¿DGHOODFLWWj Barbara Sassi (*) /·DQÀWHDWURURPDQR La situazione attuale Il monumento scavato è in luce per quasi i 2/3, ma l’arena è ancora invasa dalla terra dei colluvi che nei secoli hanno riempito l’invaso. Il terzo VXGRULHQWDOHqRFFXSDWRGDHGL¿FLLQSDUWHFRVWL­ tuenti un calco urbano, in parte abusivi (soprat­ tutto gli annessi recentissimi). Gli scavi archeo­ logici della Missione Italiana sono nella porzione meridionale, che nel 2004 risultava libera da HGL¿FLGRSRFKHDOFXQHIDWLVFHQWLFRVWUX]LRQLHUD­ QRVWDWHGHPROLWH8QDVWUDGDFLUFRQGDO¶HGL¿FLR VXOODSRU]LRQHRFFLGHQWDOHVDOHQGRLQTXRWD¿QR al livello della galleria superiore (la terza). La per­ corrono automezzi anche pesanti, per accedere alle case poste sulla collina del castello, senza alcuna considerazione del pericolo di passare VXJDOOHULHFDYHFKHOHSURVSH]LRQLJHR¿VLFKH realizzate dalla Missione hanno con chiarezza HYLGHQ]LDWR'LYHUVLJOLLQWHUYHQWLGLUHVWDXUR¿Q qui operati: quelli successivi alla scoperta del 1966, i cui limiti sono in genere evidenziati sulle pareti con inserzioni di schegge di vetro, ma che richiusero anche alcune gallerie troppo piene di macerie, per costruire un percorso pubblico in VLFXUH]]DTXHOOLGHODGRSHUDGHOOHIRU]H armate Nato, che non si limitarono ad una pulitura dell’arena ma operarono anche alcuni interventi di FRQVROLGDPHQWRTXHOOLGHORSHUDWLGDOO¶,VWL­ tuto dei Monumenti di Cultura sotto la direzione di .DUDMVNDMHGHOUHVWDXUDWRUH.0LKRFKHKDQQR snaturato l’immagine della cavea con rappezzi di FHPHQWRDUWL¿FLDOPHQWHFRORUDWRKDQQRULFRVWUXLWR di fantasia coperture voltate nelle gallerie, com­ presa quella settentrionale principale, obliterando RPRGL¿FDQGRLQPRGRLUUHYHUVLELOHOHVWUXWWXUH DUFKHRORJLFKHSLOLPLWDWLHSXQWXDOLLQWHUYHQWLGL restauro condotti nel 2007­2008 dall’Istituto dei Monumenti di Cultura, per puntellare alcune volte e convogliare le acque della strada superiore in modo da non scaricarle dentro il monumento. Permangono gravi problemi di conservazione: soprattutto il ristagno d’acqua nell’arena e nella galleria inferiore, acqua che proviene dalla perco­ lazione dell’intero monumento che funziona come un grande catino di raccolta delle acque piovane. Quest’acqua mette a grave rischio i mosaici della cappella bizantina e le strutture che si trovano DOOHTXRWHSLEDVVH La scoperta Casuale, nel 1966, fu seguita da una grandiosa FDPSDJQDGLVFDYRFRQGRWWDGD97RoLFKHOLEH­ rò parte dell’arena e della cavea, vuotando anche alcuni tratti di gallerie. Gli scavi italo­albanesi 188 The discovery By chance, in 1966, it was followed by a huge excavation conducted E\97RFLZKROLEHUDWHGSDUWRIWKHDUHQDDQGDXGLWRULXPHPSWLQJ some sections of the tunnels. The Italo­Albanian excavations began in 2004 in the southern sector, and in 2008 a sondage was made on the great Northern gallery too. The topographic and architectural map with total station, the structural and conservative state analysis, the design of restoration and refun­ ctionalization have been made by the Italian Mission in collaboration ZLWKWKH)DFXOW\RI$UFKLWHFWXUHLQ3DUPDLQD,QWHUOLQNSURMHFW DOO materials can be seen on www. progettodurres.unipr.it). Description 7KH$PSKLWKHDWUHRI'XUUHVLVRQHRIWKHODUJHVWLQWKH%DONDQWKH only one in Albania, one of the largest in the Mediterranean (after the &ROLVHXP9HURQD3ROD ,WZDVEXLOWLQWKHPDUJLQVRIWKHXUEDQDUHD near the port, as was usual for the Romans to prevent public order problems caused by crowds of spectators. Actually it’s tangential to WKHZDOOVZKLFKZHUHFRQVWUXFWHGDIWHULWVGHIXQFWLRQDOL]D¤WLRQSDUWLDO­ ly overlapping it, as it has been revealed by geophysical exploration. It has a complicated geometry: partially it lays on the hill with a gallery V\VWHPWKDWVHHPVQRWV\PPHWULFDOWKHQRUWKHUQ*UHDWJDOOHU\LV nowadays a dead en, but it must have been an exit: today is obstruc­ WHGE\DPDVVRIHDUWKZKLFK¿OOHGWKHJDOOHU\DIWHUODQGVOLGHWKDW FDPHGRZQGURPWKHWRSRIWKHFDVWOHDQG¿OOHGWKHHQWLUHPRQXPHQW A large southern gallery, symmetrical to the northern one, has been excavated in the Italian­Albanian but not to ground level. The geophysical surveys showed the presence in the arena, a series RISDUDOOHOWXQQHOVRQZKLFKZDVSUREDEO\SODFHGWKHÀRRURIWKHDUH­ na, perhaps a wooden one. The same exploration indicate the presen­ ce of radial tunnel in the part of the amphitheater that lays on the hill, under the street and right under the houses in the north western part. sono iniziati nel 2004, nel settore meridionale, e nel 2008 hanno interessato con un saggio di scavo anche la grande galleria settentrionale. ,OULOLHYRWRSRJUD¿FRHDUFKLWHWWRQLFRFRQWRWDOVWD­ tion, l’analisi strutturale e dello stato conservativo, la progettazione del restauro e della rifunzionaliz­ zazione sono stati realizzati dalla Missione Italia­ QDLQFROODERUD]LRQHFRQOD)DFROWjGL$UFKLWHWWXUD di Parma, nell’ambito di un progetto Interlink (tutti i materiali in www. progettodurres.unipr.it ). Descrizione /¶DQ¿WHDWURGL'XUD]]RqXQRGHLSLJUDQGLGHL %DOFDQLO¶XQLFRLQ$OEDQLDXQRGHLSLJUDQGLGHO 0HGLWHUUDQHR GRSRLO&RORVVHR9HURQD3ROD  È stato costruito a margine dell’area urbana, in prossimità del porto, come era abitudine dell’urbanistica romana per evitare problemi di ordine pubblico dovuti alla folla degli spettatori. Attualmente si trova tangente alle mura che tut­ tavia furono costruite successivamente alla sua defunzionalizzazione ed anzi si sovrappongono SDU]LDOPHQWHDOO¶DQ¿WHDWURFRPHKDQQRULYHODWROH SURVSH]LRQLJHR¿VLFKH+DXQDJHRPHWULDFRPSOL­ cata: è appoggiato parzialmente alla collina, con un sistema di gallerie che sembra non simmetri­ FRODJUDQGHJDOOHULDVHWWHQWULRQDOHDWWXDOPHQWH è senza uscita, ma doveva averla: oggi è ostruita da un imponente riempimento di terra, colluviata all’interno a causa di una colossale frana che, distaccandosi dalla cima del castello, riempì tutto il monumento. Una grande galleria meridionale, simmetrica a quella settentrionale, è stata messa LQOXFHGDJOLVFDYLLWDORDOEDQHVLPDQRQ¿QRDO OLYHOORGLEDVH/HSURVSH]LRQLJHR¿VLFKHVHJQDOD­ no la presenza, nell’arena, di una serie di gallerie parallele, di servizio, sulle quali era probabilmen­ te posto il piano dell’arena stessa, forse in legno. 189 $IWHULWVFRQVWUXFWLRQSUREDEO\LQWKH¿UVWKDOIRIWKHVHFRQGFHQWXU\ $'LWZDVJUHDWO\GDPDJHGIURPWKHHDUWKTXDNHRI5HVWRUHG it was used only for venationes, and gradually fell into disuse until it was not only unused by the Byzantine wall circuit (built between DQG$' EXWDOVRRFFXSLHGE\SRRUKRXVLQJFHPHWHULHVDQG christian chapels, including the western one which was also enriched by mosaics. In its southern portion, these houses, warehouses and production ac­ WLYLWLHV JODVVZDUH RIWKH¿UVW0LGGOH$JHVZKHUHUHSODFHGDURXQGWKH ¿UVWKDOIRIWKHWZHOIWKFHQWXU\E\DIRUWL¿HGEXLOGLQJWKDWFROODSVHGGX­ ring the earthquake of 1270 but was then rebuilt using the same walls which, once raised again, continued to be used for house building until the house demolition in 2003. Quote: Currently the roadway surrounding the monument in the sou­ WKHUQSRUWLRQLVDERXWPRQWKHVHD7KHÀRRURIWKHDUHQDLVDERXW 6 m on the sea. 6L]HPDMRUD[LV FXUUHQW PSUHVHUYHGKHLJKWPDVVXP­ ptions 15­20000 spectators. 'DWHVHFRQGFHQWXU\$'EHWZHHQDQG$' 5HLJQVRI 7UDMDQDQG+DGULDQ 5HVWRUDWLRQDIWHUWKHHDUWKTXDNHRI$' substantive amendments after that of 522. Access to the amphitheater and the southwest side of Liria Square The current situation A large stone staircase in two ramps links the square ­ at the begin­ ning of the Boulevard ­ and the top level of the narrow road that sur­ rounds the amphitheater and that is the penultimate upper ring of the same. To the right of the stairs, going up between this and the Turkish walls that descend from the castle, there is a space “gardened” where Amphitheater: aerial sight , 2005$Q¿WHDWURYHGXWDDHUHD Le stesse prospezioni indicano la presenza di JDOOHULHUDGLDOLDQFKHQHOODSDUWHGHOO¶DQ¿WHDWUR DSSRJJLDWDDOODFROOLQDVRWWRODVWUDGDH¿QVRWWR OHFDVHGHOVHWWRUHQRUGRFFLGHQWDOH'RSROD sua costruzione, avvenuta probabilmente nella prima metà del II sec. d.C., subì pesanti danni dal terremoto del 346. Restaurato, fu però adibito solo a venationes, e cadde progressivamente LQGLVXVR¿QRDGHVVHUHQRQVRORXWLOL]]DWRGDO circuito murario bizantino (costruito fra 500 e 530 d.C.) ma anche occupato da povere abitazioni, cimiteri e cappelle di culto cristiano, fra cui quella occidentale dotata anche di mosaici. Nella sua porzione meridionale, queste abitazioni, magazzini e attività produttive (vetreria) altome­ dievali furono rimpiazzate, nella prima metà del XII sec. da un palazzo, che crollò per il terremoto GHOPDIXSRLULHGL¿FDWRXWLOL]]DQGROHVWHVVH murature, che, rialzate, continuarono a costituire XQ¶DELWD]LRQHLQXVR¿QRDOODGHPROL]LRQHGHO 2003. Quota: attualmente la sede stradale che circonda il monumento nella parte meridionale si trova a circa 10 m s.l.m. Il piano dell’arena si trova a circa 6 m s.l.m. 0LVXUHDVVHPDJJLRUH DWWXDOH PDOWH]]D FRQVHUYDWDPLSRWHVLGLVSHWWDWRUL 'DWD]LRQH,,VHFG&IUDHG& UHJQL di Traiano e Adriano). Restauri dopo il terremoto GHOPRGL¿FD]LRQLVRVWDQ]LDOLGRSRTXHOORGHO 522. $FFHVVRDOO¶DQ¿WHDWURHODWRVXGRYHVWGLSLD]]D Liria. La situazione attuale Una larga scalinata in pietra articolata in due ram­ pe congiunge la quota della piazza ­ all’inizio del Amphitheater: Architectural survey$Q¿WHDWURULOLHYRGLUHWWR 8QLYHUVLWjGL3DUPDSURI*LDQGHELDJL you can see a short section of wall of the amphitheater, bordered to WKHQRUWKDQGGRPLQDWHGE\DKHQKRXVHUHOHYDQWWRWKH¿UVWKRXVH overlooking the amphitheater narrow street. This space is used as a dump by the inhabitants of the neighborhood, partially obscured by some boxwood bushes. A large palm tree is located in the margins of this space, with a steep slope that descends to the level of the square. currently a butcher shop and other gates and one storey houses face the left side of the stairs, , the latter of which opens directly on one of the wedges of the amphitheater, brought to light by excavation, EH\RQGDIHQFHUHFHQWO\PDGHRILURQZKLFKGH¿QHVWKHDUHDRIUHOH­ vance of the amphitheater and consequently the responsibility of the Institute of Monuments of Culture. The discovery The Excavations of the Italian Archaeological Mission 2007 The access to the amphitheater actually is the square, at the beginning of the Boulevard, through the narrow stairs described in the previous paragraph. Such access is evidently quite alien to the structure of the ancient monument, whose level was probably even lower than the current level of the square and the boulevard. This level is due to the landslide of the castle hill, whose layers of colluvio DUULYHXQWLOWKHEHJLQQLQJRI9LD+7URSOLQLZLWKPDUNHGGLIIHUHQFHVLQ level on the eastern edge of the square. The ancient entrance to the DPSKLWKH¤DWHUPXVWEHDWLWVEDVHOHYHOSUREDEO\RQWKHHDVWVLGHRI the building, so it is now buried under the curve road which is actually the urban calc of the structure in its area. Boulevard ­ con il livello superiore della stretta VWUDGDFKHFLUFRQGDO¶DQ¿WHDWURHFKHFRUULVSRQGH al penultimo anello superiore dello stesso. A de­ stra della scalinata, salendo, fra questa e le mura turche che scendono dal castello, è uno spazio a “giardino” dove è visibile un breve tratto di PXURGHOO¶DQ¿WHDWURVRYUDVWDWRHGHOLPLWDWRYHUVR nord da un pollaio pertinente alla prima casa che DIIDFFLDVXOODVWUDGHWWDGHOO¶DQ¿WHDWUR4XHVWR spazio è usato come discarica dagli abitanti del quartiere, parzialmente occultata da alcuni cespugli di bosso. Una grande palma si trova a margine di questo spazio, che scende con una forte pendenza verso il livello della piazza. Sul lato sinistro della scalinata affaccia attualmente una macelleria ed altri portoni e case ad un pia­ no, l’ultima delle quali dà direttamente su uno dei FXQHLGHOO¶DQ¿WHDWURULPHVVLLQOXFHGDJOLVFDYLDO di là di una recinzione recente, realizzata in ferro, FKHGHOLPLWDO¶DUHDGLSHUWLQHQ]DGHOO¶DQ¿WHDWURH conseguentemente di competenza dell’Istituto dei Monumenti di Cultura. La scoperta Scavi della Missione Archeologica Italiana 2007 'HVFUL]LRQH$FFHVVRDOO¶DQ¿WHDWUR /¶DFFHVVRDOO¶DQ¿WHDWURDYYLHQHRJJLDQFKHGDOOD piazza, all’inizio del Boulevard, attraverso la scala descritta nel paragrafo precedente. Tale accesso è evidentemente del tutto estraneo alla struttura antica del monumento, la cui quota di EDVHHUDSUREDELOPHQWHDQFRUSLEDVVDGHOOD quota attuale della piazza e del Boulevard. Tale quota risente infatti del franamento della collina 191 The Turkish walls The wall in the garden In the green space between the staircase and the turkish walls that come down from the castle, in 2007 was conducted a test excavation E\WKH,WDOLDQ$UFKDHRORJLFDO0LVVLRQDQGWKH'HSDUWPHQWRI$UFKDHR­ ORJ\RI'XUUHVWRXQGHUVWDQGLIWKH\ZHUHDFWXDOO\WKHDPSKLWKHDWHU¶V outer wall and if it had a arcade gallery outwards. The excavations revealed that this is actually the outer wall of the amphitheater,built in opus coementicium with brick facing, whose surface is divided into a big lesena or a semicolumn plith, which nevertheless has a clear structural discontinuity with the curve wall. Its brick face has been entirely removed during the Middle Ages or the Turkish Age, and DUWL¿FLDOEUHDNVZHUHPDGHWRKRVWRQWKH5RPDQVWUXFWXUHEXLOGLQJV or building elements and relining clearly realized in the Middle Ages. Even toward the amphitheater, the wall is intentionally razed. North of the wall, excavations brought to light the walls of a building, probably PHGLHYDO WKLUWHHQWK¿IWHHQWKFHQWXU\ EXLOWZLWKDOLWWOHVWRQHDVKODU masonry linked by mortar, interrupted by wooden boards in order to keep the resilience of the wall, a technique thath was well known in 'XUUHVDQGJHQHUDOO\LQ$OEDQLD VHHHJWKHZDOORIWKH%\]DQWLQH monastery of Apollonia). The building is obviously in slope. Lower, but almost parallel to the building, the wreck of the wall which is still visi­ ble, even if covered by concrete, also appears belonging to the middle ages, considering the building techniques. These walls seem to draw a system of apartment buildings placed at different heights on the hill, EXWLWGRHVQRWDSSHDULQ+HX]H\DQG'DXPHWPDSVZKHUHWKLVDUHD VHHPVHPSW\+HX]\¶VPDSKRZHYHULVHYLGHQWO\DK\EULGEHWZHHQD map and a bird’s eye view of the entire territory, and therefore is out of scale and lack of detail regarding the urban environment. In the following cartography, in 1928, this space appears as a continuous The north wall of theamphitheater ,OPXURQRUGGHOO¶DQ¿WHDWUR 192 GHOFDVWHOOROHFXLFROWULGLFROOXYLJLXQJRQR¿QR all’inizio di via Troplini, con marcati dislivelli sul margine est della piazza. L’ingresso antico DOO¶DQ¿WHDWURGHYHHVVHUHDOODVXDTXRWDGLEDVH SUREDELOPHQWHDQFKHVXOODWRHVWGHOO¶HGL¿FLRHGq quindi oggi sepolto sotto la strada curvilinea che FRVWLWXLVFHLOFDOFRXUEDQRGHOSHULPHWURGHOO¶HGL¿­ cio nel suo settore. Le mura turche Il muro nel giardino Nello spazio verde, fra la scalinata e le mura turche che scendono dal castello, nel 2007 è stato condotto un saggio di scavo da parte della 0LVVLRQH$UFKHRORJLFD,WDOLDQDHGHO'LSDUWL­ PHQWRGL$UFKHRORJLDGL'XUD]]RSHUDFFHUWDUH se si trattasse effettivamente del muro esterno GHOO¶DQ¿WHDWURHVHIRVVHGRWDWRGLXQDJDOOHULD porticata verso l’esterno. Gli scavi hanno messo in luce che si tratta effettivamente del muro HVWHUQRGHOO¶DQ¿WHDWURLQRSXVFRHPHQWLFLXP FRQSDUDPHQWRLQODWHUL]LRODFXLVXSHU¿FLH è articolata in una grossa lesena o base di semicolonna addossata, che tuttavia presenta un’evidente discontinuità strutturale rispetto alla parete curva. Il paramento in laterizio di questa è stato interamente asportato in epoca medievale o turca, e sono stati praticati scassi per appoggiare DOODVWUXWWXUDURPDQDHGL¿FLRHOHPHQWLHGLOL]L e rifoderature di chiara impronta medievale. $QFKHYHUVRO¶DQ¿WHDWURLOPXURDSSDUHUDVR intenzionalmente. A nord del muro, lo scavo ha PHVVRLQHYLGHQ]DLPXULSHULPHWUDOLGLXQHGL¿FLR SUREDELOPHQWHPHGLHYDOH ;,,,;9VHF FRVWUXLWR con una tecnica muraria in piccoli conci lapidei legati da malta, con inserimenti di assi di legno orizzontali per garantire elasticità alla muratura, WHFQLFDEHQFRQRVFLXWDVLDD'XUD]]RFKHLQ Plan of excavation / Rilievo sul campo 5H\¶VSODQZLWKVXUYH\DQG³LQIURQWRIPRVTXHH´ 5(< 3ODQLPHWULDGL5H\FRQ LQGLFD]LRQHGHLVRQGDJJLH³GDYDQWLDOODPRVFKHD´ 5(<  Below on the left: 7KHH[FDYDWLRQLQSURJUHVV 5(< ,VRQGDJJLLQFRUVRGLVFDYR 5(< building, which incorporates the Turkish section of wall that descends from the castle to the mosque, facing the boulevard which was then, recently made. Quote: the crest of the northern wall of the amphitheater is about 15m on the sea Measures: the wall of the amphitheater is approximately 1.80 m wide, the average medieval walls 0.90 m. 'DWHWKHZDOORIWKHDPSKLWKHDWHUVHFRQGFHQWXU\$'ODWHUVSROLD­ WLRQDQGUHEXLOWLQJ0LGGOH$JHXQWLOWKHHQGRI;9 2 ­ The lost basilica In his article on “Albania” 1 of 1925, L. Rey cites the results of exca­ YDWLRQVFRQGXFWHGE\WKH)UHQFKDUFKDHRORJLFDOPLVVLRQLQ'XUUHV,Q particular, relatively to the Survey 5, in front of the mosque, he reports WRKDYHIRXQGDWWKHKHLJKWRIPRQWKHVHDDWRPEDQGDÀRRU of a Byzantine church. The text makes some confusion between the survey 5 results and the results of Survey 4, which is located in the plan east of Goga Street, but it tells that the survey is located in front of the mosque. Also the picture, whose caption says that belongs to the basilica found outside the mosque, evidently has a structure with an apse that is not ­3 m depth. On the other hand it seems to recognize the open space of the square and, on the bottom, the small building on the eastern side which we know from former or contempo­ rary pictures. The fact remains that, on the western side of the square in front of the mosque, remains of a Byzantine church were found. generale in Albania (vd. per es. il muro di cinta GHOPRQDVWHUREL]DQWLQRGL$SROORQLD /¶HGL¿FLR HUDLQHYLGHQWHSHQGLR3LLQEDVVRPDTXDVL SDUDOOHORDOO¶HGL¿FLRLOUHOLWWRGLPXURFKHDQFRUD HPHUJHLQVXSHU¿FLHSHUTXDQWRRUDFRSHUWRGD uno strato di cemento, sembra anch’esso almeno medievale per tecnica costruttiva. Questi muri VHPEUDQRGLVHJQDUHXQVLVWHPDGLHGL¿FLDELWDWLYL posti a diverse quote sulla collina, che però non FRPSDUHQHOOHFDUWHGL+HX]H\H'DXPHWGRYH TXHVW¶DUHDVHPEUDSULYDGLHGL¿FL/DFDUWDGL +HX]H\WXWWDYLDqHYLGHQWHPHQWHXQLEULGRIUD XQDFDUWDWRSRJUD¿FDHXQDYLVLRQHDYRORGL uccello dell’intero territorio, e dunque è fuori scala HSRFRGHWWDJOLDWDSHUTXDQWRULJXDUGDO¶HGL¿FDWR XUEDQR1HOODVXFFHVVLYDFDUWRJUD¿DGHO TXHVW¶DUHDDSSDUHFRPHXQHGL¿FDWRFRQWLQXR che ingloba il tratto di mura turche che scende dal FDVWHOORJLXQJH¿QRDOODPRVFKHDFRQXQOXQJR affacciamento continuo sul Boulevard che era, all’epoca, di recentissima realizzazione. 4XRWDODFUHVWDGHOPXURQRUGGHOO¶DQ¿WHDWURqD circa 15 m slm 0LVXUHLOPXURGHOO¶DQ¿WHDWURqODUJRPFLUFD le murature medievali mediamente 0,90 m 'DWD]LRQHSHULOPXURGHOO¶DQ¿WHDWUR,,VHFG& rifacimenti e spogli successivi di epoca medievale H¿QRDOOD¿QHGHO;9VHF 2­ La basilica scomparsa Nel suo articolo su “Albania” 1 del 1925, L. Rey cita i risultati di alcuni scavi condotti dalla PLVVLRQHDUFKHRORJLFDIUDQFHVHD'XUD]]R,Q particolare, relativamente al Sondaggio 5 davanti alla moschea, segnala di aver rinvenuto a ­3,10 m una tomba e la pavimentazione di una chiesa bizantina. Il testo fa una certa confusione fra i risultati del Sondaggio 5 e quelli del Sondaggio 4, che in pianta è collocato a oriente dell’attuale via Goga, ma che nel testo si dice essere posto da­ vanti alla moschea. Inoltre la foto, che la didasca­ lia dice essere della basilica trovata davanti alla moschea, evidentemente presenta una struttura DEVLGDWDFKHQRQqFHUWRDPGLSURIRQGLWj'¶DO­ tra parte sembra di riconoscere lo spazio aperto GHOODSLD]]DHVXOIRQGRLOEDVVRHGL¿FLRGHOODWR orientale della stessa che conosciamo da alcune DOWUHIRWRJUD¿HSUHFHGHQWLRFRQWHPSRUDQHH Resta comunque il fatto che, sul lato occidentale della piazza, davanti alla moschea, furono trovati resti di una chiesa bizantina. 193 3 – The “Macellum­forum” or the “round forum” The current situation The monument is visible from the main road, towards which is 2.50 m lower. It is partially excavated, as a wester portion remains under the road and a northern portion (the part of the stores) was destroyed du­ ring the construction of a large residential building. Also the southwest portion is hidden under the walkway connecting the street to Rruga A. Goga. The area of the monument is now covered by a water pipe ³À\LQJ´WKDWFURVVHVWKHVWUXFWXUHIURPZHVWWRHDVWUHVWLQJRQZDOOV in the easternmost part. The monument is accessible by a stairway from the main road. To enter it’s necessary to contact the Atelier of Monuments of Culture. It is surrounded by an iron rail, easy to climb over. Actually it is lost every connection, which anyway had to exist, with the baths to the south and with another archaelogical area east of it, where now there is a blocked construction site. The area to the south is still green, and maintains one of the few authentic Turkish coffee, with tables in the garden, as well as a public latrine dated of the eighteenth century by the local scholars. In 2006/2007 had been set down a “revitalization project” which aimed to lean on the walls of antique shops a metal frame structure, which would support a wood RUJODVVÀRRUWRKRVWWKHUHFHSWLRQ WKHWHUUDFHRIDEDU 7KLVDWWHPSW was blocked by the supervisory authorities and the public pressure. The metal frame remained. In 2006, a classical music concert was held in the circular forum, but without much succes. A panel set up for WKHH[KLELWLRQ³'XUUHV\HDUVRIFLYLOL]DWLRQ³ZDVUHORFDWHGDQG removed several times. The discovery UHVFXHH[FDYDWLRQV GHSWKGLUHFWLRQ$IULP+RWL DQGVRXWKSRUWLFXVDQGWZRVKRSV 'DQG( VRXWKZHVW 3. 2005: survey north of the podium 'HVFULSWLRQ1RWHGDWDDQGSODQVOLVWHGEHORZDUHIURPOLWHUDWXUHRQWKHPRQXPHQW Plans were not made of this monument by the Italian Archaeological Mission The square and the porticus The monument consists of a round porticus, enclosing a cobbled square in the center of which theren is a circular podium. Outside the porticus, there is a series of structures interpreted as shops, some of them with a basement reacheable by stairs. The porticus has a width of 5.30 meters. A low wall in opus incertum bounded with mortar ZRUNVDVSOLQWKRIWKHFRORQQDGHLWGLYLGHVWKHVSDFHLQWRWZRGLIIHUHQW areas, one of circulation (porticus) and one of halt (square). In the outer ring it seems to open a corridor to access the square, perfectly oriented east­west and with a drainage channel, which is actually open but surely it was closed by the former pavement: this access se­ ems to indicate a north­south oriented building, and has supported the hypothesis that the entire urban plan of the city was oriented north­ south. The plinth of the columns is covered with rectangular slabs of limestone (average size 110x 80x17 cm). On the base are placed the plinths of the columns (20 those variously found at a regular distan­ 194 3­ Il “macellum­forum” o “foro circolare” La situazione attuale Il monumento è visibile dalla strada principale, ri­ VSHWWRDOODTXDOHVLWURYDSLLQEDVVRGLPÊ scavato parzialmente, in quanto una parte a ovest rimane sotto la strada ed una parte a nord (nella porzione di probabili botteghe) è stato distrutto in occasione della costruzione di un grande fabbri­ cato residenziale. Anche la porzione sud­ovest è nascosta sotto il passaggio pedonale che collega la strada a via Goga. L’area del monumento è attualmente percorsa da una condotta d’acqua “volante”, un tubo che attraversa la struttura da ovest ad est, poggiando sui muri nella porzione SLRULHQWDOH,OPRQXPHQWRqDFFHVVLELOHWUDPLWH una scala dalla strada principale. Per l’accesso occorre rivolgersi all’Atelier dei Monumenti di Cultura. È circondato da una balaustra in ferro, di facile scavalcamento. Nella situazione attuale è persa ogni connessione, che pure doveva esistere, con le terme a sud e con un’altra area sicuramente archeologica, a est, dove ora è un cantiere edile bloccato. Lo spazio a sud è tuttavia ancora a verde, e conserva uno dei pochi caffè di atmosfera turca, con tavoli nel giardino, oltre che una latrina pubblica di cui gli studiosi locali SURFODPDQRODYHWXVWj ;9,,,VHF 1HJOLDQQL 2006­2007 era stata avviata un’opera di “rivita­ lizzazione” appoggiando sui muri delle botteghe antiche una struttura a telaio in metallo, che avrebbe dovuto sostenere una pavimentazione in legno o in vetro, per svolgervi attività recettive (terrazza di un bar). Questo tentativo è stato bloccato dalle autorità di tutela e dalla pressione dell’opinione pubblica. L’intelaiatura metallica è rimasta. Nel 2006, un concerto di musica classica è stato tenuto nel foro circolare, ma con non molto successo di pubblico. Un pannello, allestito LQRFFDVLRQHGHOODPRVWUD³'XUUsVDQQLGL FLYLOWj´qVWDWRSLYROWHULFROORFDWRHGDVSRUWDWR La scoperta 1. 1987­1990: scavi di emergenza (direzione A. +RWL 2. 2000­2001 e 2001­2003: portico meridionale e GXHERWWHJKH 'H( GHOODWRVXGRYHVW 3. 2005: saggio a nord del podio. Descrizione Avvertenza: i dati e le planimetrie qui di seguito riportati sono tratti dalla letteratura VFLHQWL¿FDULJXDUGDQWHLOPRQXPHQWR1RQVRQR stati fatti rilievi di questo monumento da parte della Missione Archeologica Italiana. La piazza e il portico. Il Monumento è costitu­ ito da un portico circolare, che racchiude una piazza lastricata al centro della quale è un podio circolare. All’esterno del portico, è una serie di ambienti interpretati come botteghe, alcuni dei quali dotati di un piano interrato raggiungibile tramite scale. Il portico ha una larghezza di 5,30 m. Un basso muro in opera incerta con legante in malta costituisce la zoccolatura di base del FRORQQDWRHVVDVXGGLYLGHORVSD]LRLQGXHDPELWL differenti, uno di circolazione (portico) ed uno di Above: The round forum and its relationship with the roman baths/ Il foro circolare e la sua relazione con le terme romane (da HOTI 2003). Below: The round forum: a panoramic view/ Il foro circolare: panoramica. ce of 1.30 m from each other, on little more than half of the circle). 'LIIHUHQWFROXPQVKDYHEHHQIRXQGZKROHDQGIUDJPHQWHG DWOHDVW but some fragments of columns of smaller diameter, found in the area, would suggest a double order, as in the circular forum of Constanti­ nople, vd. infra) and now they have been raised and integrated with reconstruction of painted concrete to imitate marble. The old columns are made of Proconnesio marble, with Byzantine trafored capitals, ZKLFKVW\OHGDWHVRQWKHDJHRI-XVWLQLDQ $' )UDJPHQWVRI a curved architrave molded in degrading strips were found in the exca­ vations and are now in hte museum’s lapidary, but were not reinstated in the fully reconstructed architrave, made in concrete opus incertum, which actually binds copies and original columns. The round shape central podium in opus incertum, of diameter 1.80 m, was covered with marble slabs. In its northern margin was con­ ducted in 2005 a test excavation to verify the underlying stratigraphy. The published results showed clearly that the public monyment has RYHUODSSHSULYDWH,,$'KRXVHVREOLWHUDWLQJWKHP$ZHOOGDWLQJEDFN to late medieval or even Turkey Age, located to the southeast, cut the OD\HUVDQGDOVRWKHPDUEOHÀRRU The shops They have Trapezoidal shape and a width varying between 20 and 27 VTP7KHZDOOVRIWKHVKRSVZKLFKWR¿WWKHFXUYDWXUHRIWKHEXLOGLQJ are diagonal and are preserved to a height of 0.40 to 1.10 m, draw spaces of different sizes. They are built in opus vittatum mixtum (3 rows of brick with measures 29x36x5 alternated to a small stones opus incertum). Some of the bricks have Christian symbols and mo­ nograms. Almost every shop has two doors, one on the porch and one RQWKHH[WHUQDOVSDFHRIWKHEXLOGLQJWKHGRRUVWRPZLGH had a swing (hinge traces). In a second phase, some of these acces­ VHV URRP( ZHUHFORVHG7KHÀRRUVRIWKHVKRSVZHUHWHUUDEDWWXWD RUEULFNV [[FP SODFHGRQDOD\HURIPRUWDU,Q'VKRSWKHÀRRU RIWKHJURXQGÀRRUZDVPDGHRIZRRGOD\HGLQDSORWPDGHRIZRRGHQ boards linked by smaller boards. In this workshop a staircase led to a lower level, the remainng ramp is composed of 5 steps and leads to a plan leaning against the wall of the room C. The shops were covered by a gabled roof, panelled with roof tiles and shingles, as showed by the collapse in room E. On this collapse were found ceramics relating to X­XIII centuries (amphorae Otranto I and II, Byzantine glazed pot­ tery), a time when the monument was already completely destroyed. The coins found in these collapse layers especially belong to Mauri­ WLXV7LEHULXV  /HR9,  DQG-DQ&LPLVNX   The life of the workshops took place between the end of fourth and VL[WKFHQWXULHVDVHYLGHQFHGE\WKH¿YHVWUDWLJUDSKLFXQLWVZLWKFH­ UDPLFFRQWH[WVFRQVLVWLQJPDLQO\RI2ULHQWDODQG$IULFDQDPSKR¤UDH traces of productive activities were noted too (small bronze metallurgy, common in late antique context: the activity of recycling). The tombs On the pavement of the square and among the remains of the shops 'DQG(JUDYHVZHUHIRXQGRIZKLFKZHUH&DSXFKLQVW\OHZLWK a case and and a gabled tile roof, while the other 3 were simple pits. 196 sosta (piazza). Nell’anello esterno sembra aprirsi un corridoio di accesso alla piazza, perfettamente orientato est­ovest, percorso da una canaletta di scolo attualmente aperta ma in antico sicuramen­ te coperta dalla pavimentazione: questo accesso sembra indicare una orientazione nord­sud GHOO¶HGL¿FLRHGKDDYYDORUDWRO¶LSRWHVLFKHO¶LQWHUR piano urbano della città fosse orientato nord­sud. Lo zoccolo del colonnato è rivestito da lastre di calcare rettangolari (dimensioni medie 110x80x17 cm). Su di esso sono posati i plinti delle colonne (20 quelli variamente rinvenuti, ad una distanza UHJRODUHGLPO¶XQRGDOO¶DOWURVXSRFRSL della metà del cerchio). Ne sono state rinvenute diverse, cadute, intere e frammentarie (almeno 8, PDDOWULIUDPPHQWLGLFRORQQHGLSLSLFFRORGLDPH­ tro, trovate nell’area, farebbero pensare ad un doppio ordine, come nel foro circolare di Costan­ tinopoli, vd. infra) ed ora sono state rialzate ed integrate con ricostruzione in cemento dipinto ad imitazione del marmo. Le colonne antiche sono di marmo proconnesio, con capitelli a traforo di tipo bizantino, stilisticamente databili all’età di Giusti­ QLDQR G& )UDPPHQWLGLXQDUFKLWUDYH curvilineo modanato in listelli degradanti sono stati rinvenuti nello scavo ed ora si trovano nel lapidario del museo, ma non sono stati reinseriti nell’architrave totalmente di ricostruzione, in opera incerta cementizia, che attualmente lega fra loro colonne originali e copie. Il podio centrale di forma rotonda, in opera incerta, del diametro di 1,80 m, era probabilmen­ te rivestito di lastre di marmo. Al suo margine settentrionale è stato condotto nel 2005 un saggio GLVFDYRSHUYHUL¿FDUHODVWUDWLJUD¿DVRWWRVWDQWH La pubblicazione dei risultati di scavo ha chiarito come il monumento pubblico si sia sovrapposto, demolendole, ad abitazioni private di II sec. d.C. Un pozzo, di epoca tardomedievale o addirittura turca, collocato a sud­est, ha tagliato gli strati ed anche la pavimentazione in marmo. Le botteghe+DQQRIRUPDWUDSH]RLGDOHHDPSLH]­ za variabile tra 20 e 27 mq. I muri delle botteghe, FKHSHUDGDWWDUVLDOODFXUYDWXUDGHOO¶HGL¿FLRVRQR diagonali e sono conservati per un’altezza di 0,40­ 1,10 m, disegnano spazi di dimensioni differenti. 6RQRFRVWUXLWLLQRSXVYLWWDWXPPL[WXP ¿OHGL laterizi con misure 29x36x5 cm, alternati a opus incertum di piccole pietre). Alcuni dei laterizi presentano simboli cristiani e monogrammi. Quasi ogni bottega è dotata di due porte, una sul portico HXQDVXOORVSD]LRHVWHUQRGHOO¶HGL¿FLRTXHVWH porte, larghe 1,30­1,50 m, erano ad un battente (tracce del cardine). In una seconda fase, alcuni di questi accessi (ambiente E) sono stati chiusi. I pavimenti delle botteghe erano in terra battuta o in mattoni (28x36x5 cm) posati su uno strato di PDOWD1HOODERWWHJD'LOSDYLPHQWRGHOSLDQRWHUUD era in legno, costituito da un ordito di travi ed una trama di travetti. In questa bottega una scala FRQGXFHYDDGXQSLDQRLQIHULRUHODUDPSDULPDVWD composta di 5 gradini arriva ad un pianerottolo appoggiato al muro dell’ambiente C. Le botteghe erano coperte da un tetto a doppio spiovente, rivestito di embrici e tegole, come The round forum: some details/Il foro circolare: dettagli (foto A. Hoti). Urban relationship betweem the baths and the round forum./ La relazione urbanistica tra le terme e il foro circolare. 197 All the graves were without items. Overall in the excavation there were found 67 tombs dated from the seventh century to the Middle Ages. Quote: The plan of the pavement of the circular square is at ­2.50 m to WKHURDGWRGD\7KHOD\HURQWKH99,$'ZDVEHWZHHQDQG P7KHRQHRIWKHSUHYLRXVSKDVH ,,,FHQW$' LVPGHHS7KHUH is no outcrop of groundwater, but there is stagnation inside the old shops when it rains. Measurements: total diameter is about 40 m (reported in the bibliogra­ SK\EXWWKHUDGLXVIURPWKHFHQWHUWRWKHRXWHUZDOOLVP SRUFK width is 5.30 m. 'DWLQJ6RPHZDOOVZLWKQRUWKVRXWKWUHQGLQWKHHDVWHUQVHFWRURIWKH VXUYH\HGDUHDDUHGDWHGWRWKH,,,FHQW$'7KH\VHHPEHORQJLQJ to residential buildings, perhaps, a room seems to have a square central bath. The complex macellum­forum should be built in the late IRXUWKFHQWXU\$' 7KLVGDWHZDVEDVHGPRUHRQWKHVWXG\RIWKHSODQ than the analisys of the materials and the stratigraphy found), but experienced a phase of major renovation and landscaping in the Age of Justinian. It should have fallen into disuse at the end of the seventh FHQWXU\EHFRPLQJODWHO\WKHQHFURSROLVDUHDWKHVWUXFWXUHV¿QDOO\ FROODSVHGLQWKHQLQWKWHQWKFHQWXU\$' Assumptions and Comparisons The monument has been interpreted by its discoverer and a majori­ ty of Albanian scholars as a macellum­forum, ie a marketplace (the macella are food market architectural types, well known in Punic Africa by the the third century BC. and imported in Rome by the II FHQWXU\%&XVXDOO\WKH\KDYHDQRSHQUHFWDQJXODUVSDFHVXUURXQGHG by a continuous porch, with one or more doors on the streets or the VTXDUHVQHDUE\LQWKHFHQWHUWKH\KDYHD³JD]HER´FLUFXODURUSRO\JR­ nal, covered, with a board with hydraulic implants with running water, LQWHUSUHWHGDVDQDUHDRIWKH¿VKRUYHJHWDEOHVPDUNHWYGWKHFDVH RIPDFHOOXPRI3RPSHLLRUWKDWRI$OED)XFHQV ,QDGGLWLRQWRWKH absence of the central building, replaced here by a podium, the round shape is quite unusual: the only comparisons are with the forum of Constantine in Constantinople and that of Jerash in Jordan. The forum of Constantinople is located on a hill in west of the imperial palace: today it is only the middle column. It was a circular plaza surrounded with a double row of columns, Corinthian. At the center there was a giant column topped by a bronze statue of the emperor represented DV+HOLRV WKH6XQ*RG DFFRUGLQJWRDQLFRQRJUDSK\DOUHDG\XVHG by Alexander the Great. The base, 5 m high, was hollow inside, where WKHUHZDVDFKDSHO6LPLODUFROXPQVZHUHDOVRRQWKH5RPDQ)R­ rum in Rome, along the long side, dating to the remake of the forum DIWHUWKH¿UHLQWKHUHLJQRI&DULQR $' &HUWDLQO\WKHWKHPHRI WKHFRORVVDOFROXPQLVRODWHGZLWKLQDFRQ¿QHGVSDFHEHORQJVWRWKH Late Empire age, as a development of the idea applied in the Trajan column in Rome, nestled among the colonnades of the two libraries DQGWKHEDVLOLFD8OSLDLQ7UDMDQ¶V)RUXP$ODUJH%\]DQWLQH-XVWLQLDQ capital, made of marble Proconnesio, reused as a baptismal font is QRZLQWKHPXVHXP¶VODSL¤GDU\7KHRYDOIRUXPRI-HUDVKLQVWHDGGD­ WHVEDFNWRWKH¿UVWFHQWXU\$',WVVKDSHLVGXHWRWKHQHHGWRFRQ­ 198 dimostra il crollo nell’ambiente E. Su questo crollo erano materiali ceramici riferibili ai secoli X­XIII DQIRUHWLSR2WUDQWR,H,,FHUDPLFDLQYHWULDWDEL­ zantina), epoca nella quale il monumento doveva già essere completamente distrutto. Le monete ritrovate in questi strati di crollo appartengono VRSUDWWXWWRD0DXUL]LR7LEHULR  /HRQH9, (886­912) e Jan Cimisku (969­976). La vita delle ERWWHJKHVLqVYROWDWUD¿QH,9H9,VHFFRPH GLPRVWUDQROHXQLWjVWUDWLJUD¿FKHPHVVHLQOXFH con contesti ceramici costituiti soprattutto da an­ fore orientali ed africane. Sono state notate anche tracce di attività produttive (piccola metallurgia del bronzo, frequente nei contesti tardoantichi: si tratta di attività di riciclaggio). Le tombe. Sul piano lastricato della piazza e tra i UHVWLGHOOHERWWHJKH'H(SRJJLDYDQRWRPEH 7 delle quali erano alla cappuccina con cassa e copertura a doppio spiovente in tegole, mentre le altre 3 erano in semplice fossa. Tutte le tombe erano senza corredo. Complessivamente nello VFDYRVRQRVWDWHWURYDWHWRPEHGDWDWHGDO9,, sec. al medioevo (non meglio precisato). Quota: il piano del lastricato della piazza circolare si trova a ­2,50 m rispetto al piano stradale attua­ OH/RVWUDWRUHODWLYRDO99,VHFVWDYDIUD e ­2,50 m. Quello della fase precedente (I­II sec. G& HUDDPGLSURIRQGLWj1RQF¶qDI¿RUD­ mento di acqua di falda, ma ristagno in caso di pioggia all’interno delle botteghe antiche. Misure: diametro totale circa 40 m (dichiarato in ELEOLRJUD¿DPDLOUDJJLRGDOFHQWURDOPXURHVWHU­ QRqP ODUJKH]]DGHOSRUWLFRP 'DWD]LRQH$OFXQHVWUXWWXUHPXUDULHFRQDQGD­ mento nord­sud nel settore orientale dell’area indagata, sono datate al I­II sec. d.C. Sembrano SHUWLQHQWLDGHGL¿FLIRUVHUHVLGHQ]LDOLXQDPELHQWH pare avere una vasca quadrata centrale. Il com­ plesso del macellum­forum dovrebbe essere stato FRVWUXLWRYHUVROD¿QHGHO,9VHFG& TXHVWD GDWD]LRQHqVWDWDDYDQ]DWDSLSHUFRQIURQWRGHOOD SLDQWDFKHSHUPDWHULDOLHVWUDWLJUD¿HULQYHQXWH  ma certo conobbe una fase di notevole ristrut­ turazione e abbellimento nell’età di Giustiniano. 6DUHEEHFDGXWRLQGLVXVRDOOD¿QHGHO9,,VHFH VXFFHVVLYDPHQWHGLYHQQHDUHDGLQHFURSROLOH VWUXWWXUHVDUHEEHURGH¿QLWLYDPHQWHFUROODWHQHO IX­X sec. d.C. Ipotesi e confronti. Il monumento è stato interpre­ tato dal suo scopritore e dalla maggioranza degli studiosi albanesi come un macellum­forum, cioè una piazza­mercato (i macella sono tipologie ar­ chitettoniche di mercati alimentari note nel III sec. a.C. nell’Africa punica e importate a Roma dal II VHFD&QRUPDOPHQWHVRQRXQRVSD]LRDSHUWR rettangolare, circondato da un portico continuo, FRQXQDRSLSRUWHDSHUWHVXOOHVWUDGHRSLD]]H DGLDFHQWLDOFHQWURSUHVHQWDQRXQ³JD]HER´FLUFR­ lare o poligonale, coperto, dotato di bancone con impianti idraulici di acqua corrente, interpretato come area del mercato del pesce o delle verdure: vd. il caso del macellum di Pompei, o quello di $OED)XFHQV  Above. Costantinopoli, plan of the ancient city. Below: Gerasa, plan of the city/ In alto: Costantinopoli, ricostruzio­ ne della città in età bizantina, col foro circolare di Costantino. In basso: mappa della città di Gerasa. *HUDVDLPDJHRI)RUXPGerasa, immagine del Foro. QHFWLQJWKHWHPSOHRI=HXVZLWKWKHFDUGRPD[LPXVZKLFKLVWKH¿QDO element, measuring 90x80 m and surrounded by 56 Ionic columns. The historical, dimensional an morphological differences, compared WRWKHFLUFXODUIRUXPRI'\UUDFKLXPDUHREYLRXV,WVKRXOGDOVREH mentioned the proposed interpretation of G. Muka, former director of WKH,QVWLWXWHRI&XOWXUDO0RQXPHQWVZKLFKLGHQWL¿HGWKLVDUHDDVWKH church of S. Mary in Rotunda cited by some sources, Byzantine and medieval chronicler, and compared with S. Stefano Rotondo in Rome $' $QRWKHUFRPSDULVRQLQWKDWZD\FRXOGEH6$QJHORLQ 3HUXJLDGDWHGWRWKHHQGRIWKHIRXUWK$'DQGRIFRXUVHWKHURXQG FKXUFKRI6&RVWDQ]DLQ5RPH $' 7KHK\SRWKHVLVGRHVQRW seem reliable because of the lack of support for coverage on the SDYHGÀRRUDQGWKHLQDGHTXDF\RIWKHFROXPQVVXSSRUWLQJDYDXOWHG roof of this size. )XUWKHUPRUHWKHURRPVEHKLQGWKHSRUWLFRDUHREYLRXVO\FRPPHUFLDO or production rooms and the presence of conducts to the outside VKRZVWKDWWKHSDYHGÀRRUZDVPHDQWWREHXQFRYHUHG,QDQ\FDVH the homogeneity of the material used (marble Proconnesus) for paving, columns and capitals, and its stylistic homogeneity suggests an organic project, implemented in a single phase, resulted from the architectural culture of Late Antiquity (Constantinian or later) that uses FLUFXODUSODQVIRUWKHLUV\PEROLFPHDQLQJ)XUWKHUPRUHWKHLPSOH­ mentation of this considerable number of prestigious architectural structures, all imported and of homogeneic manufacture, suggests an imperial commission, the only one in late antiquity that could have marble material of this quality and quantity and could facilitate tran­ sportation from the quarries to the place of execution. 200 Oltre all’assenza della costruzione centrale, qui sostituita da un podio, la forma circolare è del tutto insolita: gli unici confronti sono con il foro costantiniano di Costantinopoli e con quello di Gerasa in Giordania. Il foro di Costantinopoli si trova su un’altura a occidente del palazzo imperiale: oggi ne resta solo la colonna centrale. Era una piazza circolare circondata di colonne a doppio ordine, corinzie. Al centro si trovava una gigantesca colonna, sormontata da una statua bronzea dell’imperatore rappresentato come +pOLRV LOGLR6ROH VHFRQGRXQ¶LFRQRJUD¿DJLj usata da Alessandro Magno. Il basamento, alto 5 m, era cavo all’interno dove si trovava una cap­ pella. Colonne simili, monumentali, si trovavano anche a Roma sul foro romano, lungo i lati lunghi, sono datate al rifacimento del foro dopo l’incendio avvenuto sotto il regno di Carino (282 d.C.). Cer­ tamente il tema della colonna colossale, isolata all’interno di uno spazio chiuso appartiene all’età tardoimperiale come sviluppo dell’idea applicata nella colonna Traiana, a Roma, racchiusa fra i colonnati delle due biblioteche e della basilica Ulpia, nel foro di Traiano. Un grande capitello di stile bizantino giustinianeo in marmo proconne­ sio, reimpiegato come fonte battesimale, si trova attualmente nel lapidario del museo. Il foro ovale di Gerasa risale invece al I sec. d.C. La sua forma è dovuta alla necessità di raccordare il tempio di Zeus con il cardo maximus colonnato, di cui FRVWLWXLVFHO¶HOHPHQWR¿QDOH0LVXUD[P ed è circondato da 56 colonne di stile ionico. Le diversità, cronologiche, dimensionali e morfologi­ FKHULVSHWWRDOIRURFLUFRODUHGL'\UUDFKLRQVRQR 4 ­ The old thermae The current situation Two rooms of a Roman baths are visible from the walkway between WKHFLUFXODUIRUXPDQG9LD$*RJDXQGHUWKH3DODFHRI&XOWXUH³$ Moisiu”. The structure continues below the building, which lays on concrete columns, one of them very visibly damaged, and below the current street. The discovery It occurred in two stages, between 1960 and 1965, during the con­ struction of the Palace of Culture “A. Moisiu”. A restoration is docu­ mented in 1967. Description Note: data and plans listed below are from literature on the monu­ ment. Topographical survey and drawing of this monument were not made by the Italian Archaeological Mission. The thermae Complex building of major importance, consisting of a series of rooms (three of them with hypocaust heating system) and with a complicated system of pipes and water pipes and sewage. The outer walls, with exposed brick face, 45­90 cm wide, are preserved to a height of 2 m. The complex overlooks a cobbled street with a north­south trend, with a central rectangular room with bath (6.45 x4, 60 m, depth 60 cm), with a stairway with two steps 28 and 20 cm high, interpreted as swimming pool, its bottom made of plates of rectangular limestone (70x20x3 cm) with north­south direction. The bath was equipped with lead pipes for hydraulic power. The Room (No. 7 plant Miraj), with an area of 300 square meters and about the size of 11 (front) x 6 m, is interpreted as frigidarium, but remains a doubt due to the opening toward the street. North of this room are lined up two large rooms connected by a double opening in the wall, with a threshold nearly 2 PZLGHERWKKDYHODUJHGLPHQVLRQV QR[QR x7, 45 m, but continues under the current path), both are equipped with a hypocaust heating system with suspensurae and therefore are interpreted as tepidarium (2), and calidarium(1). The latter is separa­ ted from the outer wall of the complex, towards the road, on the west E\DQDUURZFRUULGRUGH¿QHGE\DEULFNZDOO,WLVHOHJDQWO\SDYHGZLWK slabs of stone square, alternating black and white 60x60 cm, laid on a RSXVVLJQLQXPVXEÀRRU7KLVÀRRUZDVYHU\ZHOOSUHVHUYHGDWWKHWLPH of excavation, but now very shabby and is supported by square brick pillars (22x22x3 or 29x29x3 cm). 'XULQJDUHVWRUDWLRQLQRQHRIWKHVHEULFNVKDVUHYHDOHGDUDZ VFUDWFKHGLQVFULSWLRQRIJUHDWLQWHUHVW/787,/,958)86$5& LQWHUSUHWHGDV/XFL7XWLOL95XIXVDUFKLWHFWXVWKHQDPHRIDQ,WDOLDQ architect for a type of building complex typical of the Roman tradition unknown to Greek architecture and therefore sign of the process of acculturation and complete romanization of the city. On the walls are the remains of the air conducts in tubules rectangular bricks for KHDWLQJ2QWKHTXRWHRIWKHÀRRURQWKHEULFNZDOODGRXEOHDUFKLQ evidenti. Occorre citare per completezza anche la proposta di interpretazione di G. Muka, già di­ rettore dell’Istituto dei Monumenti di Cultura, che LGHQWL¿FDYDLQTXHVWRVSD]LRODFKLHVDGL60DULD in Rotunda, citata da alcune fonti cronachistiche bizantine e medievali, e la confrontava con S. Stefano Rotondo a Roma (468­483 d.C.) Un altro confronto in tal senso potrebbe essere S. Angelo D3HUXJLDGDWDWDDOOD¿QHGHO,9HQDWXUDOPHQWH la basilica rotonda di S. Costanza a Roma (330 d.C.). L’ipotesi tuttavia non sembra attendibile a causa dell’assenza di sostegni per una copertura sulla parte lastricata, e della inadeguatezza delle colonne a sostenere una copertura voltata di queste dimensioni. Inoltre gli ambienti retrostanti il portico sono evidentemente di natura commer­ ciale o produttiva e la presenza di canalizzazioni verso l’esterno denuncia il fatto che la parte lastricata doveva essere scoperta. In ogni caso, l’omogeneità del materiale utilizzato (marmo del Proconneso) per la lastricatura, le colonne e i capitelli, nonché l’omogeneità stilistica di questi fanno pensare ad un progetto organico, attuato in una unica fase, scaturito dalla cultura archi­ tettonica tardoantica (costantiniana o posteriore) che impiega volentieri le piante circolari per il loro VLJQL¿FDWRVLPEROLFR,QROWUHODPHVVDLQRSHUD di un numero così considerevole di membrature architettoniche di pregio, tutte di importazione e di fabbricazione omogenea, fa pensare ad una com­ mittenza imperiale, l’unica che in età tardoantica potesse disporre di materiale marmoreo di questa qualità e in questa quantità e potesse garantire il trasporto dalle cave al luogo della messa in opera. 4 ­ Le terme vecchie. La situazione attuale 'XHDPELHQWLGLXQLPSLDQWRWHUPDOHURPDQRVRQR visibili dal passaggio pedonale fra il foro circolare e via A. Goga, sotto il Palazzo della Cultura “A. Moisiu”. La struttura prosegue al di sotto del palazzo, che poggia su piloni di cemento armato uno dei quali visibilmente molto danneggiato, e al di sotto della strada attuale. La scoperta . È avvenuta in due tempi, fra 1960 e 1965, in occasione della costruzione del Palazzo di Cultura “A. Moisiu”. Un intervento di restauro è documentato nel 1967. Descrizione . Avvertenza: i dati e le planimetrie qui di seguitoriportati sono tratti dalla letteratura VFLHQWL¿FDULJXDUGDQWHLOPRQXPHQWR1RQVRQR stati fatti rilievi di questo monumento da parte della Missione Archeologica Italiana. Le terme. Complesso edilizio di notevole rile­ vanza, costituito da una serie di ambienti, tre dei quali con sistema di riscaldamento a ipocausto e dotato di un complicato sistema di condotte e canalizzazioni idrauliche e fognarie. I muri peri­ metrali, con faccia a vista in laterizio, larghi 45­90 cm, sono conservati per un’altezza di 2 m. Il complesso si affaccia su una strada lastricata con andamento nord­sud, tramite un vano rettango­ lare con vasca centrale (6,45x4,60 m, profondità 201 Above:Picture of two rooms from the baths/ )RWRJUD¿DGLGXHGHJOLDPELHQWLGHOOHWHUPH GD0,5$-  Below: Thermae’s plan/ Il rilievo delle terme (da MIRAJ 1994). brick masonry marks the entry of air duct coming from the furnace (er­ roneously called praefurnium in the publications, which would be the access and loading of the furnace mouth, and which obviously would EHRXWVLGHWKHEXLOGLQJWRDOORZORDGLQJDQGQRWXQGHUWKHÀRRU 7R the east of the calidarium there is another room (no. 3) that, because of the curved section of wall left and the suspensurae system, has been interpreted as laconicum or essudatorium. The Tepidarium 1R DOVRKDVDK\SRFDXVWÀRRUKHDWLQJV\VWHPEXWVXSSRUWHGE\ round brick pillars. South of the room with bath there are some small areas of irregular shape, of which (no. 5) was certainly a latrine as surrounded by a system of gutters drain. The access to the complex would be from the southeast, a apodyterium (No. 6) or locker room, diagonal to the sequence NS of the three typical Roman thermal baths (frigidarium tepidarium caldarium). This apodyterium was paved with RSXVVSLFDWXP EXW,WKLQNLQVWHDGLWLVDSODQEULFNÀRRU $QLQWHUPH­ diate space, keystone shaped, also paved with stone slabs, opens RQWKHIULJLGDULXP+RZHYHUVRPHRIWKHVHZDOOVSUREDEO\EHORQJWR different phases, as it can be understood from the longitudinal section RIWKHFRPSOH[)XQFWLRQDOFKDQJHVKDYHRFFXUUHGLQWKHPLGIRXUWK FHQWXU\$'SUREDEO\DVDUHVXOWRIWKHHDUWKTXDNHRIZKLFK caused the interruption of the heating and plumbing channels. To this intervention should belong the walls in different building techniques, and highest elevation, which divided the tepidarium into four smaller areas and isolated the frigidarium tank from the rest. Later this area was also occupied by early medieval graves. The road I2.66 m wide, paved with irregular stone slabs, with a north­south WUHQGLVWKHRQO\SRUWLRQRIURDGVRIDUIRXQGLQ'XUUHV2QWKHHDVWHUQ edge, against the wall of the complex, runs a plumbing pipe with a well (8). 4XRWHEHWZHHQDQGPIURPWKHÀRRUWRGD\ UHSRUWHGLQ the bibliography, but not clear what the reference plane is, as there is an elevation around for a public garden). Size: 700 square meters area, length of road is 20 m, 2.66 m width of the road. 'DWHWKHSUHVHQFHRI¿VWXODHSOXPEHDHZKLFKUHTXLUHWKHFRQYH\DQ­ FHRIZDWHUIURPDQDTXHGXFWWHVWL¿HGWKDWWKHFRPSOH[LVFRQVHTXHQW WKHFRPSOHWLRQRIWKHDTXHGXFWE\WKH(PSHURU+DGULDQ $'  +RZHYHU/0LUDMEDVHGRQEXLOGLQJWHFKQLTXHVRQWKHW\SHRISDYLQJ stone slabs of alternating colors and dimensional considerations (size of bricks) believes them to be slightly earlier and contemporary con­ struction of the amphitheater, then of the Age of Trajan. Assumptions and Comparisons There are doubts about the thermal function of the complex, which has the traditional sequence of the Roman world (frigidarium tepida­ rium calidarium and laconicum). The size of rooms and the complexity of plumbing suggest a public rather than private baths, although the TXDOLW\RIWKHÀRRULQJLVYHU\SRRU 7KHQRUWKVRXWKRULHQWDWLRQRIWKHFRPSOH[VHHPVWRFRQ¿UPWKHK\SR­ 0,60 m), dotata di una scala di discesa con due gradini alti 28 e 20 cm , interpretata come piscina natatoria, con fondo in lastre rettangolari di calcare (70x20x3 cm) con disposizione nord­ sud. La vasca era dotata di tubi in piombo per l’alimentazione idraulica. L’ambiente (n. 7 della SLDQWDGL/0LUDM FRQXQDVXSHU¿FLHGLFLUFD mq e delle dimensioni circa di 11 (sul fronte)x6 m, è interpretato come frigidarium, ma resta dubbio a causa dell’apertura verso la strada. A nord di questo ambiente si allineano due ampie stanze, comunicanti tramite una doppia apertura nel PXURGRWDWDGLVRJOLDODUJDTXDVLPHQWUDPEH KDQQRJUDQGLGLPHQVLRQL Q[Q 1: 12,80x7,45 m, ma prosegue sotto la strada attuale), entrambe sono dotate di un sistema di riscaldamento a ipocausto con suspensurae e pertanto sono interpretate come tepidarium (n. 2) e calidarium (n. 1). Quest’ultimo è separato dal muro perimetrale del complesso, verso la strada, VXOODWRRYHVWGDXQRVWUHWWRFRUULGRLRGH¿QLWRGD un muro laterizio. È pavimentato elegantemente in lastre di pietra quadrate, alternate, bianche e nere di 60x60 cm, posate su un sottofondo in opus signinum. Questo pavimento assai ben con­ servato al momento dello scavo, ed ora invece molto malridotto, è sostenuto da pilastrini quadrati di mattoni (22x22x3 o 29x29x3 cm). In occasione di un restauro nel 1967, uno di questi mattoni KDULYHODWRXQDLVFUL]LRQHJUDI¿WDDFUXGRGL JUDQGLVVLPRLQWHUHVVH/787,/,958)86$5& LQWHUSUHWDWDFRPH/XFL7XWLOL95XIXVDUFKLWHFWXV il nome di un architetto di origini italiche per un complesso edilizio di tipologia assolutamente romana, sconosciuto alla tradizione edilizia greca e dunque testimonianza del processo di acculturazione e di compiuta romanizzazione della città. Sulle pareti sono resti dei condotti d’aria in tubuli laterizi rettangolari per il riscalda­ mento. Alla quota del pavimento, sulla parete di mattoni, un doppio arco laterizio nel paramento murario segna l’accesso del condotto d’aria che viene dalla fornace (erroneamente chiamato nelle pubblicazioni praefurnium, che sarebbe l’accesso e bocca di caricamento della fornace, e che ovviamente doveva trovarsi all’esterno GHOO¶HGL¿FLRSHUFRQVHQWLUHLOFDULFDPHQWRHQRQ sotto il pavimento). A est del calidarium c’è un altro ambiente (n. 3) che a causa dell’andamento curvilineo del troncone di muro rimasto e del sistema di suspensurae è stato interpretato come laconicum o essudatorium. Il tepidarium (n. 2) ha pure un pavimento con sistema di riscaldamento a ipocausto, ma sostenuto da pilastrini roton­ di, sempre in laterizi. A sud dell’ambiente con vasca si trovano alcuni piccoli ambienti, di forma irregolare, di cui (n. 5) era certamente una latrina in quanto circondata da un sistema di canalette di spurgo. L’accesso al complesso sarebbe stato da sud­est, da un apodyterium (n. 6) cioè spogliatoio, diagonale rispetto alla sequenza NS dei tre tipici ambienti termali romani (frigidarium, tepidarium, calidarium). Questo apodyterium era lastricato in opus spicatum (ma credo invece si tratti di un pavimento in laterizi piani). Uno spazio intermedio, trapezoidale, pavimentato anch’esso 203 in lastre di pietra, si apre sul frigidarium. Tuttavia alcuni di questi muri appartengono probabilmente a fasi diverse, a quanto si può capire dalla se­ ]LRQHORQJLWXGLQDOHGHOFRPSOHVVR0RGL¿FD]LRQL IXQ]LRQDOLVRQRLQWHUYHQXWHDOODPHWjGHO,9VHF d.C., probabilmente in conseguenza del terremoto del 346, che provocò l’interruzione dei canali idraulici e dell’impianto di riscaldamento. A questa rifunzionalizzazione dovrebbero appartenere i PXULLQWHFQLFDHGLOL]LDGLYHUVDHDTXRWDSLDOWD che suddivisero il tepidarium in quattro ambienti SLULGRWWLHLVRODURQRODYDVFDGDOUHVWRGHO frigidarium. Successivamente anche quest’area fu occupata da tombe altomedievali. Above: Thermae: panoramic view of the excavations/ Sopra: le terme: panoramica di scavo thesis of a general urban plan of the city north­south oriented. Several other baths have been found in the city, including those which is assigned the great black and white mosaic with marine themes found E\97RFLLQ 1DUFKDHRORJLFDOULVN0DS DQGRWKHUPRUH UHFHQW¿QGLQJLQGLFDWHGZLWKWKHQXPEHURIDUFKDHRORJLFDOULVNPDS La relazione urbanistica tra le terme e il foro circolare. La strada Larga 2,66 m, pavimentata in lastre irregolari di pietra, coeva alla costruzione e con andamento QRUGVXGqO¶XQLFDSRU]LRQHGLDVVHVWUDGDOH¿Q TXLULWURYDWRD'XUD]]R6XOPDUJLQHHVWFRQWURLO muro del complesso, corre un condotto idraulico rettilineo dotato di un pozzo (n. 8). Quote: fra ­3,20 e ­4,60 m dal piano di calpestio DWWXDOH GLFKLDUDWRLQELEOLRJUD¿DPDQRQFKLDUR quale sia il piano di riferimento, essendoci attorno una sopraelevazione per un giardino pubblico). 0LVXUHVXSHU¿FLHPTOXQJKH]]DGHOODVWUDGD 20 m, larghezza della strada 2,66 m. 'DWD]LRQHODSUHVHQ]DGHOOH¿VWXODHSOXPEHDH che presuppongono l’adduzione d’acqua da un acquedotto, testimonia che il complesso è suc­ cessivo alla realizzazione dell’acquedotto da parte dell’imperatore Adriano (117­138 d.C.). Tuttavia L. Miraj, sulla base delle tecniche edilizie, del tipo di pavimentazione a lastre di pietra di colori alternati e di considerazioni metrologiche (misure dei laterizi) le ritiene di poco precedenti e contempo­ UDQHHDOODFRVWUX]LRQHGHOO¶DQ¿WHDWURGXQTXHGL età traianea. 5 – The lighthouse of the Troplini street The current situation The structures are located within a construction site, completely closed. The excavation reaches the limit of the same site. An overall view is WKHUHIRUHRQO\SRVVLEOHIURPWKHXSSHUÀRRUVRIWKHEXLOGLQJDGMDFHQW WRWKHHDVW7KHDTXLIHUKDVUHVXOWHGLQWKHFRPSOHWHÀRRGLQJRIWKH excavation area, stagnant water has resulted in a bloom of algae and weeds that makes it impossible to see the structures through the water Ipotesi e confronti . Non ci sono dubbi sulla . The site is also used as a dump by local residents. The discovery (PHUJHQF\H[FDYDWLRQVRIWKH'HSDUWPHQWRI$UFKDHRORJ\RI'XUUHV  GLUHFWHGE\$+RWL0D\$XJXVW FRQFHUQLQJWKHDXWKRUL]DWLRQ granted by the Municipality for the construction of a new building in the GLVWULFWQR6WUHHW³+7URSOLQL³'XUUHVEHWZHHQWKHFHQWUDOFLW\VTXDUH and the current port. Plans of the Italian Archaeological Mission and the Institute of Archaeology. Description Were brought to light in a very complex stratigraphic situation, remains RIWKHODWHFODVVLFDO*UHHNDJH+HOOHQLVWLF5RPDQDQGPHGLHYDODJH The structures are interpreted as warehouse and yard areas, corridors, urban drainage and piers, the remains of public buildings, a well­equip­ ped port district. Even with different orientations, all structures have a stepped toward the coast (east). Quote: ­4.30 m to ­1.80 m aquifer Size: 372 sqm. 204 funzione termale del complesso, che presenta la sequenza tradizionale del mondo romano (frigidarium, tepidarium, calidarium e laconicum). Le dimensioni delle sale e la complessità degli impianti idraulici fanno pensare ad una struttura pubblica, piuttosto che a terme private, anche se la qualità delle pavimentazioni è molto mediocre. L’orientamento nord­sud del complesso sembra avvalorare l’ipotesi di un impianto urbanistico generale della città orientato appunto nord­sud. 'LYHUVHDOWUHWHUPHVRQRVWDWHULQYHQXWHQHOODFLW­ tà, fra cui quelle cui è attribuito il grande mosaico ELDQFRHQHURFRQWHPLPDULQLULQYHQXWRGD97RoL nel 1964 (n. 16 della Carta del rischio archeologi­ FR HGDOWUHGLSLUHFHQWHULQYHQLPHQWRLQGLFDWH con il n. 6 della Carta del rischio archeologico. 5 ­ Il faro di via Troplini. La situazione attuale Le strutture si trovano all’interno di un cantiere edile, completamente recintato. L’area di scavo DUULYD¿QRDOOLPLWHVWHVVRGHOFDQWLHUH8QD visione complessiva è dunque possibile solo dai SLDQLDOWLGHOO¶HGL¿FLRFRQWLJXRDHVW/DIDOGDKD Troplini street: picture of the whole excavations (from the archive of the Italian Archaelogical Mission, Sara Santoro)/ 9LD7URSOLQLIRWRJUD¿DFRPSOHV­ siva dello scavo (archivio Missione Archeologica Italiana, Sara Santoro). 205 The stores (B, C, D, E) The walls of the warehouses located on the eastern side of the excavation are kept to a height of 0,60­1,32 m, oriented north­south. 7KHFRQVWUXFWLRQLVGLYLGHGLQWRIRXUDUHDV %&'( RIWKHIROORZLQJ GLPHQVLRQV[P[P[P[P In the provision of the facilities it can be seen an alignement with the front of the rooms located towards the sea, and its rear wall facing the FRXUW\DUG . ZKLFKWDNHVSODFHLQDODWHUSKDVHRIFRQVWUXFWLRQ ODWH ¿UVWFHQWXU\%& RQDQKLJKHUTXRWH7KHEHDULQJZDOOV   with north­south trend, 0.40 m thick, are built in opus vittatum mixtum, with blocks of limestone bedridden with mortar, alternating with a range of bricks. The bottom, with rows of limestone blocks, is 0.64 m high from the pavement. Rooms B and C are paved with waterproof PRUWDUPL[HGZLWKSLHFHVRIFHUDPLFURRPV'DQG(ZKLFKRULJLQDOO\ formed a single large room, are paved with pink square slabs of clay, with each side 0.46 m. On the inner walls (wall 19)of room E, at a height of 0.83 m, are clearly seen 3­4 horizontal circular holes (about 0,60­0,70 m apart) with diameter 20 ­22 cm, loops, made to host hori­ zontal wooden boards probably. These boards were made to sustain DIUDPHZRUNRIMRLVWVRIWKHÀRRULQJLWVHOIUDLVHGWRSURWHFWWKHJRRGV stored from the soil moisture. The iron nails found in situ were proba­ bly used for the connection between the elements of this structure. The road F A road or paved patio runs alongside the room E, along its south side, at an altitude of about 50 cm higher than that of the room, which suggests that it was carried out at a later time. The section brought to light, which has dimensions 6.30 x2, 90 m, is paved with fragments of semi carved stone with the outside face merged in a layer of con­ crete. The paving is bounded by stone walls enticed with lime mortar. On the southern side of this road runs a carefully built brick channel, ZKRVHÀRRULVPORZHUWKDQWKHSDYHPHQW7KHFRQVWUXFWLRQ technique of the paving of the pavement and walls that surround it is VLPLODUWRWKHDPSKLWKHDWHU ,,FHQW$'  The lighthouse tower (L) On the northern edge of the excavation, a large circular structure of 8 meters in diameter, made of angular blocks of stone and concrete ¿OOLQWKHRXWHUZDOOKDVEHHQLQWHUSUHWHGDVDWRZHURIOLJKWVLJQDOV that was part of the complex signaling system of the ancient, famous DQGEXV\SRUWRI'XUUHV7KHVWUXFWXUHEDVLQJRQWKHEXLOGLQJWHFKQL­ TXHVFDQEHGDWHGWRWKHHQGRI,9EHJLQQLQJRI,,,FHQWXU\%&7KH circular structure has an outer diameter of 8.00m and a wall thickness of 0.80­0.95m. It survives to a height of 1.60 m: 4 rows of blocks are FXUUHQ¤WO\YLVLEOHEXWWKHVWUXFWXUHFRQWLQXHVEHORZWKHDOWLWXGHRIWKH H[FDYDWLRQ)RUWKHEXLOGLQJEORFNVKDYHEHHQXVHGQDWXUDOFRQJOR­ merate, in the form of tapered rectangular, posed dry in horizontal courses, with isodomic tecnique. This technique is common in this re­ JLRQRI(SLUXVDQG,OO\ULDGXULQJWKH+HOOHQLVWLFSHULRGIURPWKHIRXUWK century BC. In Roman times, while keeping the former shape and VL]HWKHWRZHUZDV¿OOHGZLWKDPDVVRIFRQFUHWH WRXJKZDWHUSURRI mortar mixed with medium size stones, pieces of bricks and tiles, 206 provocato l’allagamento completo dell’area di scavo, e l’acqua stagnante ha dato luogo ad una ¿RULWXUDGLDOJKHHHUEHFKHUHQGHLPSRVVLELOH vedere attraverso l’acqua le strutture. Il cantiere è utilizzato anche come discarica dagli abitanti del quartiere. La scoperta6FDYLG¶HPHUJHQ]DGHO'LSDUWLPHQWR GL$UFKHRORJLDGL'XUD]]R GLUH]LRQH$+RWL maggio­agosto 2007) relativi all’autorizzazione concessa dal Municipio per la costruzione di un QXRYRHGL¿FLRQHOTXDUWLHUHLQYLD7URSOLQLIUDOD piazza centrale della città e il porto attuale. Rilievi della Missione Archeologica Italiana e dell’Istituto di Archeologia. Descrizione. Sono stati posti in luce, in una si­ WXD]LRQHVWUDWJUD¿FDPROWRFRPSOHVVDUHVWLGLHWj greca tardo­classica, ellenistica, romana e medie­ vale. Le strutture messe in luce sono interpretabili come magazzini e spazi cortilizi, corridoi, pontili e canalizzazioni urbane, resti di ambienti pubblici, di un quartiere portuale ben attrezzato. Pur con orientamenti diversi, tutte le strutture presentano un andamento digradante verso la costa (a est). 4XRWDPIDOGDDP Misure: 372 mq. I magazzini (B,C,D,E). Le strutture murarie dei magazzini posti sul lato orientale dello scavo si conservano per un’altezza di 0,60­1,32 m, con orientamento nord­sud. La costruzione qGLYLVDLQTXDWWURDPELHQWL %&'( GHOOH VHJXHQWLGLPHQVLRQL[P[P [P[P La disposizione delle strutture vede un allinea­ mento con la fronte degli ambienti collocata in direzione del mare, e la loro parete posteriore SURVSLFLHQWHLOFRUWLOH . LOTXDOHVLFROORFDSHUz LQXQDVXFFHVVLYDIDVHGHOODFRVWUX]LRQH ¿QH I sec. a.C), a quota superiore. I muri portanti (17,19,21) con andamento nord­sud, di spessore 0,40 m sono costruiti in opus vittatum mixtum, con blocchetti di calcare allettati con malta, alter­ nati con un fascia di mattoni. La parte inferiore, a ¿ODULGLEORFFKHWWLFDOFDUHLqDOWDPGDOSLDQR pavimentale. Gli ambienti B e C sono pavimentati con malta impermeabile mischiata con pezzi di FHUDPLFDJOLDPELHQWL'HG(FKHRULJLQDULD­ mente costituivano un unico grande ambiente, sono pavimentati con lastre di terracotta di forma quadrata, aventi per lato 0,46 m, di colore rosato. Sulle pareti interne dell’ambiente E (muro 19) ad un’altezza di 0,83 m si vedono chiaramente 3­4 cavità circolari orizzontali (circa 0,60­0,70 m di distanza una dall’altra) con il diametro 20­22 cm, non passanti, ricavate probabilmente per allog­ giare travi orizzontali. Queste travi reggevano a loro volta un’intelaiatura di travetti che costituiva la pavimentazione vera e propria, sollevata per proteggere le merci conservate dall’umidità del terreno. I chiodi di ferro ritrovati in situ erano probabilmente utilizzati per la connessione tra gli elementi di questo ordito. La strada F Un tratto di strada o cortile pavi­ PHQWDWRFRUUHD¿DQFRGHOYDQR(OXQJRLOVXR lato meridionale, ad una quota di circa 50 cm coarse sand, gravel and chips). On the central part of the structure was placed a rectangular platform with dimensions of 4.00mx 3.60m, bounded by rectangular bricks. The platform lacks a fairly regular portion, rectangular, in the north east, perhaps an ancient spoliation WRUHWULHYHEXLOGLQJPDWHULDOV)UDJPHQWVRI¿UVWFHQWXU\$'LWDOLFWHUUD sigillata pottery provides a possible date for such intervention and the construction of some of the areas nearby, which can be ascribed to WKHHDUO\\HDUVDIWHUWKHGHGXFWLRQRIWKHDXJXVWHDQFRORQ\RI'\UUD­ chium (30 BC). The construction technique of the tower is very different both from WKH/DWH5RPDQIRUWL¿FDWLRQVRIWKHFLW\ WKHZDOOVWKDWWKH%\]DQWLQH (PSHURU$QDVWDVLXV,DQGKLVVXFFHVVRUVEXLOWEHWZHHQWKHODWH¿IWK DQGHDUO\VL[WKFHQWXU\$'WKH\KDYHVWUXWDQGFLUFXODUWRZHUVEXWRI different technique) and from the circular base that is at the heart of macellum, Byzantine too, which served as support for an honorary statue. Instead the tower presents similarities with the round tower which concludes the southern bastion of the Byzantine walls, in the south­east. superiore rispetto a quella del vano E, il che fa supporre che esso sia stato realizzato in epoca successiva. Il tratto messo in luce, che ha dimen­ sioni 6,30x2,90 m, è pavimentato con frammenti di pietra semilavorata con la faccia esterna scalpellata immersi in uno strato di calcestruzzo. Il selciato e’ delimitato da murature in pietra allettata con malta calcarea. Sul lato meridionale di questa strada scorre una canaletta accurata­ mente realizzata in laterizi, il cui piano si trova a PSLLQEDVVRULVSHWWRDOVHOFLDWR/DWHFQLFD costruttiva della pavimentazione del selciato e dei PXULFKHORGHOLPLWDQRqVLPLOHDTXHOODGHOO¶DQ¿WH­ atro (II sec. d.C.). La torre faro (L) Al margine settentrionale dello­ scavo, una grande struttura circolare di 8 metri di diametro, realizzata con muro esterno in conci angolari di pietra e riempimento in calcestruzzo, è stato interpretato come una torre di segnala­ zione luminosa che faceva parte del complesso sistema di segnalazione dell’antico, celebre e IUHTXHQWDWLVVLPRSRUWRGL'XUD]]R/DVWUXWWXUD SHUWHFQLFDHGLOL]LDqGDWDELOHDOOD¿QHGHO,9 207 7KHFRXUW\DUG .  The rectangular courtyard, measuring 7.35 x 7 m, is surrounded by DPWKLFNZDOOEXLOWZLWKVWRQHVDQGPRUWDU7KHÀRRULVPDGHRI “terrazzo” mixed with gravel of different colors, with a vaguely decora­ tive intent. In later stages the yard has been reduced in size with walls of poor construction technique and a latrine (N) was obtained in the end of the obtained corridor. In the north east corner of the courtyard there is a circular pit (with the diameter. 0.80 m), built with semi worked blocks placed dry. It was not completely emptied. This well seems the result of the reduction of DODUJHUFLUFXODUWDQNWKHQ¿OOHGZKLFKFXWDQXPEHURIÀRRUVEHORZ with their substrates, which have been noticed in the section. Two segments of the channel have been discovered in two areas (I, I1), RQHRIZKLFKUXQVSDUDOOHOWRWKHQRUWKHUQZDOORIWKHFRXUW\DUG.WKHQ runs up in altitude. This segment is long 6.2 m wide and 1.23 m, and oriented from northwest to southeast. The side walls of the channel, measuring about 0.40 m high, are made of stones and bricks (0,45 x0, 45x0, 04m) associated with strong hydraulic mortar. The top part of the arch in the risen altitude is set up with seven courses of brick (0.30 m x 0.30 x 0.04 m, 0.30 m x 0.24 x 0.04 m) always enticed with strong hydraulic mortar. The second segment of the channel is inser­ ted diagonally between the structures in room B. After analyzing the construction technique these channels look similar to those already LGHQWL¿HGLQRWKHUDUHDVRIWKHFLW\DWWKHHQGRIWKH¿UVWFHQWXU\$' HDUO\VHFRQGFHQWXU\$' Other areas (H, J, G1, G2, O, P, Q) 2WKHUDUHDVZHUHLGHQWL¿HGRQWKHHDVWDQGZHVWVLGHVRIWKHH[FDYD­ tion, but their location near or beyond the walls of the excavation does not allow us to assume the functions. Rooms P and O were paved with large limestone slabs. The materials collected in association show that the Roman structures remains in use, with a few adjustments, XQWLOWKHPLG¿IWKFHQWXU\$' )LJXUD Troplini street: chronological plan 9LD7URSOLQLULOLHYRLQWHUSUHWDWLYRSHULRGL]]DWR 0LVVLRQH$UFKHRORJLFD Italiana). The early medieval graves The southern part of the excavation area was occupied by some JUDYHVLQWKHHDUO\PHGLHYDOSHULRG VHFF9,,9,,,$' $WDGHSWKRI PZHUHLQIDFWLGHQWL¿HG¿IWHHQJUDYHV0RVWRIWKHPEHORQJ to the “Capuchin” type (tomb No. 3­9, 11­15). Only three of these are burials are cremation (tomb No. 1, 2, 10), in great African type and *D]DDPSKRUDV,QVRPHEXULDOWRPEVKDYHEHHQLGHQWL¿HGIXQHUDU\ objects, such as bronze earrings or rings, funerary crosses (encolpion) that tipologically belong to the craft production of the seventh­eighth century. The graves have been removed with the excavation, but there DUHVWLOOWUDFHVZKHUHWKH\KDYHEURNHQWKURXJKWKHOLPHVWRQHVODEÀRRU 208 inizi del III sec. a.C.. La struttura circolare ha una diametro esterno di 8 m ed uno spessore del muro di 0,80­0,95 m. Sopravvive per un’altezza GLFLUFDPVRQRDWWXDOPHQWHYLVLELOL¿ODULGL conci, ma la struttura prosegue al di sotto della quota dello scavo. Per la costruzione sono stati usati blocchi in conglomerato naturale, in forma di parallelepipedo rastremato, posti in opera a secco in corsi orizzontali, con tecnica isodoma. Questa tecnica è diffusa in questa zona dell’Epiro e GHOO¶,OOLULDGXUDQWHLOSHULRGRHOOHQLVWLFRGDO,9VHF a.C. In età romana, pur conservando la forma e le dimensioni precedenti, la torre fu riempita di una massa di calcestruzzo (malta dura impermeabile mescolata con pietre di media dimensione, pezzi di mattoni e di tegole, sabbia grossa, ghiaia e schegge). Sulla parte centrale della struttura fu posta una piattaforma rettangolare con dimensioni di 4x3,60 m, perimetrata da mattoni rettangolari. La piattaforma manca di una porzione abbastanza regolare, rettangolare, nell’angolo nord­est, forse per uno spoglio e demolizione già in antico per recuperare il materiale edilizio. Qualche frammen­ to di vasellame in terra sigillata italica del I sec. d.C. fornisce una possibile datazione per questo adattamento e per la costruzione di alcuni degli ambienti vicini, che possono ascriversi ai primi anni dopo la deduzione della colonia augustea D'\UUDFKLXP D& /DWHFQLFDFRVWUXWWLYD GHOODWRUUHqPROWRGLYHUVDVLDGDOOHIRUWL¿FD]LRQL tardoantiche della città (le mura che l’imperatore bizantino Anastasio I e i suoi successori costruiro­ QRIUDOD¿QHGHO9HJOLLQL]LGHO9,VHFG&HVVH presentano torri a puntone e anche circolari, ma di tecnica differente da questa) sia dal basamento circolare che sta al centro del macellum, sempre bizantino, e che doveva servire da supporto per una statua onoraria. Presenta invece similarità con la torre rotonda che conclude il bastione meridionale delle mura bizantine, a sud­est. Il cortile (K) Il cortile rettangolare, di dimensioni 7,35x7 m, è circondato da un muro spesso 0,45 m, costruito con pietre e malta. La pavimenta­ zione è realizzata in cocciopesto mescolato con ghiaia di vari colori, con un intento vagamente decorativo. In fasi successive il cortile è stato ridotto di dimensioni con muri di cattiva tecnica costruttiva ed una latrina N è stata ricavata nel fondo del corridoio così ottenuto. Nell’angolo nord est del cortile si trova un pozzo di forma circolare (con il diametro 0,80 m), costruito con blocchi semilavorati posti in opera a secco. Non è stato svuotato interamente. Questo pozzo sembra O¶HVLWRGHOODULGX]LRQHGLXQDSLODUJDYDVFD circolare, poi riempita, che tagliava una serie di pavimentazioni sottostanti con relativi sottofondi, FKHVRQRVWDWHYLVWHLQVH]LRQH'XHVHJPHQWLGL canalizzazione scoperti in due ambienti (I, I1), uno dei quali corre parallelo alla parte settentrionale GHOPXURGHOFRUWLOH.SHUGHVFULYHUHSRLLQVDOWRGL quota. Questo segmento e’ lungo 6,20 m e largo 1,23 m, è orientato da nord­ovest a sud­est. I muri laterali del canale, che misurano circa 0,40 m di altezza, sono realizzati in pietre e mattoni (modulo 45x45x4 m) legati con malta idraulica tenace. L’arcovolto del salto di quota è rialzato Troplini street: particular of the wall texture from the “lighthouse”/ Via Troplini: particolare della tessitura muraria del “faro” (Missione Archeologica Italiana). Reminants of the Ottoman period Were eliminated int the proceeding of the stratigraphic excavation. 7KH\FRQVLVWHGRIDWOHDVWRQHEXLOGLQJRI[PGH¿QHGE\VWRQH walls bound with clay mortar of poor quality. Turkish ceramic (eighte­ enth century) found in association with the structures allows us to say WKDWWKLVDUHDRIWKHGLVWULFWRI9DURVKDLQWKH2WWRPDQHUDZDVXVHG for crafting activities. Assumptions and Comparisons The connection of the round tower with warehouses, piers, tanks and hydraulic systems supports the hypothesis that it is a lighthouse. The round shape is typical of lighthouses in the eastern Mediterranean, the nearest comparison is with the three Greek lighthouses on the island of Thasos, and the Roman one just discovered in Patara in Turkey. The ancient lighthouses (Greek and Roman) known in the Mediter­ ranean Sea are a hundred: the documentation and literary represen­ tations in painting, sculpture, mosaics and coins was very abundant because the lighthouse was a formidable monument to celebrate the power of rulers, and a exhibit of building techniques and technology. Only twenty of these lighthouses are still known and preserved legible remains. The most famous of all lighthouses, the one in Alexandria, ZKLFKZDVRQHRIWKHVHYHQZRQGHUVRIWKHZRUOGLVKRSHOHVVO\ORVW FRQVHWWHFRUVLGLPDWWRQL PRGXOL[[FP 30x24x4 cm) sempre allettati con malta idraulica forte. Il secondo segmento della canalizzazione si inserisce diagonalmente tra le strutture dell’am­ biente B. In base all’analisi della tecnica costrutti­ va queste canalizzazioni appaiono simili a quelle JLjLGHQWL¿FDWHLQDOWUHDUHHGHOODFLWWjGHOOD¿QH del I inizi II d.C. Altri ambienti (H, J, G1, G2, O, P, Q) $OWULDPELHQWLVRQRVWDWLLGHQWL¿FDWLVXLODWLRULHQWDOL ed occidentali dello scavo, ma la loro collocazio­ ne a ridosso o oltre le pareti dello scavo non ci consente di ipotizzarne le funzioni. Gli ambienti P e O erano pavimentati in grandi lastre di calcare. I materiali in associazione raccolti dimostrano che le strutture di epoca romana rimangono in uso, con SRFKLDJJLXVWDPHQWL¿QRDOODPHWjGHO9VHFG& Le tombe altomedievali La zona meridionale dell’area di scavo fu occupata da alcune sepolture QHOSHULRGRDOWRPHGLHYDOH VHFF9,,9,,, $OODSUR­ IRQGLWjGLPVRQRVWDWHLQIDWWLLGHQWL¿FD­ te quindici tombe. La maggior parte e’ della tipolo­ gia “alla cappuccina” (tombe 3­9, 11­15). Solo tre di queste sono sepolture ad inumazione (tombe 1, 2, 10), entro anfore del tipo africano grande e di Gaza. In alcune delle tombe alla cappuccina VRQRVWDWLLGHQWL¿FDWLDQFKHRJJHWWLGLFRUUHGR quali orecchini o anelli di bronzo, croci funerarie (encolpion), che tipologicamente fanno parte della SURGX]LRQHDUWLJLDQDOHGL9,,9,,,VHF/HWRPEH 209 Byzantine and Turkish walls: the “venetian” tower/Le mura bizantine e turche: la torre “veneziana” the best preserved, in La Coruna in Spain, this year received the title of UNESCO monument of humanity. The round tower has some similarities with that, round too, which ends the southern bastion of the Byzantine walls, to the east, now fully incorporated into the new building that was built above, and then hardly visible. Although larger, this big tower shows the base made in large curved conglomerate segments, on which rises a cylindrical body, subjected to evident reconstructions and raised in different eras, especially Byzantine and medieval. The relative positions of the two towers recalls the system of towers / lighthouse island of Thasos )LJ ZKLFKDUHGDWHGWRWKHVL[WKFHQWXU\%&$VPHQWLRQHGWKH similarities between the construction technique used in lighthouse of 'XUUHVDQGLQWKRVHRI7KDVRVDUHVLJQL¿FDQW 6 ­ The section of “Turkish” wall and the clock tower The current situation This was the section of the defenses that, breaking away from the corner of South East Castle (the so called Quote 59), descended in a straight line to the sea. It remains today the entire stretch to the point where, less than a century ago, there still was the “main gate” (Gate <DOL DQGZKLFKQRZLVWKH%RXOHYDUGDQGVRPHUHPDLQVRIWKH³FORFN WRZHU´+HX]H\DQG'DXPHWDWWULEXWHLWVFRQVWUXFWLRQWRWKHSHULRGRI Turkish rule, based on the presence, between the reuse material of ZKLFKLVPDGHRIVHYHUDOWRPEVWRQHVGDWLQJWRWKH¿IWHHQWKFHQWXU\ 5HJDUGLQJWKH¿UVWSDUW FDVWOH%RXOHYDUG DFFRUGLQJWR-HUDN.D­ raiskaj it was about 250 m long,with a thickness variable at the base from 3 to 3.30 m. This is rectilinear segment of walls, made with an emplekton with simple stone and reused stone ornaments bedridden ZLWKWRXJKPRUWDUWKHHPEDWWOHGSDUDSHWZKLFKVXUYLYHGLQVRPH sections, is made of bricks, also probably reused. The disappearance of the section from where it was located the main door is probably a 210 sono state asportate con lo scavo, ma ne restano le tracce dove hanno sfondato la pavimentazione in lastre di calcare. Resti del periodo ottomano Sono stati eliminati dal procedere dello scavo VWUDWLJUD¿FR(VVLFRQVLVWHYDQRLQDOPHQRXQ HGL¿FLRGL[PGH¿QLWRGDPXULLQSLHWUDPH legato con malta argillosa di scarsa qualità. &HUDPLFDGLSURGX]LRQHWXUFD ;9,,,VHFROR WUR­ vata in associazione con le strutture ci consente GLGLUHFKHTXHVWD]RQDGHOTXDUWLHUHGL³9DURVK´ in epoca ottomana fu adibito ad attività artigianali. Ipotesi e confronti La connessione della torre rotonda con magaz­ zini, pontili, sistemi idraulici e cisterne avvalora l’ipotesi che si tratti di un faro. La forma rotonda è tipica dei fari del Mediterraneo orientale, il FRQIURQWRSLVWULQJHQWHqFRQLWUHIDULGHOO¶LVROD di Thasos, di epoca greca e con quello romano appena scoperto a Patara in Turchia. I fari antichi (greci e romani) noti nel Mediterraneo sono un centinaio: la documentazione letteraria e le rappresentazioni in pittura, scultura, mosaici e su monete fu molto abbondante perché il faro costituiva un formidabile monumento di celebra­ zione del potere dei sovrani, e di esibizione di tec­ nica edilizia e di tecnologia. Solo una ventina di questi fari noti presentano ancora resti conservati HOHJJLELOL,OSLIDPRVRGLWXWWLLIDULTXHOORGL Alessandria, che era una delle sette meraviglie GHOPRQGRqLUULPHGLDELOPHQWHSHUGXWRTXHOOR meglio conservato, a La Coruña in Spagna, ha ricevuto quest’anno il titolo di monumen­ to dell’umanità dall’Unesco. La torre rotonda ha alcuni elementi di somiglianza con quella, ugualmente rotonda, che conclude il bastione meridionale della cinta bizantina, verso est, oggi FRPSOHWDPHQWHLQJOREDWRQHOQXRYRHGL¿FLRFKHYL è stato costruito sopra e quindi visibile con molta GLI¿FROWj%HQFKpGLGLPHQVLRQLPDJJLRULTXHVWD grossa torre presenta la base realizzata in grandi conci curvilinei di conglomerato, sui quali si alza il corpo cilindrico, oggetto di evidenti ricostruzioni e result of the substantial twentieth century dismantling related to the construction of the boulevard. The condition is almost perfect, even if at least the tower that is part of, but probably also some points of the external ornament (Northeast) were, more or less, heavily restored. The walls and the tower feature at the top of a guard walk still partially YLDEOHZKLOHWKHZRRGHQÀRRUVLQVLGHWKHWRZHUDUHSUREDEO\FROODS­ sed. The inner side of the curtain (southwest) is now a limit property of various private homes located between the walls themselves and the amphitheater and is not accessible to the public. On the outside instead there are certain stretches of garden, theoretically “public”, which could be recovered. The “clock tower”, so called because of the last function that has taken over the course of its history, is located along the alignment of WKHVDPHVHFWLRQRIZDOOEXWVRX¤WKHDVWRIWKH%DVKNLDZKHUHWKH\ have disappeared, the center of a small public garden area. It is now reduced to a few ruins, marked by a facade made of reused material blocks, some of which seem of the same type and sizes of those square blocks of the Classical period. Its likely to be ascribed to the same phase ­ late medieval ­ of the walls on which they were placed, and that has been built using materials coming from the spoliation of much older buldings. %DUEDUD6DVVL3URJHWWR'XUUHV0LVVLRQH$UFKHRORJLFD,WDOLDQDD'XUD]]RGLUH­ zione: Prof. Sara Santoro, Università di Parma, Università di Chieti ­ Pescara (http:// ZZZSURJHWWRGXUUHVXQLSULW WUDGLQJO00RGHUDWR %,%/,2*5$),$ %$d($.$5$,6.$-*M.DODMDH'XUUsVLWGKHIRUWL¿NLPHWSsUUHWKQsNRKsQHYRQs antike, “Monumentet” 9, pag. 5­14. +(8=(</'$80(7+Mission archéologique de Macédonie, Paris. 0,5$-/7HUPDWH'\UUDKXW³Iliria” 1­2, pag. 207­224. 5(</Fouilles de la Mission Francaise à Apollonie d’Illyrie et à Durazzo (1923­24), “Albania” 1, pag. 9­32. +27<$,OSDWULPRQLRDUFKHRORJLFRGHOPXVHRHGHOODFLWWjGL'XUUHVLQ%825$0 SANTORO S. (eds.), Progetto Durrës. L’indagine sui beni culturali albanesi dell’antichità e del medioevo: tradizioni di studio a confronto, “Antichità Altoadriatiche” LIII, pp. 129 ­ 148. 6$172526/RVWDWRGHJOLVWXGLVXOO¶XUEDQLVWLFDGL(SLGDPQRV'\UUDFKLXPLQ%825$ M., SANTORO S. (eds.), Op. cit., pag.129­148. SANTORO S. 2009, Epidamnos, Dyrrachium, Dyrrachion: urbanistic and cultural transfor­ mations in a port between Orient and Occident ;9,,,QWHUQDWLRQDO&RQJUHVVRI&ODVVLFDO Archaeology, Rome 22­26 September 2008), www.beniculturali.it/bao. 6$1725266$66,%+27,$FVUna nuova immagine dell’urbanistica di Epidamnos­ Dyrrachium dagli scavi e dalle ricerche del Dipartimento di Archeologia e della Missione Archeologica Italiana di Durrës, (Actes du colloque international L’Illyrie méridionale et l’Epire GDQVO¶$QWLTXLWp9*UHQREOHRFWREUH  rialzamenti in varie epoche, soprattutto bizantine e medievali. La posizione reciproca delle due torri ricorda il sistema di torri/faro dell’isola di 7KDVRVFKHVRQRGDWDWHDO9,VHFD&&RPH si è detto, le somiglianze fra la tecnica edilizia XWLOL]]DWDQHOIDURGL'XUD]]RHLQTXHOOLGL7KDVRV sono notevoli. 6 ­ Il tratto di mura “turche” e la torre dell’oro­ logio La situazione attuale Questo era il tratto delle difese che, distaccan­ dosi dall’angolo sudorientale del castello (cd. Quota 59) discendeva in linea retta verso il PDUH'LHVVRRJJLUHVWDQRO¶LQWHURWUDWWR¿QRDO punto in cui, poco meno di un secolo fa, sorgeva DQFRUDODFRVLGGHWWD³SRUWDJUDQGH´ 3RUWD<DOL  e nel quale ora transita il Boulevard, ed alcuni UHVWLGHOOD³WRUUHGHOO¶RURORJLR´+HX]H\H'DXPHW ne attribuiscono la costruzione al periodo della dominazione turca, in base alla presenza, tra il materiale di reimpiego che la costituisce, di varie ODSLGLGDWDELOLDO;9VHFROR3HUTXDQWRULJXDUGD il primo tratto (castello­Boulevard) secondo Jerak .DUDLVNDMHUDOXQJRXQWRWDOHGLFLUFDPSHU uno spessore alla base variabile dai 3 ai 3,30 m. Si tratta di un segmento rettilineo di mura realizzate “a sacco”, con paramenti costituiti da pietrame e materiale lapideo di reimpiego DOOHWWDWRFRQPDOWDWHQDFHLOSDUDSHWWRPHUODWR del quale sopravvivono alcuni tratti, è invece realizzato in mattoni, anch’essi probabilmente di reimpiego. La scomparsa del tratto a partire da dove si trovava la porta grande è con ogni probabilità esito del consistente smantellamento novecentesco correlato con la realizzazione del Boulevard. Lo stato di conservazione è quasi perfetto, anche se almeno la torre che ne fa parte, ma probabilmente anche alcuni punti del SDUDPHQWRHVWHUQR QRUGHVW VRQRVWDWLSLR meno pesantemente restaurati. Le mura e la torre sono dotati in sommità di un cammino di ronda probabilmente almeno ancora parzial­ mente percorribile, mentre i solai lignei interni alla torre sono probabilmente crollati. Il lato interno della cortina (sud­ovest) funge oggi da limite di proprietà delle varie abitazioni private FROORFDWHWUDOHPXUDVWHVVHHO¶DQ¿WHDWURHQRQ è accessibile al pubblico. Sul lato esterno invece esistono taluni tratti di verde, teoricamente “pubblico”, che potrebbero essere recuperati. La cosiddetta “torre dell’orologio”, così chiamata per via dell’ultima funzione che ha assunto nel corso della sua storia, si colloca lungo l’allineamento dello stesso tratto di mura, ma a sud­est della Bashkia, dove queste sono scomparse, al centro di una piccola area di verde pubblico. Essa è ridotta oggi a pochi ruderi, caratterizzati da un paramento costituito principalmente da blocchi di materiale di reimpiego, alcuni dei quali sembrano di tipologia e dimensioni compatibili con quelle dei conci di opera quadrata di epoca classica. È probabile che essa sia da ascrivere alla stessa fase ­ tardomedievale ­ delle mura sulle quali si collocava, e che sia stata realizzata utilizzando materiali di reimpiego provenienti dalla spoliazio­ QHGLUXGHULGLHGL¿FLPROWRSLDQWLFKL 211 4.3 The preparatory seminars and outside visits/ I seminari preparatori e le visite sul campo International workshop Durres, Albania, November 18, 2008, Palace of Culture A. Moisiu Prof. Sara Santoro+HDGRI,WDOLDQ$UFKDHRORJLFDO0LVVLRQLQ'XUUHV University of Parma Dr. Afrim Hoti, archaeologist Center of Albanology­ Archaeology Institute of Albania Prof. Piero Rovigatti'$578QLYHUVLW\RI3HVFDUDUHVSRQVLEOHRI Master Plan of the Central Area Dr. Besim Lila, Institute of Cultural Monuments, ICM Eng. Roland Olli, Center of Albanology, Agency for Archaeology On the day of November 18 had full swing and successful the program announced, whose main goal was to focus group participants at the second stage of the competition problems on the protection and exploitation of the vast archaeological and cultural historical present in the liria square and its surrounding spaces. The protagonists of this meeting were researchers who for years lead excavations and archaeological investigations in the city ­ among them, in addition to archaeological Albanian leaders of major excavations in previous years, the archaeological mission of the University of Parma, directed by Professor Sara Santoro , this meeting ­ and representatives of institutions responsible for the protection and enhancement of these assets (present at Ing. Roland Olli, the new director of the Agency for DUFKHRORJ\RIWKH&HQWHUIRU$OEDQRORJ\DQG'U%HVLP/LODUHSUH­ senting the Institute of Monuments of Culture. The initial program, which included a morning seminar and a guided tour of the excava­ tions and archaeological sites in the afternoon, has added a further working meeting, during which been further discussed the issues of LQWHUYHQWLRQDQGKDGEHHQVSHFL¿HGWKHSDUDPHWHUVIRUWKHVHFRQG stage of the competition. Meeting with archaeological experts and institutions responsible for protection The meeting with Professor Sara Santoro, director of the Archaeolo­ JLFDO0LVVLRQLQ'XUUHV8QLYHUVLW\RI3DUPDDIWHUDEURDGDQGKLVWR­ rical framework of the city and state studies of urbanism Epidamnos '\UUDFKLXP QDPHVRIWKH*UHHNFLW\WKH¿UVWLQGLFDWLQJWKHFLW\¶V second port) has provided exciting new directions of research and 212 Workshop internazionale Durres, Albania, 18 novembre 2008, Palazzo della Cultura A. Musiu Prof. Sara Santoro, Missione Archeologica ,WDOLDQDD'XUD]]R8QLYHUVLWjGL3DUPD Dott. Afrim Hoti, archeologo, Centro di Albanologia­ Istituto di Archeologia di Albania Prof. Piero Rovigatti'$578QLYHUVLWjGL Pescara, responsabile del Master Plan dell’area FHQWUDOHGL'XUD]]R Dott. Besim Lila, Istituto dei Monumenti Culturali, ,0. Ing. Roland Olli, Centro di Albanologia, Agenzia per l’Archeologia Nella giornata del 18 novembre ha avuto pieno svolgimento e successo il programma annun­ ciato, il cui principale obiettivo era quello di concentrare l’attenzione dei gruppi partecipanti alla seconda fase del concorso sui problemi di tutela e valorizzazione del vasto patrimonio archeologico e storico culturale presente nella piazza Iliria e nei suoi spazi attigui. Protagonisti di tale incontro sono stati i ricercatori che da anni conducono scavi e indagini archeologiche nella città – tra questi, oltre agli archeologici albanesi, responsabili delle principali campagne di scavo negli anni passati, la missione archeologica della Università di Parma, diretta dalla professoressa Sara Santoro, presente all’incontro – e i rappre­ sentanti delle Istituzioni responsabili della tutela e della valorizzazione di tale patrimonio (presenti all’incontro l’ing. Roland Olli, neo direttore della nuova Agenzia per l’archeologia del Centro per l’Albanologia, e la dott. Besim Lila, in rappresen­ tanza dell’Istituto dei Monumenti di Cultura. Al programma iniziale, che prevedeva un seminario mattutino e una visita guidata agli scavi e alle aree archeologiche nel pomeriggio, è stata aggiunta una ulteriore riunione di lavoro, nel corso della quale sono stati ulteriormente discussi I temi di intervento e precisate le richieste per la partecipazione alla seconda fase del concorso. study design, together with availability for all groups participating in the competition of new materials of knowledge, particularly relating to the following sites of the study: +HOOHQLVWLFOLJKWKRXVHDUHDWRWDOVWDWLRQVXUYH\VLWHSODQZLWK steps, summary (2 pages), text support (with an article descriptive FRPSDULVRQV  2. slaughterhouse­spa area: plant integral summary (2 pages) with LQGLFDWLRQVRISRVVLEOHFRPSDULVRQV 3. amphitheater area: topographic survey, design input from ladders, summary (2 folders) and comparisons. ,WµZDVDOVRSUHVHQWHGDVKRUWSDSHURQWKHFHQWHURIWKHDQFLHQWFLW\ DQGGHOLYHUHGD&'520FRQWDLQLQJDQH[WHQVLYHFROOHFWLRQRIWH[WV bibliographies, collections, images, reliefs and other drawings. In the long and detailed presentation of particular interest were compari­ sons also suggested, for example between the Macellum ­ Byzantine )RUXPRI'XUD]]RZLWKWKDWRI&RQVWDQWLQHLQ&RQVWDQWLQRSOHDQGWKH -RUGDQLDQ-HUDVKDQGEHWZHHQWKHEHDFRQRI+HOOHQLVWLFFLW\UHFHQ­ WO\GLVFRYHUHGQHDU7RZQ+DOODQGWKHUDUHRWKHUH[DPSOHVRIVLPLODU monuments found on the Mediterranean coast, including those of Thas island, dating back to Greek and Roman recently discovered in Patara, Turkey. In terms of graphic documentation, the contribution of interest in the contribution of the Italian archaeological mission of 'XUUHVWRWKHDFWLYLWLHVRIWKHFRPSHWLWLRQRQLWVSDGXQSXEOLVKHGWKH ÀDJVKLSRIWKH%\]DQWLQH(PSLUHDQGWKHWDEOHVKRZLQJWKH¿QGLQJV of excavations carried out by 1960 to 1965 by archaeologists in the $OEDQLDQ5RPDQEDWKV WKHUHOHYDQWWDEOHLVGDWHG¿JDQG Incontro con gli esperti archeologici e i responsabili delle istituzioni di tutela L’incontro con la professoressa Sara Santoro, GLUHWWULFHGHOOD0LVVLRQH$UFKHRORJLFDD'XUD]]R dell’Università di Parma, dopo una ampia ed esaurente relazione di inquadramento storico della città e dello stato degli studi sull’urbanistica GL(SLGDPQRV±'\UUDFKLXP WRSRQLPLGHOODFLWWj greca, indicanti il primo la città il secondo il porto) ha fornito nuove interessanti indicazioni di ricerca e di approfondimento progettuale, assieme alla disponibilità per tutti i gruppi partecipanti al con­ corso di nuovi materiali conoscitivi, in particolare relativi ai seguenti luoghi dell’area di studio: 1. area del faro ellenistico: rilievo total station, planimetria con fasi, scheda sintetica (2 cartelle), testo di supporto ( un articolo descrittivo con FRQIURQWL  2. area del macello­terme: pianta integrale, scheda sintetica ( 2 cartelle) con indicazioni dei SRVVLELOLFRQIURQWL DUHDGHOO¶DQ¿WHDWURULOLHYRWRSRJUD¿FRSURJHWWR dell’ingresso dalle scalette, scheda sintetica (2 cartelle) e confronti. E’ stato inoltre presentato anche un breve testo sul centro della città antica, e consegnato un &'URPFRQWHQHQWHXQDHVWHVDUDFFROWDGLWHVWL UDFFROWHELEOLRJUD¿HLPPDJLQLULOLHYLHGDOWUL HODERUDWLJUD¿FL1HOODOXQJDHDUWLFRODWDSUHVHQ­ 213 29 in the brochure delivered by hand during the workshop). Please note that emerges from this survey also found only trace (visible on VLWH RIURDGRIWKH5RPDQFLW\VRIDUIRXQGLQ'XUUHV PZLGH ZLWKWUHQGVQRUWKVRXWK 7KLV¿QGLVYHU\LPSRUWDQWEHFDXVHLWLVWKH only one who can testify on the basis of certainty the likely direction of the city’s road jersey, and thus guide the development in the vicinity of the discovery of new excavations. Just the excavation, the latest ÀDJVKLS+HOOHQLVWLFDGGHGDVHFRQGWUDFNLQUHODWLRQWRWKDWURDGQHW­ ZRUNDOWKRXJKDWDJUHDWGLVWDQFHIURPWKDW¿QGLQJDQGSUREDEO\DOVR in relation to a different historical period. These excavations are so few tracks for the hypothetical reconstruction of the urban structure of WKHDQFLHQWFLW\ZKLFKFRXOGDOVREHQH¿WIURPQHZH[FDYDWLRQVDOVR expansion of these areas. These interesting features are also added valuable insights and observations on the “wall in the garden” in the “public” on the west side of the square containing the wall, considered by many traces of Ottoman walls, which has proved to be factor the outer wall of the Roman amphitheater of the city. These develope now allow integration of the table base competition, and deliver to all parti­ cipants new design elements for discussion of archaeological themes, dominant in many areas of the square. Design themes These themes lend themselves to an hour and their partial list of all JXLGDQFHDQGGH¿QLWLRQHYHQRQWKHEDVLVRILQIRUPDWLRQUHFHLYHG and the comments received following the valuable lesson of Professor 6DQWRURDQGDOVRWKH¿HOGYLVLWFDUULHGRXWZLWKWKHVDPHJXLGH tazione, di particolare interesse sono stati anche i confronti suggeriti, ad esempio tra il Macellum – IRUREL]DQWLQRGL'XUD]]RFRQTXHOORFRVWDQWLQLDQR di Costantinopoli e quello giordano di Gerasa, e quelli tra il faro ellenistico della città, recentemen­ te scoperto in prossimità del Palazzo Comunale e i rari altri esempi di monumenti analoghi presenti sulle coste del Mediterraneo, tra cui quelli dell’iso­ la di Thaso, di epoca greca, e quello romano UHFHQWHPHQWHVFRSHUWRD3DWDUDLQ7XUFKLD'DO SXQWRGLYLVWDGHOODGRFXPHQWD]LRQHJUD¿FD l’apporto di maggior interesse nel contributo della PLVVLRQHDUFKHRORJLFDLWDOLDQDGL'XUD]]RDOOH attività del concorso riguarda proprio il rilievo, inedito, dell’area del faro bizantino, e la tavola riportante i rilievi degli scavi condotti dal 1960 al 1965 dagli archeologi albanesi nelle terme roma­ QH ODWDYRODGLULOLHYRqGDWDWD¿JH nella brochure consegnata a mano nel corso del workshop). Si ricorda che da tale rilievo emerge anche l’unica traccia accertata (e visibile in loco) GLDVVHVWUDGDOHGHOODFLWWjURPDQD¿QTXLULWURYDWR LQ'XUD]]R ODUJDPFRQDQGDPHQWRQRUG – sud). Questo ritrovamento è molto importante, perché è l’unico che può testimoniare su basi certe un probabile orientamento della maglia stradale della città, e dunque orientare lo sviluppo in prossimità del ritrovamento di nuovi scavi. Proprio lo scavo, recentissimo del faro ellenistico ha aggiunto una seconda traccia rispetto a tale tracciato viario, anche se a molta distanza da tale ritrovamento, e probabilmente anche in relazione ad un differente periodo storico. Tali scavi costitui­ scono dunque le poche tracce per la ricostruzione ipotetica della struttura urbana antica della città, FKHSRWUHEEHSHUDOWUREHQH¿FLDUHGLQXRYLVFDYL anche ad ampliamento delle aree menzionate. A questi motivi di interesse vanno anche aggiunte la preziose indicazioni e osservazioni sul “muro nel giardino”, nell’area “pubblica” a lato ovest della piazza, contenente le mura, da molti considerato traccia delle mura ottomane, che si è invece ULYHODWRHOHPHQWRGHOPXURHVWHUQRGHOO¶DQ¿WHDWUR romano della città. Tali elaborati permettono ora una integrazione della tavola di base del concorso, e consegnano a tutti i partecipanti nuovi elementi per la trattazione progettuale dei temi archeologici, dominanti in molte aree della piazza. Temi di progettazione Tali temi si prestano ora ad una loro parziale e del WXWWRRULHQWDWLYDHOHQFD]LRQHHGH¿QL]LRQHDQFKH sulla base delle informazioni ricevute e delle osservazioni raccolte a seguito della preziosa le­ zione della professoressa Santoro, e anche della visita sul campo svolta con la stessa guida. 214 1. Macellum ­ Byzantine court. The area has been abandoned. In the past it was often used for outdo­ or performances, and there was also an attempt to place a metal fra­ me structure, to create a platform to air a commercial service around the complex. Recently such a structure (contrary to the allegations cited in the brochure) was removed, but remains open the question of a conscious and legitimate use of the area. The entire archaeological area is bordered by a low fence, which does not have access ope­ nings. This fence does not seem able to protect the area from possible intrusions, but rather is to decide whether to make the space more workable, albeit under controlled forms (as for example in the Roman )RUXPRUWKH0DUNHWVRI7UDMDQLQ5RPH RUWRHVWDEOLVKGH¿QHGLQ closed area, and pears. An immediate problem, and solution is not LPSRVVLEOHJLYHQWKHSUHVHQFHRID39&VHZHUWKDWFURVVHVWKHZKROH DUHDDQGWKDWDSSHDUVWRVROYHRQHRIWKH¿UVWLQFRQVLVWHQFLHVLQWKH draft resettlement, with apparently the result of collecting and disposal of stormwater into the open space. Another possible indication regards the possible and desirable extension of the excavation, at least to the VRXWKDQGLQWHJUDWLRQDQGWKHUHXQL¿FDWLRQRIWKHDUFKDHRORJLFDODUHD with the nearby spa, under the current Palace of Culture (A. Musiu Theatre). Sara Santoro rightly reminds us, but also the quality and interest of a garden facing the south, where it maintains “one of the few Turkish cafe atmosphere, with tables in the garden. Also to encou­ rage measures to cushion the impact of new development behind the archaeological works through a green or other measures (redesign of the facades, partial demolition). 1. Macellum – foro bizantino. L’area si presenta in stato di abbandono. In passato è stata spesso utilizzata per spettacoli all’aperto, e c’è stato an­ che un tentativo di collocare una struttura a telaio in metallo, per la realizzazione di una pedana all’aperto di un servizio commerciale adiacente al complesso. Recentemente tale struttura (con­ trariamente a quanto dichiarato nella brochure citata) è stata rimossa, ma rimane aperto il pro­ blema di un uso consapevole e legittimo dell’area. L’intera area archeologica è delimitata da una recinzione bassa, che non presenta aperture di accesso. Tale recinzione non sembra in grado di SURWHJJHUHO¶DUHDGDSRVVLELOLLQWUXVLRQLSLXWWRVWR è da decidere se rendere lo spazio maggiormente praticabile, sia pure in forme controllate (come DYYLHQHDGHVHPSLQHL)RUL5RPDQLRDL0HUFDWL 7UDLDQHLD5RPD RSSXUHGLVWDELOLUQHODGH¿QL]LR­ ne in area chiusa, non praticabile. Un problema immediato, e di non impossibile soluzione è an­ che dato dalla presenza di una condotta fognaria LQ39&FKHDWWUDYHUVDWXWWDO¶DUHDHFKHDSSDUH una delle prime, banali incongruenze da risolvere nel progetto di nuova sistemazione, assieme evidentemente alla soluzione della raccolta e dello smaltimento delle acque meteoriche nello spazio aperto. Una ulteriore possibile indicazione riguarda la possibile ed auspicabile estensione dello scavo, almeno verso Sud, e l’integrazione e il ricongiungimento di tale area archeologica con quella limitrofa delle terme, sotto l’attuale Palazzo della Cultura. Si segnala, però anche la qualità e l’interesse della sistemazione a giardini del fronte sud, dove si conserva “uno dei pochi caffè di atmosfera turca, con tavoli nel giardino”. Sono inoltre da favorire misure che attenuino l’impatto delle nuove costruzioni alle spalle dell’area arche­ ologica, attraverso opere a verde o altre misure (restyling delle facciate, demolizioni parziali). 215 2. Roman baths. The relief provided to update the base table of the competition, and also suggest possible extensions of the original building, “which introduces the traditional sequence of the Roman world (frigidarium WHSLGDULXPFDOLGDULXPDQGODFRQLFXP ,WµFDQDOVRWKLQNEDVHGRQWKH HODERUDWHO\SURYLGHGE\WKHRI¿FHRI8UEDQ3ROLF\ ,QD;KDNRQL$UFK  on the Palace of Culture, to devise an internal connection between the building and the area’s public theater archaeological below. And µSRVVLEOHDQGGHVLUDEOHHYHQDQHQODUJHPHQWRIWKHDUFKDHRORJLFDO area, both north, whereas the acquisition of public land area currently occupied by a skeleton of reinforced concrete, on safe ground archa­ eological (see materials archaeological mission), probable area input of the Imperial Palace in the city, both eastward and westward, to ZHOGDVLQJOHH[FDYDWLRQDUHDEHWZHHQWKHEDWKVDQGWKH)RUXPLQWKH preceding paragraph. 216 2. Terme romane. I rilievi forniti permettono di aggiornare la tavola base del concorso, e anche di ipotizzare possibili HVWHQVLRQLGHOO¶HGL¿FLRRULJLQDULR³FKHSUHVHQWDOD sequenza tradizionale del mondo romano (frigi­ darium, tepidarium, calidarium e laconicum)”. E’ anche possibile pensare, sulla base degli elaborat IRUQLWLGDOO¶XI¿FLR8UEDQLVWLFRGHO&RPXQH DUFK Ina Xhakoni) relativi al Palazzo della Cultura, di LGHDUHXQFROOHJDPHQWRLQWHUQRWUDO¶HGL¿FLRSXE­ blico del teatro e l’area archeologica sottostante. E’ possibile e auspicabile anche un allargamento dell’area archeologica, sia verso Nord, consi­ derando anche l’acquisizione a suolo pubblico dell’area attualmente occupata da uno scheletro in cemento armato, su sicuro suolo archeologico (vedi materiali missione archeologica), probabile area di ingresso del Palazzo Imperiale della città, sia verso Est e verso Ovest, a saldatura di una XQLFDDUHDGLVFDYRWUDOHWHUPHHLO)RURGLFXLDO punto precedente. 3. Ottoman walls and walls of the amphitheater. This area of the project was discussed during the seminar in the PRUQLQJDQGZDVWKHQJURXQGWRDGHSWK¿HOGYLVLWGXULQJWKHDIWHUQR­ RQ7KXVLWZDVSRVVLEOHWRVHHDWWKHVWDWHRIWKH¿UVWSDUWRIWKHZDOOV partially blocked access by squatting (a small bar with a precarious house of the conductor). The return for public use area is one of the main objectives of the project, along with any other action for the use DQGSURWHFWLRQ'HVLJQHUVDUHDOVRLQYLWHGWRVXJJHVWOHJDOSURFHGXUHV and administrative arrangements for the relocation of individuals pre­ sent (permutations, economic compensation, expropriation), also to DYRLGOHJDOFRQÀLFWVDQGGLVSXWHVOHJDOZLWKWKHSDUWLHV,WLVUHFDOOHG WKDWDPRQJWKHPDLQUHDVRQVWKHFRPSHWLWLRQLVWRUHDI¿UPWKHLPSRU­ tance of urban public spaces, including through measures to extend WKDWVSDFHRUUHDI¿UPDWLRQRISURSHUW\ULJKWVVXEMHFWWRSXEOLFLQYDVLRQ illegal. This consideration is general in nature and covers the whole urban area intervention. A particularly symbolic and strategic value could also be delivered to every possibility of acquiring the assets of public areas and buildings of private property, because they are considered of interest with respect to the creation of spaces or public service facilities (parks, green areas, public libraries and district, small equipment, local assistance and social solidarity, of health protection, culture and education). It recalls in this connection the will expressed in the existing urban plan to encourage in every way the connection between the plaza, amphitheater, Byzantine castle and the area just by creating a network of paths and public areas near the line of walls still exist today. 0XUDRWWRPDQHHPXURGHOO¶DQ¿WHDWUR. Tale ambito di progetto è stato discusso durante il seminario della mattina, ed è stato poi motivo di una approfondita visita sul campo nel corso del pomeriggio. In tal modo è stato possibile visionare sul posto lo stato del primo tratto delle mura, in parte ostruito all’accesso da occupazioni abusive (un piccolo bar con annessa abitazione precaria del conduttore). La restituzione ad uso pubblico dell’area appare uno degli obiettivi principali del progetto, assieme ad ogni altra azione di valorizzazione e tutela. I progettisti sono anche invitati a suggerire procedure e dispositivi giuridico amministrativi per la delocalizzazione delle attività privati presenti (permute, compensazioni econo­ PLFKHHVSURSUL DQFKHDO¿QHGLHYLWDUHFRQÀLWWLH contenziosi giuridico – legali con le parti. Si ricorda che tra le motivazioni principali del Concorso è quella di riaffermare l’importanza dello spazio pubblico urbano, anche attraverso interven­ ti di estensione di tale spazio, o di riaffermazione di diritti di proprietà pubblica oggetto di invasio­ ne abusiva. Tale considerazione ha carattere generale e riguarda tutto il settore urbano oggetto di intervento. Un particolare valore simbolico e strategico potrebbe essere anche consegnato ad ogni ipotesi di acquisizione al patrimonio SXEEOLFRGLDUHHHGHGL¿FLGLSURSULHWjSULYDWD perché considerati di interesse rispetto alla realizzazione di spazi o attrezzature di pubblico servizio (parchi, aree verdi, biblioteche comunali e di quartiere, piccole attrezzature locali di assi­ stenza e solidarietà sociale, di presidio sanitario, culturali e per l’istruzione). Si ricorda al riguardo la volontà espressa nel Piano urbanistico vigente di favorire in ogni modo la connessione tra la piazza, O¶DQ¿WHDWURHO¶DUHDGHOFDVWHOOREL]DQWLQRSURSULR attraverso la realizzazione di una rete di percorsi e di aree pubbliche a ridosso della linea delle mura attualmente ancora esistenti. 217 218 4. Hellenistic lighthouse. Hellenistic quay of the port 4. Faro ellenistico. Banchina del porto ellenistico This area is called as the biggest surprise of recent archaeological H[FDYDWLRQVLQWKHFLW\7KHGLVFRYHU\FKDQFHWKHOLJKWKRXVH+HOOHQL­ stic, occurred during the construction of an impressive second building permit prior to entry into force of measures to safeguard existing 8UEDQ3ODQ 'HFHPEHU LIQRWWKHZRUNZRXOGEHFRQVL­ dered abusive ­ has brought to light what is destined to become one of the main archaeological attractions of the city. The documentation provided by the Italian archaeological mission engaged by the Alba­ nian authorities in the detection and study of the monument makes it possible to operate the project in action for the protection and enhan­ cement of main monuments and other archaeological traces found (among them, an important sign of viability period, the second after the stretch of Roman road found in excavations of the baths), even temporarily, for the safety of the area (currently invaded by rainwater DQGLVXVHGDVODQG¿OO SHQGLQJWKHFRQVWUXFWLRQOLWLJDWLRQEHWZHHQ SULYDWHSURSHUW\DQGSXEOLFDGPLQLVWUDWLRQGH¿QLWLRQYLGHRV,WµFDQDOVR suggest solutions to expropriation or exchange for the acquisition of the assets to the public, also because of the impressive building den­ sity reached the area and the hull of planning standards. Please note that the formation of the new PRG entire municipality, in the opening LQUHODWLRQWRDPDMRUSURJUDPRIDLGWRWKH&HQWUDO*RYHUQPHQW¿QDQ­ ced by World Bank open to possible policies for urban development in other strategic areas of the city, on which a prudent public policy can deliver and manage the interests and rights also located in the city centre, in a situation of strong impairment of archaeological and historical monuments. This is the condition of that area, which is still present as case study to test the legal procedures for administrative high degree of innovation. )LQDOO\LWLVUHFRPPHQGHGWRFRQVLGHUWKHDFWLRQRIWKHSURWHFWLRQDQG enhancement of this important archeological site in relation to other, adjacent sites of equal interest, establishing continuity solutions for example with the area, which is already public, the former tower of µFORFNDQGPHQWLRQHGVHYHUDOWLPHVDERYHWKHSDWKRIWKH%\]DQWLQH walls, shown in Table 10 of the new plan for the central area, which is reported here is an excerpt. In a nutshell, the success of this meeting FRQ¿UPVWKHLQVLJKWKDGWRFRQVLGHUWKHFRPSHWLWLRQIRUWKHFLW\¶VPDLQ square is also at the convergence of all scholars and researchers working for some time, for different reasons, in the city, and also to HVWDEOLVKD¿UVWFRQWDFWZLWKWKHKHDGVRILQVWLWXWLRQVRISURWHFWLRQWKDW the institutional task of working for the protection and enhancement of DUFKDHRORJLFDOKLVWRULFDODQGFXOWXUDOFLW\RI'XUUHV+HVWLOOUHPHP­ bers that the workshop of the morning of Tuesday, November 18 was also attended by the new director of the National Archaeological, Eng. Roland Olli, and other representatives of the institutions of the sector. :KLOHQRWJHWWLQJLQWRWKHVSHFL¿FLVVXHVOLVWHGWKH'LUHFWRURI National Agency for archeology recalled the commitment of their own VWUXFWXUHIRUWKHFLW\RI'XUUHVRQJRLQJFRPPLWPHQWWRUHYLHZWKHUXOHV for protection of the city, considered by City Museum A law of 1961. Tale area costituisce come detto la sorpresa mag­ giore degli ultimi scavi archeologici della città. La scoperta, fortuita, del faro ellenistico, avvenuta nel corso della costruzione di un imponente immobile secondo un’autorizzazione precedente all’entrata in vigore delle norme di salvaguardia del vigente Piano Urbanistico (15 dicembre 2005) – se così non fosse, l’opera sarebbe da considerare abusi­ va – ha portato alla luce quello che è destinato a diventare una delle maggiori attrazioni archeologi­ che della città. La documentazione fornita dalla missione arche­ ologica italiana, coinvolta dalla autorità albanese nel rilievo e nello studio del monumento, rende possibile operare nel progetto in azioni di tutela e valorizzazione del monumento principale e delle altre tracce archeologiche rilevate (tra queste, anche un importante traccia di viabilità dell’epo­ ca, la seconda dopo il tratto di strada romana rilevato negli scavi delle terme), anche a carattere temporaneo, per la messa in sicurezza dell’area (attualmente è invasa dalle acque meteoriche ed è utilizzata come discarica), in attesa che il contenzioso edilizio tra la proprietà privata e la SXEEOLFDDPPLQLVWUD]LRQHDUULYLDGH¿QL]LRQH E’ possibile anche ipotizzare soluzioni di esproprio o di permuta per l’acquisizione dell’area al pub­ blico patrimonio, anche in ragione delle impres­ sionanti densità edilizie raggiunte dalla zona e alla carena di standard urbanistici. Si ricorda che la formazione del nuovo PRG dell’intero territorio comunale, in avvio in relazione ad un importante SURJUDPPDGLDLXWRDO*RYHUQR&HQWUDOH¿QDQ­ ziato da World Bank, apre a possibili politiche di sviluppo urbanistico in altre aree strategiche della città, su cui una accorta politica pubblica può convogliare e dirigere interessi e diritti acquisiti localizzati anche al centro della città, in situazione di forte compromissione del patrimonio archeolo­ gico e storico monumentale. Tale è la condizione di tale area, che si presenta ancora come caso esemplare per la sperimentazione di procedure giuridico amministrative ad alto grado di innova­ zione. In ultimo, si raccomanda di considerare l’azione di tutela e valorizzazione di tale importante sito DUFKHRORJLFRDQFKHLQUHOD]LRQHDJOLDOWULOLPLWUR¿ siti di pari interesse, stabilendo soluzioni di conti­ nuità ad esempio con l’area, già pubblica, dell’ex WRUUHGHOO¶2URORJLRHFRQLOJLjSLYROWHULFRUGDWR percorso delle mura bizantine, 219 Visit the archaeological excavations As planned, the guided visit to the areas with archaeological interest has allowed a closer inspection of sites and the continuation of GLVFXVVLRQVWDUWHGLQWKHPRUQLQJGLUHFWO\LQWKH¿HOGRILQWHUYHQWLRQ Many of the shots during that visit have already been reported in previous notes. At the end of the visit, all participants focused on GHYHORSLQJD¿QDOGHVLJQWKHPHZKLFKKDGDOVRKDGDSUHOLPLQDU\ GLVFXVVLRQZLWKWKHPD\RURI'XUUHVGXULQJDPHHWLQJRIJUHHWLQJWR the workshop participants. This question concerns the design solution to be taken in freedom, private property, located on the north ­ east of the square before the Palace of Culture. This area is now bound by the rules of the Plan for the central area, and results in land, as A inner area of archaeological interest, according to the perimeter of the ,QVWLWXWHRI0RQXPHQWVRI&XOWXUH ,0. WDNHQDVDQRUPVRSUDRUGLQD­ WDWKH7HFKQLFDO6WDQGDUGVIRU,PSOHPHQWDWLRQRIWKHQHZSODQ'XULQJ WKH¿UVWVWDJHRIWKHFRPSHWLWLRQZDVJLYHQIXOOIUHHGRPWRDOOFRQWHVW participants to propose new functions for the area. Many of the proposals showed how the design solution of the construction of bu­ ildings of public interest (the town’s museum, library, community ser­ vices). The municipal council of the city, knowing the limitations now imposed urban area, which effectively binds any possibility of new development to changes in national legislation, previously mentioned, decided to leave the contest open to competitors each design solution but suggest a role for public purposes, including on the basis of initial SURSRVDOVPDGHLQWKHLQLWLDOSKDVHRIWKHFRPSHWLWLRQ,WµZDVDOVR expressed interest in the preservation of the building already home to a private library, now resigned, with character period building, within a program of public interest. That decision, even with guidance for use mainly public area will be reported in the guideline document and the Notice of integration for the second stage of the competition. ,QVXFKDSODFHZLOOEHIXUWKHUFODUL¿HGWKHQDWXUHRILOOXVWUDWLRQQRW binding the project proposal, which must also be accompanied a cost estimate and an indication of technical administrative procedures necessary for the realization of what is proposed. Last meeting 7KHZRUNLQJGD\HQGHGZLWKD¿QDOZRUNLQJPHHWLQJDWWHQGHGE\ PHPEHUVRIWKH&RPPLVVLRQ¶V6FLHQWL¿F7HFKQLFDO&RPSHWLWLRQ (QJ Adrian Cela, prof. Piero Rovigatti) and all members of design teams invited to the second phase of competition. 'XULQJWKDWPHHWLQJZHUHDOVRGLVFXVVHGUHTXHVWVFRQWHVWWKHDGGLWLR­ nal business appointments, as well as technical means of delivery and SUHVHQWDWLRQRI¿QDOSDSHUVWRFRQWHVW This point is contained in the document entitled “Background and ad­ ditions to the Call for the second phase of the competition,” attached, which will be placed online on the contest website, either in Italian or Albanian and English . 220 evidenziato nella tavola 10 del nuovo Piano per l’area centrale, di cui si riporta qui uno stralcio. In estrema sintesi, il successo di questo incontro conferma l’intuizione avuta di considerare il concorso per la piazza principale della città anche occasione di convergenza tra tutti gli studiosi e i ricercatori che da tempo lavorano, a diverso titolo, nella città, e anche per stabilire un primo contatto con i responsabili delle istituzioni di tutela che hanno il compito istituzionale di operare per la tutela e la valorizzazione del patrimonio archeolo­ JLFRVWRULFRHFXOWXUDOHGHOODFLWWjGL'XUD]]R Si ricorda ancora che al workshop della mattina di martedì 18 novembre erano presenti anche il neo direttore dell’Agenzia archeologica nazionale, l’ing. Roland Olli, e altri rappresentanti delle istitu­ ]LRQLGLVHWWRUH3XUQRQHQWUDQGRQHOORVSHFL¿FR delle questioni elencati, il direttore della Agenzia nazionale per l’archeologia ha ricordato l’impegno GHOODSURSULDVWUXWWXUDSHUODFLWWjGL'XUD]]RH l’impegno in corso per la revisione delle norme di tutela della città, considerata Città Museo da una legge del 1961. Visita agli scavi archeologici Come previsto dal programma, la visita guidata agli scavi e alle aree di interesse archeologico ha SHUPHVVRXQDSLDWWHQWDRVVHUYD]LRQHGHLVLWLH il proseguo della discussione iniziata nella mattina direttamente sul campo di intervento. Molte delle questioni riprese nel corso di tale visita sono state JLjULSRUWDWHQHOOHQRWHSUHFHGHQWL$OOD¿QHGHO sopralluogo, tutti i partecipanti si sono concentrati VXOODGH¿QL]LRQHGLXQXOWLPRWHPDSURJHWWXD­ le, su cui si era avuta anche una discussione SUHOLPLQDUHFRQLO6LQGDFRGL'XUD]]RQHOFRUVR dell’incontro di saluto ai partecipanti al workshop. Tale questione riguarda la soluzione progettuale da assumere nell’area libera, di proprietà privata, collocata sul fronte Nord – Est della piazza, dinanzi al Palazzo della Cultura. Tale area è oggi vincolata dalle norme vigenti del Piano per l’area FHQWUDOHHULVXOWDLQHGL¿FDELOHLQTXDQWRLQWHUQD all’area A di interesse archeologico, secondo la perimetrazione dell’Istituto dei Monumenti di &XOWXUD ,0. ULSUHVDFRPHQRUPDVRSUDRUGLQDWD nelle Norme tecniche di Attuazione del nuovo piano. Nel corso della prima fase del concorso, era stata data piena libertà a tutti i partecipanti al concorso di proporre nuove funzioni per l’area in questione. Molte delle proposte avanzate indicavano come soluzione progettuale dell’area ODUHDOL]]D]LRQHGLHGL¿FLGLLQWHUHVVHSXEEOLFR (museo della città, biblioteca comunale, servizi collettivi). L’amministrazione comunale della città, pur sapendo delle limitazioni urbanistiche oggi gravanti sull’area, che di fatto legano ogni ipotesi di nuova costruzione alla variazione delle normative nazionali in materia, precedentemente ricordate, ha deciso di lasciare aperta ai con­ correnti al concorso ogni soluzione progettuale, pur propendendo per una funzione di carattere pubblico, anche sulla base delle prime proposte avanzate nella fase iniziale del concorso. E’ stata inoltre anche espresso interesse per la salvaguar­ GLDGHOO¶HGL¿FLRJLjVHGHGLXQDELEOLRWHFDSULYDWD RUDGLPHVVRFRQFDUDWWHULGLHGL¿FLRG¶HSRFD all’interno dello stesso programma di interesse pubblico. Tale decisione, assieme anche all’orientamento per la destinazione prevalentemente pubblica dell’area, verrà riportata nel documento di indiriz­ zo e di integrazione al Bando per la seconda fase del concorso. In tale sede verrà ulteriormente precisato il carattere indicativo, non cogente della proposta progettuale, a cui dovrà essere accompagnata anche una stima dei costi e una indicazione delle procedure tecnico amministrative necessarie alla realizzazione di quanto proposto. 5LXQLRQH¿QDOH La giornata di lavoro si è conclusa con una ultima riunione di lavoro, a cui hanno partecipato i PHPEULGHOOD&RPPLVVLRQH7HFQLFR6FLHQWL¿FDGHO Concorso (ing. Adrian Cela, prof. Piero Rovigatti) e tutti i membri dei gruppi di progettazione invitati alla seconda fase del concorso. Nel corso di tale riunione sono state anche discusse le richieste di concorso, gli ulteriori ap­ puntamenti di lavoro, nonché le modalità tecniche GLFRQVHJQDHSUHVHQWD]LRQHGHJOLHODERUDWL¿QDOL di concorso. Tale disposto è contenuto nel documento dal titolo “Iter procedurale e integrazioni al Bando per la seconda fase del Concorso”, disponibile in rete, sul sito del concorso, sia nella versione italiana che in quella albanese e inglese. On the left: Pictures of Workshop on 18th November &XOWXUH3DODFH'XUUHVA lato: immagini del seminario del 18 novembre 2008, presso il Palazzo della Cultura. 221 5 The 5 projects of second phase/ I 5 progetti della seconda fase 5.1 Linea d’ombra Arch. Ivan de Sousa Arch. Ines Antunes 5,)/(66,21( Una visione per Durazzo: La città del Nuovo Millenium ³/¶HVSHULHQ]DVWRULFDGHOOHQRVWUHFLWWjFLLQGLFDFRQVXI¿FLHQ]DFKLDUH]]DTXDOLVRQRLIDWWLGHFLVLYLLWHPLGH¿QLWLL mezzi e le soluzioni adeguati” Giorgio Grassi Con la recente transizione dal comunismo all’economia di mercato, O¶DUHDXUEDQDGL'XUD]]RqFUHVFLXWDVHQ]DXQDVWUDWHJLDJHQHUDOHGLXQIXWXURSRVVLELOHHVRVWHQLELOH&RQO¶DUULYRGHO progetto di connessione per facilitare lo scambio di merci, energia e persone tra l’Unione Europea e gli stati balcanici­ LOFRUULGRLR9,,,O¶HVSDQVLRQHXUEDQDLQFRQWUROODWDSXzDFFHQWXDUVLDQFRUDGLSLGDQQHJJLDQGRVHULDPHQWHOHFLWWjH LOWHUULWRULRÊTXLQGLXUJHQWHSUH¿JXUDUHXQIXWXURSHU'XUD]]RHQRQVHJXLUHLSDVVLGHOOHFLWWjGHOO¶(XURSD2FFLGHQWDOL che in poche decine d’anni hanno visto il suo territorio invaso da costruzioni senza una struttura di supporto capace di assicurare la crescita della città presente e futura. L’elemento essenziale della vita delle città è stato addirittura rinunciato­ la strada urbana­ che rappresenta, a nostro viso, un evidente abbandono del progetto della società civile. 2JJLTXHVWHFLWWjKDQQRFRPHSUREOHPDFHQWUDOHODULTXDOL¿FD]LRQHGHOOHLPPHQVHSHULIHULHFRVWUXLWHQHOOHXOWLPH GHFDGL'XUD]]RSXzHYLWDUHTXHVWRWLSRGLSUREOHPDXUEDQRHWURYDUHXQDULVSRVWDFKHVLDFDSDFHGLSLDQL¿FDUHXQ processo temporale mediante una matrice sociale dove la continuità, densità e limite urbano danno forma alla città. Solo così possiamo evitare la potenza distruttrice della dispersione urbana e le sue conseguenze già ampiamente comprovate nelle maggior parte delle città occidentali. Pensare nel centro storico senza pensare contemporanea­ mente nel futuro dell’espansione della città è rinviare fatalmente un problema che investirà il territorio in generale ma sopratutto il proprio centro storico che è spesso la prima vittima collaterale. ,IRWRPRQWDJJLSUHVHQWDWLPRVWUDQRGXHPRGHOOLXUEDQLFRQSULQFLSLRSSRVWL,SULPLGXH³'XUD]]R0DQKDWWDQ´H ³'XUD]]R%DUFHORQD´UDI¿JXUDQRXQDFUHVFLWDXUEDQDEDVDWDVXOODFRQWLQXLWjGHQVLWjHOLPLWHXUEDQRLQFXLODVWUXWWX­ UDXUEDQDqODEDVHGHOODORURLGHQWLWj/¶XOWLPRLQYHFH³'XUD]]RGLVSHUVLRQHXUEDQD´UDI¿JXUDODFLWWjEDVDWDVXOOD discontinuità e la frammentazione. Ogni forma di vita cittadina è stata eliminata. Uno scenario che rappresenta la pochezza delle risposte all’espansione urbana, delle ultime decadi, nelle maggior parte delle città. 'XUD]]RYDQWDDQRVWURYLVRGLXQDTXDOLWjVWUDRUGLQDULDTXHOODGHOODULWDUGDWDFUHVFLWDXUEDQDFKHPDQWLHQHWXWWRUD e nonostante tutto, intatto un territorio ancora incontaminato. Una qualità che deve essere valorizzata e fare parte del nuovo progetto del futuro. LA PROPOSTA Porto­Via­Piazza /DFLWWjGL'XUD]]RHGLQSDUWLFRODUHLOVXRFHQWURVWRULFRGLVSRQHGLXQQRWHYROHSDWULPRQLRVWRULFRFXOWXUDOHD testimonianze delle differenti culture che l’hanno abitata nei diversi periodi storici. L’identità della città è fortemente legata al suo fronte d’acqua che lungo la storia fu un elemento vitale nella formazione della sua morfologia urbana. Infatti, la via del Commercio, perpendicolare alla linea di costa, rappresenta la matrice generatrice della città storica che collegava le due porte della città, a sud la Porta del Mare e a nord la Porta Grande. Oggi questa via, la principale arteria del centro urbano, collega due importanti spazi pubblici, il parco costiero di carattere ludico e ricreativo e la SLD]]DGHOOD/LEHUWjGLFDUDWWHUHVLPEROLFRHUDSSUHVHQWDWLYR8QVLVWHPDFKHSXzGLYHQWDUHXQYHURPRWLYRTXDOL¿FD­ WRUHGHOO¶DPELHQWHXUEDQRFDSDFHGLULVWDELOLUHO¶DWWHVROHJDPHFRQODVWRULDXUEDQDGL'XUD]]R/DSLD]]DLQTXHVWR sistema svolge un ruolo fondamentale, quello di articolare il centro storico “intramura” a sud con il resto della città a nord. Un’articolazione necessaria che sia capace, contemporaneamente, di collegare i vari episodi culturali e storici circostanti, tra cui, le aree archeologiche, il castello, i tessuti ottomani esistenti, la moschea, ecc. Negli ultimi anni, tuttavia, la città ha assistito ad un aumento di costruzioni, spesso oggetto di speculazione, dove la ricerca formale dell’oggetto in sé prevale sulle relazioni contestuali. La Piazza della Libertà e il suo intorno è l’esempio di questo fe­ nomeno che nonostante i vari interventi e progetti non è riuscita ad acquistare un carattere formale e spaziale stabile, ULVXOWDWRDQFKHGLVXFFHVVLYHDJJLXQWHPRGL¿FD]LRQLHGHPROL]LRQH/DVXD¿VLRQRPLDLQIDWWLGHULYDGDQXPHURVLH GLYHUVLPRPHQWLGLIRUPD]LRQLPDqQHOFKHVLqFHUFDWRGLGH¿QLUHLOODWRQRUGGHOODSLD]]DFRQODUHDOL]]D]LRQH del Palazzo della Cultura e posteriormente con il Palazzo della Prefettura. Una soluzione parziale che ha dato origine a due spazi continui ma con direzioni distinte, tuttora irrisolti. Già nel piano di 1942, l’arch. Leone Carmignani tentava GLULVROYHUHLOSUREOHPDSURSRQHQGRXQQXRYR³HGL¿FLRFHUQLHUD´GLIURQWHDOO¶DWWXDOH3DOD]]R0XQLFLSDOHFKHGHOLPLWDL GXHVSD]LXQDSLD]]DHXQDURWDWRULDSHUULVROYHUHLOWUDI¿FRGLTXHOWHPSR2JJLODVWHVVDDUHDVLSUHVHQWDFRPHXQ DPSLRVSD]LRGRYHODVFDUVDDUWLFROD]LRQHHLOFRQÀLWWRWUDLOSHGRQHHLOWUDI¿FRYHLFRODUHSHUVLVWRQR&RQODOLPLWD]LR­ QHGHOWUDI¿FRYHLFRODUHGHOODYLDGHO&RPPHUFLRHGHOFHQWURVWRULFRLQJHQHUDOHG¶DFFRUGRFRQLOSLDQRXUEDQLVWLFR del 2007, infatti, lo slargo perde il suo senso. Se propone, pertanto, una nuova piazza come alternativa all’attuale slargo. La nuova piazza, di carattere culturale, insieme alla piazza rappresentativa esistente formano un unico spazio pubblico capace di ristabilire un’articolazione adatta alla complessa struttura urbana della città e alle nuove esigenze FRQWHPSRUDQHH/¶RELHWWLYRSULPDULRGHOSURJHWWRGLYLHQHDOORUDODULGH¿QL]LRQHHO¶DUWLFROD]LRQHGHJOLVSD]LFKHFRP­ SRQJRQRODSLD]]DDWWUDYHUVRLOVXRSHULPHWURRJJLVFDUVDPHQWHGH¿QLWRHOHUHOD]LRQLFRQOHDUHHFLUFRVWDQWL 225 Lo spazio Pubblico /DSURSRVWDSUHYHGHODVXGGLYLVLRQHGHOO¶DUHDG¶LQWHUYHQWRLQGXHSLD]]HXQDGLFDUDWWHUHSLUDSSUHVHQWDWLYRHVLPER­ OLFRVXOODTXDOHVLDIIDFFLDQROD0RVFKHDHODVHGH0XQLFLSDOHHO¶DOWUDGHFDUDWWHUHSLFXOWXUDOHVXOODTXDOHVLDIIDFFLD­ no il Palazzo della Cultura, la Biblioteca proposta e il museo della Città previsto per l’attuale Palazzo della Prefettura. /H3LD]]HVRQRÀHVVLELOLHGLVSRQLELOHDGRVSLWDUHHYHQWLHGDWWLYLWjSHULRGLFKHTXDOLPHUFDWLWHPSRUDQHL¿HUHFRQFHUWL spettacoli vari, mostre all’aperto, ecc. La presente proposta prevede quattro ambiti essenziali di seguito descritti: ,O3HUFRUVR&RSHUWR8QDOLQHDG¶RPEUDFKHQDVFHGHOO¶LQWHQ]LRQHGLULFXFLUHOHUHOD]LRQL¿VLFKHFRQOHDUHHFLUFR­ stanti di interesse storico, culturale e paesaggistico, articola i due spazi della piazza, oggi scarsamente articolati tra loro. Un segno che si concretizza in percorso coperto, percorre e delimita tutto il lato est dello spazio pubblico, sul quale si sviluppa un’area di cerniera tra i due spazi. Qui si prevede un’ampia copertura sospesa disponibile ad acco­ gliere molteplici programmi di appoggio quali, caffè­bar, ristorante, punto di informazione turistico o semplicemente un’area ombreggiata. Il percorso coperto, con 3,5 metri di larghezza circa, garantisce l’attraversamento pedonale e ciclabile ma anche accoglie l’arredo urbano necessario alla Piazza come parcheggi per biciclette, abbeveratoi, panchine, telefoni pubblici, ecc. ­La scalinata: Una imponente scalinata sul perimetro ovest raggiunge la quota della Moschea e del verde pubblico per consentire una maggiore integrazione con la piazza. In questo modo la piazza e il parco della Moschea formano un unico conti­ nuum di carattere pubblico. La scalinata invita anche ad un utilizzo informale. Se prevede la conservazione delle specie arborei presenti nell’area, inserite in aiole adeguate. ,OQXRYRHGL¿FLRSXEEOLFR Un nuovo volume posto sul fronte opposto della Prefettura permette di delimitare lo spazio della piazza e valorizzare OHLQWHUD]LRQLWUDLGLYHUVLHGL¿FLHVLVWHQWL8QHGL¿FLRDGHVWLQD]LRQHSXEEOLFDGLDOWH]]DQRQVXSHULRUHDTXHOORGHOOD 3UHIHWWXUD6LSURSRQHORVSRVWDPHQWRGHOODELEOLRWHFDSHULOQXRYRHGL¿FLR6XOODWRRSSRVWRLQYHFHVLSURSRQHLO QXRYR0XVHRGHOOD&LWWjVXOO¶DWWXDOHHGL¿FLR4XHVWHGXHQXRYHGHVWLQD]LRQLG¶XVRLQVLHPHDO3DOD]]RGHOOD&XOWXUD costituiranno un importante polo culturale della città. ­Il parco Urbano: Se prevede due tipi di aree verdi con sviluppi temporali molti diversi. Uno localizzato ad Est, in un’area piana e di fa­ FLOHDFFHVVRGDUHDOL]]DUHLQXQDVRODIDVHHO¶DOWUDORFDOL]]DWDDG2YHVWQHOIURQWHFROOLQDUHFKHVDOH¿QRDO&DVWHOOR da realizzare lungo gli anni. Nel primo parco, con relazione diretta con il percorso coperto, se propone un spazio per l’uso ludico­sportivo con una nuova modellazione del terreno associata all’utilizzo di varie alberature, con percorsi interni attraversabili. 1HOVHFRQGRSDUFRVHSURSRQHO¶XWLOL]]RGHLVSD]LGLULVXOWDWUDJOLHGL¿FLHJOLVSD]LGHJOLHGL¿FLGDGHPROLUHSHUOD FRVWLWX]LRQHGHOSDUFR8QSDUFRFKHSLDQSLDQRVDOHUj¿QRDOFDVWHOORXQDYROWDGHFLVRJOLHGL¿FLDEXVLYLGDGHPROLUH per dare spazio al nuovo parco e consentire, quindi, una piena integrazione della piazza con il castello. 787(/$(9$/25,==$=,21('(/3$75,021,26725,&2$5&+(2/2*,&2 Si considera per la tutela e valorizzazione del patrimonio una attuazione diretta attraverso interventi di conservazione, UHVWDXURHHVHFX]LRQLGLGLYHUVLSURJHWWL¿QDOL]]DWHDOODYDORUL]]D]LRQHHLQWHJUD]LRQHGHOSDWULPRQLRFRQLOUHVWRGHOOD città e promuovere lo sviluppo culturale e turistico. $TXHVWRVFRSRVHSURSRQHSHUO¶DUHDDUFKHRORJLFDGHOIRUREL]DQWLQRHGHODQ¿WHDWURURPDQRODGH¿QL]LRQHGLXQD VSHFL¿FDSDYLPHQWD]LRQHFKHKDFRPHPDWULFHLOSURSULRPRQXPHQWRVWRULFRDUFKHRORJLFR4XHVWDSDYLPHQWD]LRQH ROWUHDVYROJHUHXQUXRORGLYDORUL]]D]LRQHGHOSDWULPRQLRHVLVWHQWHSHUPHWWHUjDQFKHO¶LGHQWL¿FD]LRQHGHOOHDUHH archeologiche in questione. Se prevede inoltre un sistema di illuminazione incassata per pavimenti esterni e proiettori di varie potenze per soddi­ sfare una adeguata illuminazione notturna dei monumenti. Un altro elemento di estrema importanza per la tutela e valorizzazione del patrimonio è la segnalazione informative. Se prevede, infatti, un sistema di comunicazione e divulgazione del patrimonio poste in punti strategici nelle aree vicine e nelle fermate della metropolitana leggera prevista. Questi tre elementi, pavimentazione, illuminazione e segnalazioni dovranno permettere la valorizzazione del patrimo­ nio e la sua integrazione con il resto della città e quindi promuovere lo sviluppo culturale e turistico. 6,67(0$',02%,/,7$¶38%%/,&$(35,9$7$ /DSURSRVWDSUHYHGHODSHGRQDOL]]D]LRQHGHOORVSD]LRSXEEOLFRDWWUDYHUVRLOULRUGLQRGHOWUDI¿FRYHLFRODUH6LSURSRQH TXLQGLFRPHDOWHUQDWLYDDOODYLDGHO&RPPHUFLRHDOODYLD+7URSOLQLODGHYLD]LRQHGHOWUDI¿FRSHUOHYLHSHUSHQGLFRODUL alla via Aldo Mouro, che raggiungendo la via Egnatia, collega tutta l’area portuale. In questo modo, l’area d’intervento WUDVIHULVFHODVXDIXQ]LRQHDWWXDOHGLVQRGRGHOWUDI¿FRSHUDUHHOLPLWUR¿GLYHQWDQGR¿QDOPHQWHXQYHURVSD]LRSXEEOL­ co rappresentativo, simbolico e culturale della città. È garantita comunque l’accessibilità ai residenti, mezzi di soccor­ so e manutenzione con opportune demarcazioni nella pavimentazione e dissuasori mobili nel nuovo spazio pubblico. Se prevede, per la mobilità collettiva, un sistema di metropolitana leggera da realizzare in due fasi. La prima, la linea A, collega il porto (la Porta del mare) alla Piazza Iliria e continua lungo la Rr.Shefqet e Rr. Alekssander Goga. Questa linea svolgerà un ruolo di mobilità pubblica importante per i cittadini ma anche per i turisti che vedranno in TXHVWDOLQHDXQPRGRIDFLOHHHI¿FDFHGLUDJJLXQJHUHODPDJJLRUHSDUWHGHOOHDUHHGLLQWHUHVVHVWRULFRFXOWXUDOH,QIDWWL OHIHUPDWHSUHYLVWHSHUOD/LQHD$FRLQFLGRQRFRQLSULQFLSDOLPRQXPHQWLHDUHHGRYHHVLVWRQRRVHSUHYHGRQRHGL¿FL GLFDUDWWHUHSXEEOLFR6HSUHYHGRQRDOPHQRRWWRIHUPDWH3RUWDGHOPDUH+DPDPL7XUN$Q¿WHDWUR5RPDQR 3LD]]D,OLULD)RUXP%L]DQWLQR$OHNVDQGHU*RJD0XVHRL'HVKPRUHYH La seconda fase, la linea B, percorre tutta la costa collegando la stazione con tutta l’area costiera di carattere ludico­ recreativo. L’intersezione delle due linee si farà nella Porta del mare, punto di cerniera tra la costa e l’entro terra. 228 232 233 5.2 Suoli Sensibili Arch. Laura Mascino, Arch. Barbara Agnoletto, Arch. Giulia Lobba, Arch. Anna Paola Pola 75$9(/127(6 7KHUHDUHSODFHVZKHUHLWLVYHU\GLI¿FXOWWR¿QGVRPHVSHFLDOIHDWXUHVDQGZKDWPLJKWPDNHWKHP³XQLTXH´'XUUHVLV QRWRQHRIWKRVHSODFHV,Q'XUUHVWKHUHDUHVRPHVSHFLDOIHDWXUHVDQGVRPHJUHDWRSSRUWXQLWLHVDQGFHUWDLQO\RQH of them is represented by its many layers, from the traces of its dense history. This opportunity can not be lost. In this QHZ³XUEDQVHDVRQ´ZH¶OOGHFLGHZKHWKHUWREXLOGDFLW\WKDWLVGH¿QLWHO\³PRGHUQ´DQG³FRUUHFW´EXWVWLOODFRPPRQ FLW\RUWRZRUNRQD³XQLTXH´ORFDWLRQZKLFKGRHVQRWFRQWUDGLFWDPRGHUQVW\OHEXWWKDWUHTXLUHVDSURMHFWIRFXVHGRQ its own merits and peculiarities. Working on Piazza Liria you meet two fundamental heritages: WKH¿UVWRQHWKHPRVWRXWVWDQGLQJLVWKHDPRXQWDQGFRPSOH[LW\RILWVKLVWRULFDODQGDUFKDHRORJLFDOVWUDWDDQG between them not only the great archaeological remains such as the amphitheatre or Macellum, but also the neigh­ bourhoods where you can recognise the Ottoman tissue. It now appears very neglected, but the interesting alternating solids and voids of the settlement makes it a model worthy of attention. ­ the second, no less important, but not as “exceptional” is its natural elements, above all the promontory. Who designed the new mosque has chosen to have it as background, and perhaps it’s not a coincidence. The Pro­ montory goes down to the main square of the city becoming one of its sides. 7+(352-(&7 The Basements 7KLVVOLJKWO\UDLVHGJURXQGGH¿QHVWKHVFRSHRIUHOHYDQFHRIWKHYDULRXVSXEOLFEXLOGLQJV$NLQGRISHGHVWDOWKDW JLYHLPSRUWDQFHDQGYLVLELOLW\WRSXEOLFEXLOGLQJV2QWKHDPRUSKRXVVRLOOD\HUVDUHPRUHJHRPHWULFDOO\GH¿QHGDQG that makes it more of a “monument” to the object that you are over. It reinforces the representative status of public buildings. These plans also include the system of lifts and access to buildings that are almost always at a level higher than that of the square. The basement of the mosque and access to the prefecture On the West side the background is that of a cape covered with vegetation consisting of essences typical of the Me­ GLWHUUDQHDQODQGVFDSH+HUHWKHLGHDLVSODQQLQJWREXLOGWKHSDUNRIWKH%\]DQWLQHZDOOVWKHPRVTXHEDVHPHQWDQG WKHEDVHRIWKHEXLOGLQJRIWKH3UHIHFWXUHWKDWLVDWWDFNVRQWKHVTXDUHRIWKHSDUN7KLVV\VWHPRIUDLVHGÀRRUVDQG sloping garden contains trees that are the “arrival” and “input” from the park to the square. The basement of the mosque is important not only for the renovation of the system back to this building, but because DORQJZLWKWKHEDVHPHQWRIWKHSUHIHFWXUHWKDWUHGH¿QHVWKHSURVSHFWXVRIWKH:HVWVLGHWKH\EHFRPHDQREMHFW DUFKLWHFWXUHWKDWXQL¿HVWKHIURQWRIWKH%\]DQWLQHZDOOVDWWKHHQGRIWKHVTXDUH,QWKHEDVHPHQWRIWKHPRVTXH the main lift system, consisting of a staircase, is oriented to the front façade of the mosque and shows its “back” to the prefecture. The staircase will stop in several sections so as not to be too tiring. The space between the ramps H[SDQGVVRLWFDQEHFRPHDQLQIRUPDOSODFHWRVWRSWKH¿UVWRIVXFKH[SDQVLRQLQFOXGHVDJDUGHQ WKHWUHHVDUHDOVR on display to the side of the prefecture that does not have a high architectural quality), the second stop, before the last VWUHWFKKDVDWHUUDFHWKDWRYHUORRNVWKHVTXDUH1H[WWRWKH%\]DQWLQHZDOOVWKHUHLVDUDPSOHDGLQJWRWKHPRVTXH the ramp breaks where it meets the access to the trails that go back up the hill to the castle (see Byzantine walls) and provides access to services that underlie the mosque. The basement of City Hall The basement of the town hall stretches on the East side to include the remains of the clock tower, in a sort of a ³FRQ¿GHQWLDO´VTXDUH The basement of the theatre 7KHEDVHPHQWRIWKHWKHDWUHJRHVFORVHWRWKHVLGHVLQWKH1RUWKDQG:HVWWRWKH(DVWLWH[SDQGVLQFOXGLQJDOVRWKH VWUHHWDQGDUULYLQJDWWKHVKRSSLQJDUHD+HUHWKHEDVHKDVQRWRQO\WKHYDOXHVRID³SHGHVWDO´RIDEXLOGLQJEXWLWEH­ FRPHVVRPHWKLQJWKDWXQL¿HVWKHVFHQHZLWKWKHOLQHRIVKRSVPDNLQJWKLVEHFRPHDVLQJOHVSDFHDQGRIIHULQJGLUHFW involvement in the activities of the Square. Steps and ramps allow access to the theatre, between those on the East VLGH¿WDJDUGHQ7KHEDVDPHQWVDUHPDGHLQDXUHVLQDVWRQH 235 Sensitive Soil ,W¶VDVRLOWKDWLVH[SDQGLQJOLNHDOLTXLGDQGGHSHQGLQJRQZKDWLWPHHWVUHDFWVGLIIHUHQWO\,WGH¿QHVWKHVSDFHRIWKH pedestrian and keeps all the various objects that rely on this spot. This ground has not a limit and does not disclose a SUHFLVH¿JXUHLW¶VH[SDQGDEOH 7RPHHWWKHDUFKDHRORJLFDO¿QGVLWFRUUXJDWHVDQGPDNHVLWSRVVLEOHWRSHUFHLYHYLVXDOO\DQGSK\VLFDOO\WKHFORVHQHVV to an archaeological object when it passes over an area where the tracks are of historical rises as a kind of model reference to an “architecture” that was there in another time. The architecture of representation: the mosque, the thea­ tre, town hall ... instead determine the main paths that dictate the design of the square. These lines will be those that make the soil, slope, water drains, collect water, etc. .. Where there are already some trees this sensitive land is opened to contain them, so the gardens contain trees. To the East, the Cedars of Lebanon offers the opportunity to build a “garden” with trees typical of Mediterranean scrub. The sensitive soil is mainly a paving stone Albanera. The Albanera is a stone from southern Albania that has been used since ancient times (not only in Albania) for paving works and “important” public space.The stone was laid in long running sections of 80 cm wide, 5 courses of these bands includes a white strip 20cm wide in Auresina stone. These paved “lines” develop in parallel with the directions given by a number of important elements. Three main direc­ WLRQV6WDUWLQJIURPWKH6RXWKWKHGLUHFWLRQRIWKH¿UVWÀRRULVJLYHQIURPWKHIURQWRIWKHWKHDWUHE\WKLVVORSHZKHQLW encounters the district access to the Ottoman tissue. The obtuse angle of the library determines the beginning of the third line that links the library with the start of the stairs leading to the Mosque. The fourth angle is the façade of the &LW\+DOODQGJRHVRQXQWLOWKHHQGRIWKHKLJK7KHOLQHVDUHPDUNHGRQWKHJURXQGDQGDUHWKHPDLQSDWKVWKDWEXLOG the design of the square. They work by being major lines of drain water. $UFKDHRORJLFDOÀQGV 7KLVVRLOUHDFWVZKHQLWHQFRXQWHUVVRPHDUFKDHRORJLFDO¿QGV,QWKHYLFLQLW\RIDUFKDHRORJLFDO¿QGVZKLFKKDYHDOUH­ ady emerged, the design of the pavement has a sort of stretch mark and the surface itself corrugates. The design of WKLVÀRRUPDGHRISDUDOOHOOLQHVWKDWIROORZHDFKRWKHUUHJXODUO\VKRZVDVWUHWFKPDUNDQGVXIIHLQWHUIHUHQFHWKHOLQHV retain their shape and do not follow the more smooth line. Physically and visually it is possible to perceive that you are close to something important. :KDW¶VXQGHU/LULDVTXDUH" 1RRQHNQRZVIRUVXUHWKHUHLVVRPHWKLQJ6RPHWKLQJLPSRUWDQWRUQRWLPSRUWDQW"$WZKDWGHSWK" The unknowns are many, but given the importance of the project an effort is required in this direction. <RXFDQVHOHFWWKUHHFDVHV 1. are the remains below­1m., 2. is a monument between ­1 and ­3 m., 3. is an important monument between ­3 to ­8 m. 1 remains a­1m., 'XULQJWKHFRQVWUXFWLRQRIWKHVTXDUHDQH[FDYDWLRQRIFPLVUHTXLUHG,IGXULQJWKLVZRUNWKHUHDUHVRPHDUFKDHR­ ORJLFDO¿QGV \RXFDQUHDFKDGHSWKRIDURXQGP WKHSODQLVWRUHPRYHDOOPDWHULDOVWKDWKDYHYDOXHZKLFKZLOOWKHQ be preserved in the museum. In the East, where it would be expected that everything would be demolished in any event during the excavation, we propose to integrate into the square these remains allowing the square to show or to present small slopes or dips where people can pass and view the archaeological scenery. 2 exceptional discovery between ­1 and ­3 m., All that is or is potentially present 1m down and further can be selected to remain in situ preserving it in any case and not excluding the possibility of a future excavation. If, however, an exceptional monument is found then the opportu­ QLW\WRDGGLWWRWKHFROOHFWLRQRIRWKHUVLJQL¿FDQWDUFKDHRORJLFDOREMHFWVVKRXOGEHH[SORLWHG,WLVDVVXPHGWKDWVRPH parts of the square will be built at an altitude slightly higher than that of the project and that the sensitive ground hea­ ves from below. The exhibition halls can be built that would take hypogean light and air from the square. The descent WRWKHVHHQYLURQPHQWVZLOOEHSDUWRIWKH³JODVVER[´ VHH+HOOHQLVWLF)DUR  H[FHSWLRQDO¿QGLQJVEHWZHHQDQGP As in the previous case where a monument is found of an outstanding level then it can be decided whether or not to PDNHLWRSHQ<RXFDQEXLOGK\SRJHRXVHQYLURQPHQWVEXWLQWKLVFDVHDIIHFWWKHDPRXQWRIVTXDUHIHHW Natural elements 7KHVHQVLWLYHVRLOUHDFWVZLWKQDWXUDOHOHPHQWV,QWKHFDVHRIWKH¿UVWVWDJHRIWKHFRPSHWLWLRQZKHUHWKHUHDUH already some trees, this sensitive land is opened up to contain them. To the East side, the Cedars of Lebanon offers the opportunity to build a “garden” with trees. After two visits in the project area it was found that the Cedars, currently in place, are not grown in a appropriate manner to their species. The assumption is made that they have failed to develop their root system, probably because of some obstacle that is not too deep or they do not have enough land or because the kind of land is not suitable. The shape of these trees is not responding to the needs of the project to create a wooded area that is easily accessible, (currently it is too hard to cross) and that we prefer to opt for a repla­ cement of these trees. Among the gardens set on the square, the biggest is the main characteristic of the East side. A true stain of trees under which a series of games and water tanks increases the feeling of coolness and that can be XVHGE\FKLOGUHQIRUSOD\LQJWKHVTXDUHLVLQWHQGHGWREHDSODFHIRUFKLOGUHQ7UHHVZDWHUDQGDVHDWLQJVWUXFWXUH LQWKLVSODFHFUHDWLQJDSODFHIRUUHVWLQJDQGHYHU\GD\OLIH7KHJDUGHQDOVRFRQWDLQVD¿OWHUVFUHHQDQGEHWZHHQWKH RSHQVTXDUHDQGEXLOGLQJVRQWKH(DVWVLGHWKDWLVYHU\XQHYHQEXWWKDQNVWRWKLVIUDJPHQWHGQDWXUHDOORZVLQ¿OWUDWLRQ of the square in the district. The garden works as a “hinge” between the two urban areas. 238 The embankments Garden On the East side in place of the “garden of the Cedars” a garden with trees is built, which works on a series of emban­ kments that contain a great number of trees. The embankments can increase 50cm. the layer of earth and contains earth to bring suits under essences. Given the opportunity of new planting trees, were chosen that enrich the variety RIHVVHQFHVLQWKLVWHUULWRU\VRWUHHVPRUH³XQXVXDO´WR'XUUHVEXWVWLOOW\SLFDORIWKH0HGLWHUUDQHDQ$FDUHIXOFKRLFH KDVEHHQPDGHLQWKLVUHJDUG2QWKHVTXDUHDUH$UEXWXVXQHGR9LWH[DJQXVFDVWXV/LJXVWUXPOXFLGXV4XHUFXV ilex,Quercus suber, Olea europaea Embankments in the soil are a permeable soil. A “natural” soil covering by a “carpet” of covering grass. The embankments that are built on the slopes of the square are the lines that rise from the ground up 50 cm. In some places the edges of concrete containment bend and become sittings. In the garden, three water tanks help create a micro climate in summer being cooler and increasing the sense of well being for those who use the square. 62,/2/'$5&+$(2/2*,&$/02180(176 7KHOHYHOWKDWFRQWDLQVDOOWKHDUFKDHRORJLFDO¿QGVWKHOD\HUWKDWOLHVEHORZDQGWKDWDIIHFWVWKHWRSOD\HULQVRPH points emerge and become the subject. Others remain invisible but perceptible to change from the top layer. %HVLGHWKHVTXDUHWKHUHDUHDQXPEHURILPSRUWDQWDUFKDHRORJLFDO¿QGVIRUZKLFKWKHSURMHFWLVQRWOLPLWHGWRZRUNLQJ ZLWKWKHJURXQGÀRRU7KHUHLVWKHXQGHUO\LQJSULQFLSOHRIHQKDQFLQJWKHLQGLYLGXDO¿QGV,QWKHFRQVWUXFWLRQRID system ­ archaeology has favourites that work more on “threads” unifying the individual items. They are not like paths, but they appears in the urban spread as a series of gems. The Macellum 7KHUHDUHWZRSRLQWVRQZKLFKWKHSURMHFWZRUNVLQWKLVSODFHWKHOHDSLQEHWZHHQURDGDQGWKH)RUXPWRHQVXUHWKDW WKHUHPDLQVDUHQRWOHIWLQD³PRDW´WKDWLVQRWDFFHVVLEOHDQGWKHQWKHUHEXLOGLQJRIXUEDQ¿IWKHQKDQFLQJSHUFHSWLRQ of the archaeological object, because the size and type of buildings that surround it including the recent construction do not help in the development of these artefacts. It is therefore expected to build on a new road pavement, (the new bridge will enable the extension of the excavation) this will step and fold down the market until you reach the level of the forum. The route continues and remains to its quota and also goes through the excavation of the baths. The course is in wood. The land South of the hole becomes a slight slope and reaches the quota of the Macellum. The VSDFHEHWZHHQWKH³DWPRVSKHUHRI7XUNLVKFRIIHHDQGWKH)RUXPLVRQHDUHDWKDWKDVVFRSHDQGDJUHDWHUEUHDGWK :LWKWKLVV\VWHPRIVORSHVDQGWKHUHGH¿QLWLRQRIWKHVRLOWKHSURMHFWDOVRRUJDQL]HVWKHÀRZRIZDWHUDQGUHFRQVWUXF­ WLRQRIWHFKQLFDOQHWZRUNVVXFKDVPRYLQJRUEXU\LQJWKH39&SLSH VHZDJH WKDWFXUUHQWO\FURVVHVWKHDUHD$URXQG WKHSHULPHWHURI0DFHOOXPRQWKH1RUWKVLGHLQD¿HOGFRUWHQEXLOGDQHZ¿IWK DQHXWUDOEDFNJURXQG WKDWKLJKOLJKWV WKHFLUFXODUFRORQQDGHVHSDULQJLWYLVXDOO\IURPWKHEXLOGLQJVEHKLQG:HLPDJLQHWKDWWKHWZREORFNVRIÀDWVRQWKH road,that are currently in a state of decay, are retrained (if only through the study of the colour of the façades). The Baths The project plans to continue the excavation to the North and recover the remains that are currently covered by a structure of concrete pillars acquiring public land to the North (tips). Excavations Thermal becomes unique and are passed through a pedestrian walkway. The Baths and Macellum become an archaeological site where the share of transit remains the Macellum. Rainwater is collected in a cistern under the basement of the theatre. The Byzantine walls and the Arena At the Byzantine walls of the ramp to lift the Mosque, from here and from a break from the ramp after leaving 15 m. path lifts on the hill that run along the Byzantine walls. Currently, these walls travel along a series of small illegal volumes that with time have closed the possibility of a public path. A small set of steps in the private space has slowly completely blocked in some places this rise. The project proposes to back a public space, even if thin, that will FRQWLQXHXQLQWHUUXSWHGXQWLOWKH%\]DQWLQHFDVWOH7KHVWUDWHJ\LVQRWDUXOHEXWRQO\WRZRUNRQWLPHWKDW¿QGVH[DFWO\ what can stay and what needs to be demolished, with a cleaning, downsizing and preservation of public space. One LPDJLQHVWKDWWKLVSXEOLFVSDFHOLIWVIXQFWLRQVDVDÀH[LEOHOLQHRIYDU\LQJWKLFNQHVVDWGLIIHUHQWSRLQWVFRPSUHVVLQJ and dilation as appropriate. The Hellenistic Faro 7KHUHPDLQVRIWKH+HOOHQLVWLFOLJKWKRXVHDUHLQVLGHDFXUWDLQEXLOGLQJ7KLVLVDQLPSRUWDQW¿QGLQJKRZHYHUWKDWUDL­ ses the question of how to intervene when digging for a new building which is something important.The project aims to build around the remains a glass built, with a very simple structure by a steel frame. A “box” where you can access from the public pathways, that contains within it the ruins one can walk throug. One can also envisage the construc­ tion of a volume over the structure which must be balanced with the structure of the discovery. The route over the lighthouse connects the road with the Ottoman district. Besides becoming an opportunity to look at what “was” and a crossing in the city, in a game of contrasts of materials (the physicality of the objects and transparency dell’involucro) the remains of archaeological objects become markedly contemporaries, which mark the points in the city, including the evening lighting of becoming “light boxes” by landmark. West ­ Easr side The East and West are different from each other, starting from orography. The West side compared to the share sale in the square, which becomes the hill, down the East side and beyond the sight. The West side The West side, with the Mosque and the hill became the scene of the most important square. The face to watch and to be discovered since the entrances to the square are always an “end.” The physical dimensions of this side has me 240 ant that the project work alternates a sequence of full and empty. In the middle of the hill with its object is to counter­ balance a gap (the band, right on the tram) marked a turn from the “full” in the embankments Garden. The West side KDVEHHQVWUHQJWKHQHGDQGDUFKLWHFWXUDOO\GH¿QHGE\WKHGHVLJQRIWKHIRXQGDWLRQVRIWKHPRVTXHDQGWKHSUHIHFWXUH building is a sort of continuous wall along the side that they perceive the limit and length. The East side The East side of the falls, escapes from view and is composed of very different objects with each other. A building “a tower post­90s “, a small building markedly rationalist, a twentieth century villa with a library inside a hidden vegeta­ WLRQRQHODQHURDGWKDWSHQHWUDWHVWKH2WWRPDQTXDUWHUDRQHÀRRUEXLOGLQJZLWKVKRSV7KH(DVWVLGHZLOOQRW EHDEOHHYHUWREHFRPHD¿IWKWKDWYLVXDOO\EDODQFHVWKH:HVWVLGHLWLVWRRFRPSURPLVHGDQGPDGHYHU\GLIIHUHQW 7KHSURMHFWZRUNVQRWRQWKHFRQVWUXFWLRQRID¿IWKEXWRQWKHFRQVWUXFWLRQRID³IXOO´LWPDNHVGHQVHWKLVVLGH,Q DGGLWLRQWRWKHHPEDQNPHQWVJDUGHQFUHDWLQJDPDVVSHQHWUDWLQJJUHHQRQWKLVVLGHDQGWKDWPDNHVLWD¿UVW³IXOO´ ZLWKUHJDUGWRWKHGH¿QLWLRQRIWKHERDUGLWVHOIWKHPRVWJRRG,QRXUZD\RIYLHZLWUHDGVOLNHDVXFFHVVLRQRIGLIIHUHQW episodes, emphasize this point and extract the interesting material. The system interesting for the project consists of: the rationalist building, the library and the line of shops that build a set of individual items a high­two plans, not a curtain wall construction, but the individual objects. The project proposes to enhance this aspect by including two new YROXPHVDQGOLQNLQJWKLVV\VWHPRIREMHFWVZLWKDFHPHQWÀRRULQSDUWLFXODUSULQWHG A “linear” building and a “passage” building ­ An upper body that contains a plan or local shops and that continues, but not through a physical continuity of the line stores, and strengthens it. At the existing body is attached to about 1m. away a new façade giving an increase in the activities of the surface. $EXLOGLQJDERXWÀRRUVKLJKZKLFKPDNHVWKHJDPHZLWKWKHUDWLRQDOLVWEXLOGLQJDQGWKHOLEUDU\7KLVVHFRQG YROXPHGH¿QHVWKHHQWUDQFHWRWKH2WWRPDQTXDUWHU,WLVWKHUHIRUHLPSRUWDQWWKDWWKHJURXQGDWWDFNLVDSXEOLFSDWK which can be read in both directions as an input (entrance to the square, entrance to the neighbourhood Ottoman). It is essential to tie this part of the town square. Even if the deal can work without the presence of two new bodies, they offer an opportunity to include a number of activities that are currently lacking in the square and that it would increase the daily use. One imagines that the use of small businesses or local use. Even over the long linear terrace overlooking the square becomes a meeting place. ,IGXULQJWKHFRQVWUXFWLRQRIWKHVHHOHPHQWVZHZHUHWR¿QGLPSRUWDQWDUFKDHRORJLFDO¿QGVLQWKHRSHUDWLRQWKHQWKH VDPHSURFHVVDVWKHRQHSURSRVHGIRUWKH+HOOHQLVWLFOLJKWKRXVHZRXOGEHFDUULHGRXW&RPSDUHGWRH[LVWLQJEXLOGLQJV transactions were made to “restore” the library on the square, thinning the vegetation,, using the embankments to address a cone on the optical and “separate” the building from the top of the other volumes Walls and gardens The East board is made thick further by a series of gardens enclosed by walls that contain precius essences. The soil RIWKHVHJDUGHQVLVYHU\GUDLQLQJDQGLQDSRVLWLRQWRDEVRUEDVLJQL¿FDQWDPRXQWRIZDWHU VHHZDWHUV\VWHP $ORQJ with the embankments garden which is part of the square that creates a green spot and joins the system of closed gardens behind, that is in sharp decline, but that it hopes to be recovered. The view from the mosque towards this side is that of a large garden with trees, and with its size and grace it blurs the view behind the buildings recently built, with all their anonymity. 6867$,1$%,/,7<:25.,1*:,7+6+$'2:/,*+7:$7(56721(66,/(1&( 7KH¿UVWIRFXVLQEXLOGLQJDSXEOLFSODFHWKDWLVERWKDFFHVVLEOHDQGXVDEOHE\DOOLVWRPDNHDSODQIRUDVXVWDLQDEOH open space that also means working with materials that help to build the physical situations, places where they “feel good” , starting from the peculiarities of the place: climate, latitude ... The project works with the shadow, that is produced by trees, with the coolness and the feeling of fresh water that can EHPDGHZLWKPDWHULDOVWKDWGRQRWKHDWXSOLNHWKHVWRQHZLWKOLJKWVPDNLQJLWSRVVLEOHWRGH¿QHWKHVSDFHVLQWKH evening and fed through technologies that follow the principles of energy saving. A series of gardens with trees dot the square, gardens with Mediterranean buildings that offer places of shade. One imagines it is pulled even in the walled gardens that characterized the surrounding area in order to create space between private and public a dense system of “green” that can play a role in the ecological reconnection between the hill slopes and the coast. Trees and earth, shadow, new essences, permeable surfaces ,QWKHVTXDUHLQDGGLWLRQWRWKHHQEDQNPDQWJDUGHQWKHUHDUHWKHJDUGHQLQFOXGHGLQWKH¿UVWÀLJKWRIVWDLUVWRHQWHU WKHPRVTXHWKHJDUGHQWKDW¿WVLQWKHEDVHPHQWRIWKHWKHDWUHWKHJDUGHQVRQWKH(DVWVLGH WKHOLPRQVJDUGHQDQG the pomegranates garden). This system of gardens as well as greater prosperity in this place to live, make frequent SDWFKHVRIVKDGHWKDWDUHLPSRUWDQWLQVHYHUDOUHVSHFWV7KHLUGH¿QLWLRQKDVEHHQXVHGDVDQRSSRUWXQLW\WRLQWURGXFH new species. The plants are selected and chosen always from the Mediterranean and therefore well suited to the cli­ PDWHRI'XUUHVEXWFXUUHQWO\WKH\DUHQRWFRPPRQLQWKLVFLW\,WLVWKHQHQULFKHGE\WKHUDQJHRIWUHHVSHFLHVDQGLWLV these gardens that are special places. The embankments along with the rest of the gardens are on earth, that allows both to have the amount of land necessary for the growth of trees (embankments) and have good ground for the type of plants, and have well drained soil.The bottom is covered with covering grass.A good part of the project is to have a permeable surface (increasingly required in the “sustainable” Projects). Materials 7KHEXLOGLQJPDWHULDOVDUHRIWHQPDWHULDOVRIWUDGLWLRQUHLQWHUSUHWHGWKURXJKDFRQWHPSRUDU\ODQJXDJH)XUWKHUPRUH WKHLUFKRLFHZDVDOVRPDGHRQWKHEDVLVRIWKHLUGXUDELOLW\DQGHDVHRIPDLQWHQDQFH)ORRULQJ$OEDQHUD6WRQH6WRQH $XUHVLQDSULQWHGDQGFRORXUHG&HPHQW)LEURFHPHQWR7KHEDVHPHQWVDUH$XUHVLQDVWRQHPDGH7KHZDOOVRIWKH gardens are in concrete. 241 244 Water: cool, collected, irrigate. In the square it is expected to attend the water not only as a dramatic and playful material as well as materials in the construction of well­being. It is an element that cools in the summer and collects for reuse in winter. The project includes the base of the wall of a mosque with a vertical blade of water that makes this a more dramatic element, as well as the presence of jets at the front of the theatre. These two games of water can work in special moments and add to the scenery of the square. In the Embankments Garden there are three pools of water the height of a few cm. that are cool in summer and this part can be used by children to play. In winter when there is no need to FUHDWHIUHVKQHVVWKH\PD\UHPDLQHPSW\DQGEHFRPHJURXQGÀRRURULQWKHHYHQWRIKHDY\UDLQVFRQWDLQPHQWWDQNV The system of water: in the East of the square across the pavement are tanks built in a system that does not “dispo­ se” the water, but collects and reuses it. In addition to the operation of the slopes and drains that convey the water in WKH(DVWIURPWKHVTXDUHWKHWDQNV³IRXQWDLQV´FROOHFWWKHZDWHUDQGWKHQWKURXJKGUDZHULWWKURXJKDVSHFLDOÀRRULQJ that runs up to the gardens where the soil absorbs it . A strip of pavement in the East is cement board (material used LQ'XUUHVDQGZLWKLQWHUHVWLQJUHVXOWV DQGWKLVJLYHVWKHRSSRUWXQLW\WRGHVLJQDVSHFLDOÀRRUZLWKWLQ\JURRYHVWKDWDV “rigagnoli” designed to allow you to scroll . Rainwater harvesting is then used to irrigate the gardens. And these in turn “dispose of” water and the ground set in gardens is very draining and the tree species are put at a distance between them to avoid the asphyxiating radical. Lighting scheme The lighting of a public building the atmosphere of the evening. The project includes: high­lamps scattered across the square built on a 10m high pole with a double headlamp built ZLWKWZRFLUFOHVRIOLJKWRQWKHSDYHPHQWLQIURQWRIWKH&LW\+DOORQHRIWKHVHWZRFLUFOHVLVFRORXUHGOLJKWLQIURQWRI the theatre where the are coloured strips of land embellishing the pavement. This marks the lighting of the square representation ­ In the most “intimate”, the lighting is as tall stems, ­lights under the trees are emerging from below the masses of plant, ­steps have a light at grade steps, ­ the street and the tram route are light by a row of tall poles 0DQ\RIWKHVHOLJKWVXVH/('WHFKQRORJ\2QHFDQDOVRLPDJLQHWKDWWKHFRYHUDJHRIWKHWKHDWUHEHFRPHVDSKRWRYRO­ taic surface that combines with the production of alternative energy running across the square. Sounds of a square $QRWKHULPSRUWDQWDVSHFWLQWKHFRQWH[WRIVXVWDLQDELOLW\LVOLQNHGWRWKHWUDQVLWRIFDUV'HFLGLQJWRZRUNRQWKHPD[L­ mum reduction of the passage of vehicles is an important choice that adheres to certain principles. This is not just a air pollution cleaning but also noise that greatly affects the construction of well­being. 9,$%,/,7< transit gradations Building a pause in the city space. The attitude the project plans to develop is of a growing slowdown in the central area up to a total break in the square. A sort of gradual pedestrian area. The roads towards Piazza Liria become per­ YDVLYHLQWKHFHQWUDODUHDZKHUHWKHWUDI¿FKDVDORZHUJUDGH9HKLFOHVFDQJRWKURXJKWKHVTXDUHIURPQRUWKWRVRXWK DORQJWKHIURQWRIWKHSUHIHFWXUHDQGWKHPRVTXHDQGLQIURPHDVWWRZHVWLQIURQWRI&LW\+DOO,QWKHVHDUHDVWKHÀRRU is made of carriage and cubes of auresina stone. The parking lots are not placed directly on the square, but a precise number of parking spaces around the parking areas provide necessary pertaining to buildings. The project plans the passage in the square of a tram or bus. In front of the prefecture has placed a stop. &+(&.,1*7+()/(;,%,/,7<2)7+(63$&( The area of a square must include practices related to the everyday life, but also give the possibility to organize HYHQWVLQVLGH,WPXVWEHDEOHWR¿OOLQDQGWREHIXOORIPHDQLQJVDOVRZKHQLWLVHPSW\2QWKHHDVWVLGHLWLVH[SHFWHG an every day life use, linked to rest, meeting, playing and living together. In front of the theatre and the town hall but DOVRLQIURQWRIWKHUXLQVRIWKH%\]DQWLQHIRURFDQEHSODQQHGVRPHRXWGRRUHYHQWVWKHVTXDUHFDQEHDUUDQJHG On the east side of the theatre bars and pubs can expand to open air, giving to the square some liveliness of life. Feasibility units of action It is expected that the project is feasible at different times, through various chunks. Each excerpt was concluded in itself so that even if you do not realize all the action remains complete. The various stages are: ­ 1 soil sensitive about the square VHQVLWLYHJURXQGLQIURQWRIWKHIURQW0DFHOOXPDQGWKHUHPDLQVRIWKH+HOOHQLVWLFOLJKWKRXVHWRZHUDQGWKH&ORFN tower ­ 3 basement of the mosque ­ 4 printed concrete pavement system and gardens ­ 5 basement of the theatre EDVHPHQWRIWKH&LW\+DOO ­ 7 renovation of the Macellum 245 5.3 Con Sheshi Temporary $UFK/RUHQ]R3LJQDWWL0RUDQR$UFK)HGHULFD2WWRQH $UFK0DUFR9RGRWWR8UEDQ3ODQQHU5REHUWR0DVFDUXFFL $UFK(ULF+DOGHQE\/DQGVFDSH$UFK6DVKLPLQH0DVXL C. Cellucci, S. Gruosso, P. Liguori $675$7(*,&9,6,21)25'855(6 A “strategic vision” is a synthetic and evocative image of a desired urban organisation. It is not a plan, nor is it a sim­ ple functional diagram, but rather the elaboration of a “designed” idea of the objective to be achieved during a process of strategic planning. In our case, on the contrary, it represents a synthetic image of reference for: ­ framing the comprehensive meaning of a proposal within a more general system of coherent urban planning deci­ VLRQV ­ highlighting all of the elements that the project intends to bring into play based on their functional qualities (infra­ VWUXFWXUDOQHWZRUNVPRELOLW\V\VWHPVWKH³UHOHYDQW´HOHPHQWVRIDQXUEDQV\VWHPHWF  ­ assuming a propositive position regarding possible programmes of urban development that can be structured through planned intervention. 7KHSURMHFWIRUWKHUHYLWDOLVDWLRQRI,OLULD6TXDUHUHVSHFWVWKH0DVWHU3ODQIRUWKH+LVWRULFDO&LW\ FXUUHQWO\YDOLG ZKLOH SUH¿JXULQJSRVVLEOHVFHQDULRVRIIXWXUHXUEDQGHYHORSPHQWWKDWPD\UHVXOWIURPLQWHUYHQWLRQVLQYROYLQJWKH6TXDUH 7KHSURMHFWLQWHQGVWRJLYHULVHWRDSURFHVVRIXUEDQUHTXDOL¿FDWLRQWKDWJUDGXDOO\FRXOGVSUHDGWKURXJKRXWWKHFLW\ The prospects of future urban development related to the project for the Iliria Square are based on the following important operations focused on the development of the city: ­ the conservation of the important environmental resources represented by the large urban park (Park of the Walls) WKDWZUDSVDURXQGWKHDPSKLWKHDWUH ­ a valorisation of the system of existing historical/archaeological elements that allows for their use as part of a struc­ WXUHGQHWZRUNRIWRXULVPEDVHGRQWKHPDWLFLWLQHUDULHV ­ the re­design of the two waterfronts, specialising the south­eastern area to meet the needs of the port and commer­ FLDODFWLYLWLHVDQGWKHVRXWKZHVWHUQDUHDLQUHODWLRQWREDWKLQJDFWLYLWLHVDQGWRXULVP ­ the creation of a system of urban public transportation, even local, that re­connects the railway station with the LPSRUWDQWVLWHVORFDWHGLQWKHKLVWRULFFHQWUH WKURXJKD³/LJKW7UDQVLW6\VWHP´  WKHLPSOHPHQWDWLRQRISURFHVVHVRIXUEDQUHTXDOL¿FDWLRQLQYROYLQJLPSRUWDQWSRUWLRQVRIWKHKLVWRULFDOFHQWUHWKDW GHPRQVWUDWHHOHYDWHGOHYHOVRITXDOLW\ ­ the re­launching of the commercial role of the public square as a catalyst for processes of urban valorisation, also in UHODWLRQVKLSWRWKHQHZFRPPHUFLDODQGRI¿FHVSDFHV 7KHVWUDWHJLFGHVLJQLVEDVHGRQWKHIROORZLQJUHÀHFWLRQV ­ Iliria Square is already a central part of the urban fabric and only requires a process of reorganisation in order to EHWWHUIXO¿OLWVIXQFWLRQDVDSRLQWRIVRFLDOJDWKHULQJ ­ it is a fundamental node between the northern part of the city and the waterfront to the south, a role that it must PDLQWDLQWKRXJKLWPXVWEHIUHHGRIFURVVLQJYHKLFXODUWUDI¿F WRFRQWLQXHWRIXO¿OLWVUROHDVDG\QDPLFFHQWUHRIWKHFLW\WKHSXEOLFVTXDUHPXVWEHUHDFKDEOHE\FDUHYHQLILW EHFRPHVDSHGHVWULDQVSDFH Based on the general criteria listed above, the strategic vision that underlies the development of the project is based on the following elements: ­ Iliria Square is simultaneously a point of continuity and separation between the northern and southern parts of the FLW\UHSUHVHQWLQJDV\QWKHVLVRIFRPSOH[XUEDQLVVXHVZKLOHDYRLGLQJWKHG\VIXQFWLRQVUHODWHGWRFURVVLQJWUDI¿FDQG WKHRYHUODSSLQJRIGLIIHUHQWSURJUDPPHV ,OLULD6TXDUHFDQEHUHDFKHGE\FDUXVLQJWZRSRVVLEOHGLUHFWLRQVDODUJHXUEDQWUDI¿FDUWHU\IURPWKHQRUWKDQGDQ DUWHU\WKDWKDQGOHVPRUHRFFDVLRQDODQGOLPLWHGWUDI¿FIURPWKHVRXWK IURP5UXJHV(SLGDPQRV  WKHFURVVLQJRIWKH,OLULD6TXDUHE\FDULVDOORZHGRQO\RFFDVLRQDOO\OLPLWLQJLQWHQVHWUDI¿F ­ the organisation of the spaces of the square permits the simultaneous presence of different urban functions without, however, allowing overlapping. To obtain the desired propulsive effect of urban renewal the design of the new Iliria Square embodies all of the fundamental themes and the resulting complexity of the surrounding urban and environmental system: the urban park, the historical­archaeological paths, commercial activities, socio­cultural activities, vehicular mobility, local public transportation, spaces of social gathering and pedestrian mobility. Based on this proposal, Iliria Square continues to be the beating heart and driving force behind the entire functional PHFKDQLVPRIWKLVFHQWUDOSDUWRIWKHFLW\ZKLOHDYRLGLQJEHFRPLQJDIXQQHOLQVLGHZKLFKWKHGLIIHUHQWÀRZVRIWUDI¿F that cross the city overlap with various urban functions. 247 352-(&7'(6&5,37,21 7KHSURMHFWZDQWVWREHLQWHUSUHWHGDVDPRPHQWRIFRQMXQFWLRQEHWZHHQQDWXUHDQGDUWL¿FHODQGVFDSHDQGXUEDQLW\ history and modernity. The concept of nature, landscape and history is represented by the “Environmental Infrastruc­ ture” positioned along the western side of the Square, a natural edge that contains most of the historical and archeo­ logical artifacts. This side is basically conceived as a Park that will offer a green character to the Square. The concept RIDUWL¿FHXUEDQLW\DQGPRGHUQLW\LVUHSUHVHQWHGE\WKH³8UEDQ,QIUDVWUXFWXUH´SRVLWLRQHGLQWKHHDVWHUQVLGHRIWKH Square, a man­made edge that is expressed through a long Portico that will offer a consistent and visual boundary to the Square, an infrastructure that will allow many different uses to occur as well as an infrastructure behind which future building developments could attach themselves and relate to. The “Shesh”, the Square remains in the middle between these two public armatures as a void, without any permanent occupation, any tangible intervention, any tangible changes. The project is best described by its three fundamental elements: 1 ­ The Environmental Infrastructure – The Park at the Western Side of Iliria Square The west side of the Iliria Square represents the extension of the future Park of the Walls into the central Square. It is seen as a Park, a green area where the remains of archeology are settled and exposed in a natural green landscape, following and reinforcing the romantic relationship between ruins and nature. This natural area is supposed to connect WKH5RPDQ7KHDWUHZLWKWKH%\]DQWLQH)RUXPDQGLWDOVRLQFOXGHVVRPHRIWKHPRVWLPSRUWDQWEXLOGLQJVRIWKHVLWH such as the Mosque, the Prefecture and, at the top, the Palace of Culture. It is conceived as an Environmental Infrastructure for the city. With this term we intend a small “green corridor”, an are that is mostly natural, that is highly planted, that offers a comfortable micro­climate (mostly during the summer), that could contain recreational functions and that operates as a natural green “facility” for the city. The metaphorical imagery that is here proposed is the one of a landslide from the hill into the Square. We do know that the geological stability of the hill is very poor and already throughout the centuries there have been many landslides that covered, for instance, the Roman Theatre. Thus, the idea of a gentle slide of the hill into the parterre of the Square is seen consistent with the nature and history of the SODFH7KLVVLGHLVRUJDQL]HGIROORZLQJRUJDQLFOLQHVFUHDWLQJDVPDOOSDUNWKDWZLOORIIHUDVLJQL¿FDQWSUHVHQFHRI QDWXUHZLWKLQWKHFHQWUDOSDUWRI'XUUHV7KLVDUHDZLOOFRQWDLQWUHHVDQGDORZYHJHWDWLRQFUHDWLQJDPLFURFOLPDWHDV well as visual a green buffer that can mitigate the presence of buildings and artifacts. This area also contains a path that is an extension of the historical/archaeological itinerary that begins at the waterfront and connects the Roman 7KHDWUHZLWKWKH2WWRPDQ&DVWOHWKH%\]DQWLQH:DOODQGWKH%\]DQWLQH)RUXPSDVVLQJQH[WWRKH0RVTXHWKH Prefecture and the Palace of Culture. In this portion the path is slightly raised above the Square and offers views onto it. The path meets the different stairs that connect the lower part of the Square with the Mosque and the upper portion of this area. The path is covered with stabilized earth, a material that is natural but also offers a clean and smooth surface to walk on. This path also enters in between the present façade of the Prefecture and a new “green screen” that is proposed in front of the Prefecture, thus intereacting with the functions contained in this building. The path then GHVFHQGVWRWKHVWUHHWOHYHOFURVVHVWKHURDGDQGFRQWLQXHVWRZDUGVWKHZHVWVLGHRIWKH3DODFHRI&XOWXUHDQG¿QDOO\ HQWHUVLQWRWKH%\]DQWLQH)RUXPZKHUHLWHQGV7KLVSDUNKDVDOVRRWKHUUHFUHDWLRQDORXWGRRUVSURJUDPV$ORQJ the path that extends itself along the slopes of the hill on the western side of Iliria Square and connects the Roman 7KHDWUHZLWKWKH%\]DQWLQH)RUXPWKHUHDUHVRPHRSHQDLUWHUUDFHVRQWRSZKLFKDIHZRIVPDOOGRPHVDUHORFDWHG Their spherical shape, besides recalling the dome of the Mosque, derives from the idea of responding to the naturality RIWKLVJUHHQDUHDDQGWKHVRIWQHVVRIWKHVORSHWKDWGHVFHQGVWRZDUGVWKH6TXDUH(DFKGRPHFRQWDLQVDVSHFL¿F SURJUDPZLWKLQWKHVSDFHWKDWLWUHODWHVWRRIWHQWKH\FRQWDLQDFDIpZLWKWDEOHVDQGFKDLUVRULWLVVLPSO\DURRIIRU WKHFKLOGUHQ¶VSOD\JURXQGRULWUHSUHVHQWVDÀH[LEOHVSDFHIRUVPDOOFRQFHUWVHYHQWVVPDOOSHUIRUPDQFHVRSHQDLU exhibitions, etc. These activities will reinforce the public role of the Park and will add to it another layer of use and program. These domes are organic entities, with a smooth surface and with large openings through which large trees will grow and offer a comfortable condition. They will create shade and a fresh climate during the hot summer days, possibly with the aid of water nebulizers, or protect from rain during winter days. At the present moment, we imagine that two of them could replace the temporary existing structure that today has cafes in them. The domes are made of SUHIDEULFDWHGFRPSRQHQWV7KH\DUH¿EHUJODVVHOHPHQWVWKLQDQGUHVLVWDQWRIDJUHHQFRORURIVXFKGLPHQVLRQVWKDW FRXOGEHHDVLO\PRYHGDQGPRXQWHG7KHGRPHVZLOOEHVLPSO\DWWDFKHGWRWKHZRRGÀRRUWKDWSDYHVWKHWHUUDFHV This side of Iliria Square also contains a new “Green Screen” that is proposed in front of the façade of the Prefecture. In fact the building of the Prefecture offers to the Square its main elevation, characterized by a certain monumentality, EXWSUREDEO\DELWULJLGDWWKHH\HVRIPRVWRIWKHLQKDELWDQWVRI'XUUHV7KHVROXWLRQWKDWLVKHUHSURSRVHGWULHVWR mitigate the austerity of the existing façade and relate it to the softness of the lines of the park, by introducing a new façade independent from the existing. The new façade is made by a three dimensional steel frame, covered with steel perforated panels. This structure contains the previously mentioned path that extends itself along the Prefecture at 6.00 m. above the level of the Square, the same height of the podium on which the building of the Prefecture sits. The new façade is then an urban “backdrop” or a green screen created by a double layer of steel perforated panels, with different patterns and dimensions of holes and colored with different tonalities of green. Some portions will be realized with vegetable walls and will contain vases where climbing vegetation will grow and cover parts of the façade. These plants could be of different colors, giving a playful and joyful character to the facade of the Prefecture. This steel frame could have some platforms and balconies connected to the building as extension of the internal spaces of the Prefecture. This new façade thus embodies many different roles: 1. It is a “green screen” that will be consistent with the natural imagery of this side of Iliria Square. ,WDOVRFRQWDLQVWKHSDWKWKDWFRQQHFWVWKH5RPDQ7KHDWUHZLWKWKH%\]DQWLQH)RUXP 3. It offers the possibility for new outdoors spaces for the Prefecture at different heights. 2 ­ The Urban Infrastructure – The Portico on the eastern part of the Iliria Square 7KHHDVWHUQVLGHRIWKH6TXDUHLVGH¿QHGDQGOLPLWHGE\DQ8UEDQ,QIUDVWUXFWXUHWKDWZHFDOOWKH3RUWLFR 7KLVLVLQUHIHUHQFHWRRQHSLFWXUHRIDQFLHQW'XUUHVZHUHDWZRVWRUH\ORQJEXLOGLQJZDVYLVLEOHDQGLWZDVGH¿QLQJWKLV edge of the Square as well as in reference to the proposed project for the Square done by L. Carmignani in the 250 Thirties. The Portico appears as a new edge element on the east side of the Square. It consists of a linear long element constructed in a steel frame covered with local stone. It forms a sort of long “sleeve” that creates a consistent visual edge to the Square, very open at the ground level and supported by a punctual elements that correspond to IXQFWLRQDOVSDFHVVXFKDVVWDLUHOHPHQWVOLIWVDQGJHRPHWULFDOYROXPHVWKDWDUHVSHFL¿FDOO\ORFDWHG This Portico is both a public urban infrastructure, a recreational and commercial space and contains public functions D³+RXVHRIWKH&LW\´DQGD0HGLDWHTXH LQWKHXSSHUOHYHO7KLVOLQHDUEXLOGLQJVVHUYHVDVDSXEOLFLQIUDVWUXFWXUHLQ many ways. It will have a foundation element made out a hollow concrete structure, of 1.20 m of depth, that has the role of containing all the mechanical systems along the entire perimeter of the Square and then distribute to all the services. These slab could be inspected and accessible along its length following a system of modular paving, some of which could be opened. In the same paving there will be mechanical and retractible towers that will offer all the pos­ sible connections to the different systems (electricity, water, telephone). These will allow to have temporary functions under the portico, such as daily markets, exhibitions, festivals, etc. Another part that works as an infrastructural and mechanical system is the roof that is used as an energy device. It will FRQWDLQVSHFLDOSKRWRYROWDLFSDQHOVZLWKDVSHFLDOÀDWVHFWLRQWKDWEHWWHUWDNHVDGYDQWDJHRIWKHVRODUH[SRVXUH 7KHVHSDQHOVDUHVSHFL¿FDOO\FRQFHLYHGWREHORFDWHGRQWKHURRIVDQGDUHFRPSOHWHO\ZDWHUSURRI 7KHSKRWRYROWDLF panels are not considered in the proposed budget). This building also contains all the possible mechanisms and tools IRUDOORZLQJGLIIHUHQWDFWLYLWLHVWKDWFRXOGKDSSHQXQGHUWKH3RUWLFRDQGVSUHDGRXWLQWRWKHVTXDUH0RUHVSHFL¿FDO­ O\WKHUHZLOOEHIROGLQJSDQHOVDQGFXUWDLQVDWWDFKHGWRWKHORZHUVLGHRIWKHÀRRUVODEWKDWFRXOGEHRSHQHGDQG generate small spaces for temporary vending stools for the market. At the same time, the small towers, providing FRQQHFWLRQVWRDOOPHFKDQLFDOV\VWHPVFRXOGUDLVHIURPWKHJURXQGDQGSURYLGHDOOVRUWRIV\VWHPV)LQDOO\WKH3RUWLFR LVVHHQWREHFRPHDQLQVWUXPHQWWRGH¿QHWKHFRQGLWLRQVIRUWKHFRQVWUXFWLRQRIQHZEXLOGLQJVEHKLQGLW$VLQPDQ\ European cities during the XIXth and early XXth centuries, private buildings will have a public portico as a mediating element between the public spaces and the private ones, as a circulation and commercial space. This Portico in 'XUUHVLQWHQGVWRGRWKHVDPHDQGWKXVUHJXODWHIXWXUHFRQVWUXFWLRQVDQGRIIHUDSXEOLFIDoDGHWKDWZLOOEHFRQVLVWHQW for the entire east length of the Square. This armature will represent the public front of any new private construction that will occur in the adjacent lots. Every new building will have this Portico as a face, will be entered though it and the new constructions will have to be detached 5.00 m. from it. This Portico at ground level plays a primary role as a linear pedestrian open space and a space of socialization. The ground level of this Portico is in fact conceived with DJUHDWÀH[LELOLW\RIXVHVLQFHWKHEHDULQJVWUXFWXUHLVOLPLWHGWRIHZSRLQWVDQGOHDYHVPRVWRIWKHVSDFHHPSW\IRU different functions (market, exhibitions, festivals, etc.). The ground is thus visually open and the result that is here aimed is the one of a thin line of shadow, more than a spa­ FHWKDWLVGH¿QHGDQGFRPSOHWH,QIDFWWKH6TXDUHHQGVYLVXDOO\DJDLQVWWKHIDoDGHRIWKH3RUWLFREXWLQUHDOLW\LWVOLIH and functions extend themselves under it and continue further in the private lots that are behind the Portico. People can rest and enjoy the shade under the Portico, they could sit at a café, they will have privileged views towards WKH6TXDUHDQGFRXOGSDUWLFLSDWHWRWKHHYHQWVDQGLPSRUWDQWPRPHQWVRIWKHVRFLDOOLIHRI'XUUHV7KHSRUWLFRDWWKH upper level becomes enclosed and inhabitable, offering public spaces for the city. It is a space 7,00 m. wide and as long as the Square. It will contain a function that is appropriate with its position and role. We are suggesting that this VSDFHZLOOKRXVHD³+RXVHRIWKH&LW\´DVSDFHZKHUHWKH0XQLFLSDOLW\RI'XUUHVZRXOGGLVSOD\SHUPDQHQWO\WKHPDMRU projects and the major plans for the city. It will become a space for understanding and participating to the future transformation of the city, also in connection to the year 2020 when it will be the European Capital of Culture.The VSDFHLQVLGHLVYHU\ÀH[LEOHDQGWUDQVIRUPDEOHLWKDVOLQHDUWUDFNVSRVLWLRQHGRQWKHFHLOLQJDORQJZKLFKPRYDEOH panels could slide along the rectilinear space in order to set temporary exhibitions. When the panels are not needed, they are packed in small niches and thus the space becomes usable by the Municipality for meetings, receptions and cultural events. This raised condition also offers a privileged position to look back towards the city as well as it represents a permanent visual element seen from the city. The exterior of the Portico is cladded with a surface made of long linear and thin blocks of local grey stone. This pattern will also include some random long open strips that are FUHDWHGE\VKLIWLQJWKHVLQJOHVWRQHV7KH¿QDOHIIHFWLVRIDFRPSDFWDQGVROLGVXUIDFHEXWYLEUDQWDQGOXPLQRXV7KH OLJKWFRPHVIURPRXWVLGHWKURXJKWKHVHWKLQFXWVDQGLV¿OWHUHGE\WUDVOXFLGJODVVSDQHOVWKDWDUHORFDWHGLQWKHLQQHU part of the wall. At night, the light from inside will glow and illuminate the exteriors of the façade. 3­ The Sheshi ,OLULD6TXDUHLVWKHPDLQDQGPRVWFHQWUDOVSDFHRI'XUHVV$WWKHVDPHWLPH,OLULD6TXDUHUHSUHVHQWVWKHKLVWRULFDO FXOWXUDOVRFLDODQGSROLWLFDOPHPRU\RI'XUHVVDQGWKLVFKDUDFWHUKDVWREHSUHVHUYHGDQGUHLQIRUFHG%HFDXVHRI that, the project intends to maintain the square empty from new functions. It will be a void. ,WZLOOQRWFRQWDLQSHUPDQHQWREMHFWVRUSURJUDPVLWZLOOQRWKDYHDVSHFL¿FVWUXFWXUHDQGLWZLOOQRWEHRUJDQL]HGIRU DQ\VSHFL¿FHYHQW,WZLOOEHWKHVSDFHIRUWKHFROOHFWLYHPHPRU\DQG³FLYLWDV´RI'XUUHVDQGWKHVSDFHZKHUHWKHSR­ pulation will gather for daily circumstances or celebrate exceptional events. Its own character will be given by the two ÀDQNLQJVLGHVWKH(QYLURQPHQWDO,QIUDVWUXFWXUHRQWKHZHVWHUQVLGHDQGWKH8UEDQ,QIUDVWUXFWXUHRQWKHHDVWHUQVLGH 7KHVSDFHLVWKHQWKHFRPELQDWLRQEHWZHHQQDWXUHDQGDUWL¿FHEHWZHHQODQGVFDSHDQGXUEDQLW\EHWZHHQSDVWDQG SUHVHQW7KHVTXDUHLVZKHUHWKHVHWZRHQWLWLHVPHHWDQG¿QGLWVORJLFDOV\QWKHVLV7KLVSURMHFWDOVRZDQWVWRPDLQWDLQ the few existing elements of the Square. The existing fountain, certainly an object that is known and loved by all the FLWL]HQVRI'XUUHVZLOOEHPDLQWDLQHGDQGUHYDOXDWHG2XUSURSRVDOSXWVWKHH[LVWLQJIRXQWDLQSDUWLDOO\ZLWKLQDQHZ horizontal surface of still water. Placing it on water means to give to it a more prestigious and important role. The IRXQWDLQZLOOEHDOZD\VDFFHVVLEOHDQGSHRSOHFDQVLWRQLWVVWHSVVLQFHWKHZDWHUVXUURXQGVLWRQO\RQRQHVLGH)URP WKLVSRROWKHUHLVDVPDOOSURWHFWHGVWUHDPRIZDWHUWKDWÀRZVDORQJWKHJHQWOHVORSHRIWKHVXUIDFHRIWKHVTXDUH7KLV stream of water recalls the Islamic gardens and fountains, appearing and disappearing into the ground. The existing trees /HEDQRQ&HGDUV LQWKHFHQWUHRI,OLULD6TXDUHZLOOEHDOVRPDLQWDLQHG7KLVGHFLVLRQZDVGLI¿FXOWVLQFHWKHVH trees separate in two the existing space and their removal would have allowed to offer a more unitarian dimension DQGDSSUHFLDWLRQRIWKHHQWLUH6TXDUH+RZHYHULWZDVHYLGHQWWKDWPDQ\SHRSOHVSHFL¿FDOO\ROGPHQVLWXQGHUWKHP and take part in the daily life of the space. Thus the decision of maintaining them. Our proposal only suggests a new paving for this area, made of stabilized earth, as in many other green areas and new lighting that will enhance the quality of this area. 252 The materials of the entire intervention are all consistent and natural. The main material will be the local grey stone that will cover most of the visible surfaces, both horizontal (the surface of the Square) and the long façade of the Portico. Our intention is to work with the same material but differentiate the dimensions of the blocks, the treatment of the surfaces the positioning on the site and the possible variations that the stone will have in its color. The surface of WKH6TXDUHLVWKHQDOOSDYHGZLWKORFDOJUH\VWRQH+RZHYHUWRJLYHVRPHGH¿QLWLRQWRWKHGLIIHUHQWSDUWVZHSURSRVH that the area in front of the Municipality will be paved with blocks of stone of regular dimensions and similar treatment of the surface, while the entire area in front of the Prefecture and the Palace of Culture will be paved with the same stones but with blocks of different dimensions and different surface treatment. Public lighting will be done in three different manners.There will be a line of tall light poles crossing the entire Squa­ UHIURPWKH&LW\+DOOWRWKH3DODFHRI&XOWXUH7KHVHOLJKWVZLOOSURYLGHWKHPDLQDQGJHQHUDOLOOXPLQDWLRQWRWKHVSDFH 7KHUHZLOOEHDOVRORZVRXUFHVRIOLJKWFORVHWRWKHOHYHORIWKHÀRRUWKDWZLOOPRVWO\LOOXPLQDWHWKHVWRQHSDYLQJRIWKH 6TXDUHDQGZLOOHQKDQFHWKHQDWXUDOPDWHULDOLW\RIWKHKRUL]RQWDOVXUIDFHV7KHVHOLJKW¿[WXUHVZLOOEHORFDWHGDORQJ small walls or along public paths. The third system of artistic lighting will be in areas with trees and vegetation, inside the new pool, etc. There will be OLJKWVXQGHUWKHWUHHVWRDQLPDWHGXULQJWKHQLJKWWKHQDWXUDODUHDVDQGFUHDWHFRORUYDULDWLRQVLQWKHVHVLWHV'XULQJ the night, the public portico will glow by the light that will come through the little holes of the external surface. This is also intended as a public system of lighting. The green screen in front of the Prefecture will also be back lightened at night. All underground mechanical systems (sewers, water, electricity, telephone, gas, etc.) will be all concentrated under the Portico. In order to reduce excavations on a sensitive archeological soil, we propose that the foundations of the portico will be constituted by an horizontal concrete slab of 1.20 m of thickness (not as deep as the archeological remains) that will serve both as a foundation and also as spaces for all the mechanical systems, pipes and water collectors of the Square. This will allow to concentrate all the systems along one area and optimize possible future additions. This slab will have openings for inspections and maintenance The entire Square will slope gently towards the Portico and all rain water will be collected under it. It could be interesting to propose a system of storing the water in a cistern and eventually re­use it for watering plants during the summer. )LQDOO\ZHEHOLHYHWKDWpublic artLVDQLQWULQVLFSDUWRIDQ\SXEOLFVSDFH7KXVZHDUHSURSRVLQJDVLJQL¿FDQWDUWLVWLF intervention that will characterize and further explain our project as well as add an element of public décor and inte­ rest. This installation, called the “Traces of Waves”, intends to connect the two sides of the Square, the western orga­ nic and natural side with the eastern and more solid urban edge. The installation (as better described later) is made E\DVHULHVRIIROGLQJDQGURWDWLQJVWULSVRIFRUWHQVWHHOWKDWÀRZIURPRQHVLGHWRWKHRWKHURIWKH6TXDUHJRLQJXQGHU and above the ground, around trees, bounding seating areas, folding and providing possible climbing surfaces for kids, or providing surfaces for seating, eating, etc. Their positioning corresponds to the subtle change of direction that separates the part of the Square in front of the City hall from the part in front of the Prefecture and Palace of Culture. The installation thus underlines, with its main direction, this rotation in geometry between the two sides of the Square. These folding lines terminate on the horizontal façade of the Portico, becoming always more and more linear. The installation intends to capture the spirit of this project. The weaving and folding line stands for the relationship betwe­ HQQDWXUHDQGDUWL¿FHDFRQQHFWLRQEHWZHHQODQGVFDSHDQGXUEDQLW\ $5&+$(2/2*,&$/$5($6 7KHSURMHFWDGGUHVVHVYHU\VHULRXVO\WKHUHTXDOL¿FDWLRQRIDOOWKHDUFKHRORJLFDOVLWHVVXUURXQGLQJWKH6TXDUH7KH work that is here proposed is purely related to a better appreciation of the archeological remains, a better understan­ ding of them and a better preservation and protection of the ruins. The project does not propose further archeological H[FDYDWLRQVQHZWUHQFKHVRUVLJQL¿FDQWUHVWRUDWLRQRIWKHDUWLIDFWVVLQFHWKHDPRXQWRIZRUNDQGWKHUHODWHGEXGJHWLV not clear at the moment. Therefore we propose to do some further preliminary documentation of the excavated areas, VRPHPLQRUH[FDYDWLRQVWREHWWHUGH¿QHWKHERXQGDULHVRIWKHDUFKDHRORJLFDO]RQHVVRPHQHZUHWDLQLQJZDOOVWKDW ZRXOGEHWWHUFRQVROLGDWHWKHHDUWKDURXQGWKHVLWHVDQGRIIHUDFOHDQHUDVSHFWDQG¿QDOO\VRPHJHQHUDOFRQVROLGD­ WLRQDQGSDUWLDOUHVWRUDWLRQRIDOOWKHHOHPHQWVWKDWULVNFROODSVH)RULQVWDQFHZHSURSRVHVLPSOHLQWHUYHQWLRQVRI SUHVHUYDWLRQRIWKHUXLQVOLNHFRYHULQJWKHH[SRVHGZDOOVWKDWDUHGDPDJHGZLWKDVSHFL¿FPRUWDULQ³FRFFLRSHVWR´ WKDWZLOOSURWHFWWKHPIURPZDWHULQ¿OWUDWLRQDQGIXUWKHUGDPDJH7KHSURMHFWWDNHVPRUHLQFRQVLGHUDWLRQWKHYLVLELOLW\ DQGDFFHVVLELOLW\RIWKHH[LVWLQJDUFKHRORJLFDOVLWHV$VGHVFULEHGHDUOLHUWKHUHZLOOEHDQ+LVWRULFDO$UFKHRORJLFDO SDWKWKDWZLOOVWDUWIURPWKHZDWHUIURQWDQGWHUPLQDWHDWWKH%\]DQWLQH)RUXP0RUHLQSDUWLFXODUWKLVSDWKZLOOJLYH FRQWUROOHGDFFHVVWRWKH5RPDQ7KHDWUHWRWKH%\]DQWLQH:DOOVDQG2WWRPDQ&DVWOHWRWKH%\]DQWLQH)RUXPDQGWR the Roman Lighthouse. All these sites will be accessible through new pedestrian catwalks, stairs and platforms that will be strategically located in order to offer a better view of the ruins, without altering the conditions of the sites. They constitute a light infrastructure that will allow visitors to access the sites and arrive to the archaeological level, without entering into them unless it will be permitted. All these catwalks and platforms will be fenced, so that the visitors will remain in indicated spaces and the ruins will be protected. The catwalks will allow people to enter the Roman theatre DQGWKH%\]DQWLQH)RUXP+RZHYHUWKHVHFDWZDONVFRXOGEHFORVHGDQGZLOOEHRSHQDWOLPLWHGKRXUVLQRUGHUWRKDYH a full control and protection of the sites. These catwalks, stairs and platforms are conceived in a light steel structure, covered with laminated wood, panels and handrails always in metal and wood. They will contain some of added elements, such as benches, information panels, small ticket booths, canopies for shading, etc. The project of the archaeological areas is strictly related to the project for the landscape. In fact, following a tradition that has been used in other archaeological sites in Europe, trees and vegetation are used to “re­create” the missing ruins or “re­construct” WKHIUDJPHQWHGSLHFHV,QWKLVFDVHWKHURXQGVKDSHRIWKH%\]DQWLQH)RUXPLVFRPSOHWHGZLWKWKHXVHRIF\SUHVVXV trees. These trees, been linear and vertical, do recall the missing columns and do re­create the spatial envelope of the space. 255 5. GREEN AREAS The landscape intervention for Iliria square follows the idea that the present existing hill would “slide” towards the VTXDUHFRQQHFWLQJWKHÀDWDQGHPSW\VXUIDFHRILWZLWKWKHKLOOVLGHWKDWFRQWDLQVVLJQL¿FDQWEXLOGLQJVDQGULFKYHJHWDWLRQ This “geo­morphological” approach, of high visual impact, is compensated by a decision for the vegetation that tends to simplify the area in relationship to the existing conditions. In fact, nowadays, there is a large variety of green spices &HGUXVVS$OEL]]LD-XOLEULVVLQ&KDPDHURSV+XPLOLV3LQXVVSHWF WKDWFUHDWHVDYLVXDOIUDJPHQWDWLRQ The landscape project, on the contrary, intends to give a visual continuity and help in the understanding of this small SRUWLRQRIWKHFLW\RI'XUUHV7KHVHJUHHQDUHDVE\UHGXFLQJWKHQXPEHURIZLOGOLIHRIWUHHVFRXOGDVVXPHDUROHRI valorization in relationship in particular with the archeological component. The main objective of this proposal contem­ plates from one side the clearing of some of the existing trees and from the other side the introduction of few new HYHUJUHHQVSLFHVWKDWKDYHDZHOOGH¿QHGSK\VLRJQRP\7KHWUHHEHFRPHVD³VFXOSWXUDO´HOHPHQWWKDWSRVLWLRQHGHLWKHU DORQHDVDVLQJOHHOHPHQWRULQDJURXSZLOOGH¿QHWKHVN\OLQH7KHVHOHFWLRQRQWKHNLQGRIWUHHVGHULYHVERWKIURPWKH REVHUYDWLRQRIWKHORFDOÀRUDDQGDOVRPDNLQJDUHIHUHQFHWRWKHDUFKDHRORJLFDOSDUNVLQ5RPHWKDWZLWK'XUUHVVKDUHV the presence of remains from the Roman period, as well as for the similar climatic conditions. Our main imagery of reference is the related to the landscape interventions done in the central archeological park of Rome, as they now appear as the results of the planting interventions done during the XIXth century by Giacomo Boni, 5DIIDHOHGH9LFRDQG$QWRQLR0XQR]7KHPDLQHOHPHQWVRIWKHVHSURMHFWVZHUHHYHUJUHHQWUHHV XPEUHOODSLQHV F\SUHVVXVOLYHRDNVHWF FRPELQHGZLWKORZEXVKHVPDGHRIODXUHOP\UWOHDQGER[WUHHV'XULQJWKH\HDUVWKHORZ bushes have disappeared mostly for poor maintenance, with the result of a present imagery austere and “classical”. The SURMHFWDOVRSURSRVHVWKDWLQFRUUHVSRQGHQFHRIWKH%\]DQWLQH)RUXPWKHWUHHVZLOOSOD\WKHLPSRUWDQWUROHRI “underlining”, through a sort of green “anasthilosis”, the traces of the past and thus remembering the positioning of the ORVWFROXPQV2QFHDJDLQWKHWUHHVSOD\DVLJQL¿FDQWUROHIRUJLYLQJDYDOXHRIPHDQLQJWRWKHDUFKDHRORJLFDOSUHVHQFH $57,67,&,17(59(17,2175$&(62)$:$9( Artist: Licia Galizia (OHPHQWVRI6XJJHVWLRQDQG5HÀHFWLRQ ­ The form of the piazza and the nature of its edges: natural and architectural (historical and modern). ­ The opposing nature of its two sides, east and west: from the organic and wavy forms of the one, to the rigorous and linear structure of the architecture of the portico on the other. 7KHSLD]]DDQGLWVYLWDOÀRZVERGLHVLQPRYHPHQWSDXVHVVORZDQGDFFHOHUDWHGUK\WKPVFRQQHFWLRQVWUDQVPLVVLRQV of information, habitual gestures, unusual, repetitive, varying over time, uncontrollable signs, chaos and quiet, etc. ­ Trajectories and Paths Invention & Design The installation is a response to the desire to create an ideal connection between the two opposing sides of the Square. The two edges have a strongly differentiated nature and morphological structure: on the one hand the sinuous and undulating forms of the hill that seems to rest atop the piazza, marking it with curvilinear forms and, on the other, a ORQJSRUWLFRWKDWGH¿QHVDULJRURXVDQGOLQHDUHGJH The artistic­sculptural intervention is thus aimed at: FRQQHFWLQJWKHWZRSDUWV FURVVLQJWKHVHWZRVSDFHVWKHSLD]]DDQGWKHDUFKLWHFWXUDOREMHFW ­ using a sinuous and fragmented sign of nature to contaminate the rigorous and compact architectural object and the space of the piazza. ­ marking a path and a direction using signs on the ground and plastic forms that emerge from it, which can be crossed, inhabited and used for play in the planted area of the piazza ­ using rhythmic, rigid and sinuous sign to invade cross and cut the two facades of the building, in some cases entering inside it. ­ creating a point of communication between the façade of the piazza and the back of the building­portico. Elements and techniques to be used in the construction of the sculptural work: The work is made using sheets of 3 cm. thick cor­ten steel that are set into the stone pavement, and protrude above it. The size of the steel pavers varies, their width oscillating between 20 and 40 cm and their length between 50 and 200 cm. The sheets that project from the ground in the planted area behind the portico also vary in size, in some cases with lengths of more than 2 metres and curves that lift them above the ground between 250 and 300 cm. Along the two facades of the portico, the steel thrusts itself inside the horizontal joints in the stonework, in some cases GH¿QLQJWKHOLPLWVRIWKHRSHQLQJVDQGLQRWKHUVFXWWLQJRUUHVKDSLQJWKHLUSUR¿OHV7KH\SURMHFWLQGLIIHUHQWZD\VIURP the external walls and, in some points, connect with the long sinuous elements that wrap, fold and extend to create curves and volutes that’s gentle or rapid rhythm connects the multiple interior and exterior points of the architectural structure. 257 5.4 Sundials Arch. Christian Coop, Arch. Thoma Papa &RPSOHWH'HVLJQ7HDP6WXDUW:DONHU$QGUHZ:HOOV (;(&87,9(6800(5< :HDUHSURSRVLQJDFRPSOHWHUHPRGHOOLQJRI,OLULD6TXDUHWKHSULQFLSOHSXEOLFVSDFHRIWKHFLW\RI'XUUHVWRSURYLGHD ODUJHÀH[LEOHPXOWLSXUSRVHSXEOLFSLD]]D2XUSURSRVDOUHVROYHVWUDI¿FDQGSHGHVWULDQDFFHVVUHLQIRUFHVKLVWRULFUHIH­ rences and informs the placement of supportive mixed use buildings to provide our vision of a world class city square. .H\GHOLYHUDEOHVLQFOXGHWKHIROORZLQJ 1HZSHGHVWULDQLVHGVTXDUHVTP 1HZDFFHVVWR0RVTXHRULHQWHGWRZDUGVWKH6TXDUH 7KHKLOOVLGHEHWZHHQWKH0RVTXHDQG3UHIHFWXUHUHODQGVFDSHGWRFUHDWHDGGLWLRQDOVHDWLQJVSDFHVDQGSODQWLQJ $QHZWHPSRUDU\H[KLELWLRQVSDFHDQGRSHQDLUFLQHPDFUHDWHG %\]DQWLQH0DUNHWDQG5RPDQ%DWKVUHH[FDYDWHGDQGUHIXUELVKHG ­ Archaeological sites and address buildings opened up to tourism and linked to provide a regionally important DWWUDFWLRQ VTPPL[HGXVHEXLOGLQJVLQFOXGLQJUHWDLOFRPPHUFLDODQGUHVLGHQWLDOXVHV VTPVXSSRUWLYHUHWDLODQGRSHUDWLRQDOEXLOGLQJV ­ Worlds tallest sundial. +,6725,&'(9(/230(17 ,OLULD6TXDUH¿UVWDSSHDUHGDVDQRSHQVSDFHDGMDFHQWWRWKHPDLQJDWHRIWKH2OG&DVWOH,WJUHZIURPWKHLQWHUVHFWLRQ of streets which naturally met at this point. The squares principle use was to host bazaars where rural traders would WUDGHSURGXFHRXWVLGHWKH2WWRPDQ&LW\ZDOOV7KHVTXDUHDOVRVHSDUDWHGDQFLHQW(SLGDPQRVIURP'\UUDK &LW\RIWKH KDUERXU )URPKHUH\RXFRXOGVHHWKH$GULDWLF6HDWKHKDUERXUWKHUDPSDUWVRIWKH&LW\WKH$FURSROLVDQGWKHWZR KLJKHVWSRLQWVRIWKHKLOOV9LODDQG6WDQL ZKHUHWKH7HPSOHRI$WKHQDDQGWKH7RZHURI7KHRGRUH&RPQHQHDUH EHOLHYHGWREHORFDWHG <RXFRXOGVHHWKHDSSURDFKLQJYHVVHOVDQGSUREDEO\WKHVWDUWLQJRIWKHIDPRXV9LD(JQDWLD 5RPDQJDWHZD\WRWKHHDVW 7KH*UHDW*DWHLQWRWKH&LW\RI'\UUDKZDVWKHRULJLQRIWKHVTXDUH,WZDVQRWRQO\ JHRJUDSKLFDOO\VLJQL¿FDQWIRU'XUUHVLWZDVXQLTXHLQLWVLPSRUWDQFHGXULQJWKHWKUHHPLOOHQQLDRIWKHH[LVWHQFHRIWKLV place. Unfortunately the earthquake of 1926 erased this landmark from the City. together with many other buildings ZKLFKJDYHWKH6TXDUHLWVIRUPDQGSXUSRVH7RGD\WKHVTXDUHLVPRVWO\XVHGIRUWUDI¿FDQGSDUNLQJ%RUGHUHGE\ important civic buildings and archeology it remains the most important and visited public space within the City. &21&(37'(9(/230(17 Looking at the issues 7UDI¿FGRPLQDWHVWKHFXUUHQWVTXDUH$PDMRUFRQÀLFWRFFXUVEHWZHHQWUDI¿FDQGSHGHVWULDQPRYHPHQWDWWKH3DODFH RI&XOWXUH$GGLWLRQDOO\HYHQWVWKDWRFFXUDWWKLVORFDWLRQRULHQWDWHSHRSOHWRZDUGWKLVFRQÀLFW0DMRUEXLOGLQJVKDYHDQ informal relationship weakening the squares edges and containment. (On the top left Fig.1) Looking at the city /LQNLQJNH\KLVWRULFDQGLPSRUWDQWVLWHVSUHVHQWVLQWHUHVWLQJUHODWLRQVKLSV7KHWZRKLOOVRI'XUUHV SHUKDSVWKHRULJLQ RIWKHFLW\¶VQDPH SUHVHQWVWURQJYLHZVRIWKHFLW\DVGRHVWKH'\UUDK%RXOHYDUG7KHD[HVSLFNXSPDMRUFXOWXUDODQG historic buildings and boulevards. Tracing the city’s rich past. (On the top left Fig.2) Looking at the square $[HVPHHWDWWKHORFDWLRQRIWKHPDLQJDWHLQWRWKHROGTXDUWHUWKHRULJLQDOVHWWOHPHQWRI'\UUDK+LVWRULFDOO\DOOURDGV led and where focused on the gate which also housed the administrative functions. The roads leading the develop­ PHQWRIPRGHUQ'XUUHV7KHKLVWRULFVWUHHWSDWWHUQGHPRQVWUDWHVWKDWWKLVJDWHZDVWKHNH\GULYHULQWKHGHYHORSPHQW of the square from the original crossroads which characterised the site. (On the top left Fig.3) Pulling it all together %RUURZHGIRUPVDUHXVHGWRXQLI\WKHDUHD7KHRYDOµJDWKHUV¶WKHEXLOGLQJVDURXQGWKHVTXDUHUHVROYLQJJHRPHWULHV Orientation within the square moves southward to the old quarter and appropriately the administrative centre. (On the top left Fig.4) 259 261 MASTERPLAN Culture Garden 5HVWRUHGDUFKDHRORJ\DQGXQGHUJURXQGOLQNEHWZHHQ7KHUPDHDQG%\]DQWLQH0DUNHW *DUGHQVLPSURYHGDQGEURXJKWLQWRJHRPHWU\RIWKHVTXDUH ­ Bordered by tree lined boulevards. The Culture Palace Gardens are a well kept and well used green area within the City. We hope to build on this, reinforcing and extending its identity to include the archeological remains to the north. Access to these facilities would be supported by the Culture Palace which would act as an information point. Both ruins would be connected via an underground link containing a small exhibition explaining the history and context of the archaeology Opening access to the Roman Thermae and Byzantine Market together with suggested improvements would provide a valuable attraction. An attraction would be physically as well as historically linked to the Roman Amphitheatre via the square DQG3DODFHJDUGHQV,PSURYHPHQWVWRWKHJDUGHQVZRXOG,QFOXGHWKHIROORZLQJ 3DWKZD\VWRLPSURYHDFFHVVIROORZLQJWKHJHRPHWU\RIWKHVTXDUHHIIHFWLYHO\µNQLWWLQJ¶WKHJDUGHQZLWKLQWKHVSDFLDO strategy. ­ Extending high quality street furniture throughout. Providing facilities for recycling and for screening current refuse units. ­ Create an ornamental garden utilising attractive mediterranean species to add colour variety and texture. ­ Extension of green areas together with structural planting. Development Area 0L[HGXVHGHYHORSPHQWFRQWDLQLQJFLQHPDUHWDLOFRPPHUFLDODQGUHVLGHQWLDOXVDJH 3URYLGHVOLIHDQGDFWLYLW\WRWKHJURXQGÀRRUDUHDV ­ Parking kept to the rear. Large atria orientated to the sundial Buildings provide a strong edge to the square. $NH\DVSLUDWLRQLVWRSURYLGHIRUPWRWKHVTXDUHVHDVWHUQERXQGDU\H[WHQGLQJWKHVWURQJHGJHIURP'\UDKK%RXOHYDUG WRWKH&LW\+DOO:HKDYHVRXJKWWRUHVROYHWKLVZLWKIRXUEXLOGLQJVRULHQWDWHGWRWKHVTXDUHDQGVXQGLDO7KHIDFDGHV break up the mass and present a vertical expression. Each block rising to reduce the impact of the existing lone tower block which currently dominates the square. Additionally a screen could be erected infront of the tower to provide solar shading and a homogeneous elevation Inkeeping with our approach the buildings are modern and constructed IURPDOLPLWHGSDOOHWWHRIPDWHULDOV)HQHVWUDWLRQLVFODVVLFDOO\SURSRUWLRQHGSURYLGLQJDFLYLFVFDOH Usage 7KHORZHUÀRRUVFRQWDLQUHWDLOOHLVXUHDQGSXEOLFXVHVDQGDUHDFFHVVHGGLUHFWO\IURPWKHVWUHHWSURYLGLQJDFWLYLW\DW JURXQGOHYHO&RPPHUFLDORI¿FHVDQGUHVLGHQWLDODUHORFDWHGDERYHDFFHVVHGYLDWKHDWULXP2SSRUWXQLWLHVWRSURYLGH interaction and life have been exploited. The atrium expressing vertical movement at all levels. Rooftop restaurants will capitalise on the square and views of the sundial Areas Retail/leisure/public ­ 3400m2 Residential ­ 2000m2 &RPPHUFLDORI¿FHP Public Square $SSUR[LPDWHO\WKHVL]HRI3LD]]DGHO&DPSR6LHQQD 2SHQÀH[LEOHSXEOLFVSDFHZLWKQRQREWUXVLYHIHDWXUHV µ*UHHQORJJLD¶FRQWDLQVFDIHDQGIDFLOLWLHV &RQQHFWVDOOPDLQEXLOGLQJVDQGLVWUDI¿FIUHH Water Pools & Landscaping Water pools are situated within the 2pm to 5pm zone as indicated upon the sundial (10 number). Each pool has three PRGHVZKLFKDUHFRQWUROOHGE\DQDXWRPDWHGV\VWHP(PSW\WRIDFLOLWDWHHYHQWV)XOO¿OOHGWRYDULRXVOHYHOVWR SURYLGHDVKDOORZVXUIDFHIRUFKLOGSOD\DQGDGXOWVWRFRROWKHLUIHHW'LVSOD\ZDWHUMHWDQGOLJKWVWRDGGLQWHUHVW and activity (especially at night). Usage 3RROVZLOOSURYLGHDQDWWUDFWLYHDQGXVHIXOIHDWXUH$XWRPDWHGFRQWUROZRXOGDOORZPDQ\GLIIHUHQWFRQ¿JXUDWLRQVWR VXLWRFFDVLRQV7LGDOSRROVVSHFL¿FSRROVZDWHUOHYHOVULVHUHODWLYHWRWKHVXQGLDODQGWKHGD\VKLJKWLGH3URYLGLQJD YLVXDOUHPLQGHURIWKHVHDDQG'XUUHV¶KLVWRU\DVDKDUERXUFLW\ 5HÀHFWLRQSRROV$OOSRROVULVHWRUHÀHFWWKHVN\DQGWKH*QRPRQ Light pools ­ provide ambient low level light throughout the square at night. Empty pools ­ to maximise the available space for large events. Technical considerations 7KHSRROVDUH¿OOHGZLWKFOHDQ¿OWHUHGZDWHUZKLFKLVUHF\FOHGDQGUH¿OWHUHGWRDYRLGDOJDHJURZWKDQGGHSRVLWV:DWHU FRQQHFWLRQVZLOODOORZIRUKRVH¿[LQJVWRMHWFOHDQWKHVTXDUH6\VWHPZLOOH[WHQGWRJUHHQDUHDVWRSURYLGHLUULJDWLRQ ZDWHU+RQHGVXUIDFHVZRXOGSURYLGHJULSWRWKHVLGHVRIWKHSRRO Street Furniture ­ Pavilion The only structure within the square sits at the eastern side providing an eastern edge screening the road and provi­ ding supportive functions for the square. The structure is intended to be lightweight cost effective and easily adaptable 262 263 WRFKDQJH7KHSDYLOLRQLVFRPSRVHGRIWZRHOHPHQWV$VHULHVRIWHPSRUDU\IXQFWLRQDOER[HVWRVXLWSDUWLFXODUQHHGV ZKLFKPD\EHFKDQJHGRUDGDSWHG VHHRSSRVLWH $µORJJLD¶PDGHRIVWHHOPHVKDQGFRYHUHGZLWK,Y\WRSURYLGH shade and security. Openings create walkways through to the mixed use development opposite. Polygonum baldschuanicum or jaminum used as the shading climber would provide differing character through the seasons and fragrance during summer. ­ Sundial Benches 7KHQXPEHUVPDUNLQJDSSUR[LPDWHWLPHRIWKHVXQGLDODUHUDLVHGWRSURYLGHORFDOLVHGµDFWLYLW\¶DUHDVZKHUHSHRSOH PD\PHHWVLWDQGWDON'XULQJWKHGD\WKHVKDGRZZRXOGSDVVRYHUWKH¿JXUHV'XULQJWKHQLJKWWKH\ZRXOGVWDQG illuminated. Construction 6WHHOIUDPHZLWKVWHHOSODWHVXSSRUWSODWHVKH[¿[HGEURQ]HFODGGLQJZLWKUDGLXVHGJHVVWULSOLJKWLQJSURYLGHGE\/(' strip units under mounted to recessed steel frame. Mosque Gardens 7HUUDFHGJDUGHQVHQFRXUDJHVLWWLQJUHOD[LQJDQGZDWFKLQJSHRSOHZLWKLQWKHVTXDUH ­ Links areas to the west. Provides a formal entry to the Mosque. Sundial and Gnomon ­ Memory Line /LQHRIFROOHFWLYHPHPRU\HQYLVDJHGDVDFDOHQGHUIRUVLJQL¿FDQWGDWHVRIWKH&LW\'DWHVPD\EHDGGHGDQGLWLVVXJ­ JHVWHGWKHORFDOFRPPXQLW\FRXOGVXJJHVWGDWHVIRULQFOXVLRQ)RUH[DPSOHZHKDYHLQFOXGHG6XPPHU'D\/LEHUDWLRQ 'D\DQG0RWKHU7HUHVD'D\'DWHVZRXOGEHPDUNHGZLWKLQWKHEURQ]HSDYHPHQWLQOD\WKHVKDGRZIRUWKHVXQGLDO would extend to this mark on the noted day. The cast glass lense would refract light directly on to the polished steel DQGIRUDEULHISHULRGZRXOGFUHDWHDEULJKWOLJKW7KHWLPHRIWKHµPDUNLQJ¶ZRXOGYDU\HYHU\\HDU ­ Gnomon 7KH,OLULDQ6XQGLDORI'\UUDKLXPZDVUHFHQWO\H[FDYDWHGZLWKLQWKHYLFLQLW\RIWRGD\V,OLULD6TXDUH7KHVXQGLDOZKLFK GDWHVIURPQGFHQWXU\$'ZRXOGKDYHEHHQWKHPDLQFORFNRIWKHFLW\DQGLVDVLJQL¿FDQWGLVFRYHU\,WVGHVLJQKDV LQIRUPHGRXUDSSURDFKWRWKHQHZVXQGLDO+RXUO\]RQHVLQGLFDWHVKDGHGDUHDVIRUHDFKKRXU7KHKRXUO\OLQHLVWDNHQ as a mean of each zone. Shadow will move 5­10mm per second depending on the time and month. Shadow will start at 11am on the mosque and complete at 6pm on the clock tower. Times correspond with noon (zhuhr), Afternoon (Asr), Sunset (Maghrib) and Evening (Eshaa) muslim prayer times (note indicative only). The base taper acts as a Analemma Sundial providing month and time information. An accurate plot can be found opposite. ­ Landscaped Terraces Improving accessibility across and to the square has been a driving consideration. The proposal provides clear legible access to the Mosque and the Gnomon from both the North West / East areas. Increasing the permeability and enjoy­ ment of the existing Mosque gardens. The new steps work with the existing levels and planting to retain the important trees, as well as providing new accessible green terraces. providing welcome resting / picnic areas overlooking the square. The steps bring in the defensive wall creating an exhibition garden to the south neighbouring the Roman Amphitheatre. Temporary exhibition boards can be mounted upon the steps in conjunction with events held in the Amphitheatre. Geometry of both the sundial and oval motif ties in the mosque with the square and Gnomon. Creating DXQL¿HGSURSRVDO /$1'6&$3,1*$&&(66DQG'(/,9(5< Mosque Gardens A new terraced Amphitheatre providing an appropriate setting for the mosque and connecting the hillside with square. ,QWHQWLRQV ,PSURYHVDFFHVVWRWKHZHVWWKH5RPDQ$PSKLWKHDWUHDQGWKHPRVTXHIDFLOLWLHV7HUUDFHVSURYLGHVKDGHGVHD­ WLQJDUHDVWRYLHZDFWLYLWLHVZLWKLQWKHVTXDUH5HWDLQVH[LVWLQJSODQWLQJ Main Square 0DLQSXEOLFVTXDUHRIWKHFLW\2SHQDQGÀH[LEOHWRDFFRPPRGDWHHYHQWVRUJDWKHULQJ,QWHQWLRQV P[PRSHQSHGHVWULDQVSDFHFRPSDUDEOHLQVL]HWR3LD]]DGHO&DPSR6LHQQD6XSSRUWHGE\UHWDLODQG historic pedestrian area of the old district, 3.Activated by none obtrusive sundial shadow and water pools. Culture Gardens ([LVWLQJJDUGHQH[WHQGHGDQGUHLQIRUFHGZLWKSHGHVWULDQ]RQHVWRHLWKHUVLGH,QWHQWLRQV ,PSURYHIDFLOLWLHVIRUDUFKHRORJ\0DLQJUHHQDUHDRIWKHVTXDUHZLWKDVRXWKHUO\DVSHFW Sundial 0DLQIRFXVDQGWKHFLWLHVQHZLFRQ6TXDUHGHVLJQHGWRIDFLOLWDWHµWKHZDON¶DVDFXOWXUDOHYHQWLQ'XUUHVSURYLGLQJD safe and attractive route. A new archaeological walk connecting the Roman Market and Amphitheatre via the Mosque Gardens. Connection between Roman Market and Theame created. Linked to the Cultural Palace where additional facilities would be located. Scheme supports future developments including access to historic walls / acropolisand refurbishment of the Roman Amphitheatre. New structures are lightly founded to avoid damage to any archaeology. 3HGHVWULDQDUHDH[WHQGHGWRHQFRPSDVVPDMRUIHDWXUHVRIWKHVTXDUHDQGLWVHQYLURQV7UDI¿FDFFHVVPDLQWDLQHGDQG rerouted around the periphery of the square creating a major open public space. Shared surface policy adopted 264 UHGXFLQJWUDI¿FVSHHG7UDI¿FFURVVLQJSRLQWVFUHDWHGDWEXV\LQWHUVHFWLRQV3DUNLQJPDLQWDLQHGRXWVLGHVTXDUH FRQWUROOHGDFFHVVWRWKHFRXQFLORI¿FHV$FWXDOWUDI¿FURXWHWREHXVHGRQO\DWOLPLWHGDFFHVVHPHUJHQF\GHOLYHU\DQG GLIIHUHQWWLPHVRIWKH\HDU$OOQHZIHDWXUHVDYRLGH[LVWLQJVHUYLFHV+9FDEOHPDLQWDLQHGXQDOWHUHG/LJKWLQJJHQHUDOO\ ORZOHYHOVRQRWWRGLPLQLVKWKHLPSDFWRIWKHVSLUH7UDI¿FDUHDVLOOXPLQDWHGE\ÀRRUZDVKHUVRULHQWDWHGWRZDUGWKH VTXDUH6WHSVDQGSHGHVWULDQDUHDVOLWE\ÀRRUXPLQDLUHV)HDWXUHEXLOGLQJVDQGVSLUHVXEMHFWWRGHWDLOHGOXPLQDLUH design. Water features supplied by 4 main shallow pipes controlled electronically from the town hall. All services are designed to be shallow as not to disturb potential archaeology. Phase 1. 'HOLYHUVPDMRUHOHPHQWVRIWKHSXEOLFVTXDUHDWDUHGXFHGEXGJHWLQFOXGLQJWKHVXQGLDOVTXDUHFDQRS\DQGZDWHU IHDWXUHV7LPHFRQVXPLQJDFWLYLWLHVVXFKDVH[FDYDWLRQDQGODQGVFDSHUHPRGHOOLQJDUHDYRLGHG5HSUHVHQWVRI the budget. Phase 2. Completion of landscaped / archeology works. Extend the periphery of the square linking archeological areas and LPSURYLQJWKHLUVHWWLQJ5HSUHVHQWVRIWKHEXGJHW Phase 3. 'HYHORSPHQWRIWKHPL[HGXVHTXDUWHUDQGODQGVFDSLQJ3ULYDWHEXGJHW COSTS Our cost plan is shown opposite. Costs are shown for the entire build as outlined within this document together with a UHGXFHGEXGJHWIRUXQGHUWDNLQJSKDVHRQO\3OHDVHQRWHWKHIROORZLQJ &RVWVDUHLQGLFDWLYHDQGDUHUHSUHVHQWDWLYHRI8.EXLOGLQJUDWHVDWWKHLUFXUUHQWOHYHO3ULFHVH[FOXGHUHJLRQDOWD[HV DQGLQÀDWLRQ'HWDLOHGFRVWVSODQVXEMHFWWRIXUWKHULQYHVWLJDWLRQVDQGGHVLJQZRUN,QWHUIDFHZLWKSULYDWHGHYHORS­ ments including structures, landscaping and utilities considered outside the scope of this report. Prices do not include design fees for by the design team or by contractor/subcontractors. 6867$,1$%,/,7<67$7(0(17 Sustainability Achieving the most sustainable development when given a range of choices is an aim of all involved in the design SURFHVV.H\IDFWRUVLQFOXGHORFDWLRQODQGXVHWUDQVSRUWFKRLFHEXLOGLQJGHVLJQFRQVWUXFWLRQDQGEXLOGLQJXVH/LULD Square meets overarching key aims by recycling previously developed land that is situated in a location that already EHQH¿WVIURPORFDOIDFLOLWLHVDQGWUDQVSRUWFKRLFHV7RPD[LPLVHWKHVHDGYDQWDJHVWKHSURSRVDODWWHPSWVWRGHWHUPLQH the “best use” of the land resource. In relation to other key facilities the Project Team is committed to pursuing the following: 1. Seeking to maximise architectural value whilst minimising environmental harm. 2. Promotes a life cycle approach to the design and construction of buildings and their components which does not endanger environmental or personal health, and which respects biodiversity, inter­generational responsibility and social equity. 7KHPLQLPLVDWLRQRISROOXWLRQDQGUHVRXUFHGHSOHWLRQLQDOOIRUPV7KHSURPRWLRQRILQWHUJHQHUDWLRQDOUHVSRQVLELOLW\ DZDUHQHVVRIVRFLDOHTXLW\DQGSUHVHUYDWLRQRIELRGLYHUVLW\7KHPDLQWHQDQFHDQGHQKDQFHPHQWRIHQYLURQPHQWDO quality. 4. To promote actions which address the above issues and endeavour to make maximum design intervention towards the aim of environmental accountability. In particular: ,PSURYHEULH¿QJWRLQFOXGHDQHQYLURQPHQWDOO\VRXQGDSSURDFKIURPWKHRXWVHWRISURMHFWV :RUNLQJZLWKRWKHUGLVFLSOLQHVIURPDQHDUO\VWDJHWRHQFRPSDVVGHVLJQDQGPDQDJHPHQWDVSHFWV ­ Encourage a life­cycle approach to design, including environmental costing from inception, reuse and adaptation. ­ Maximise opportunities presented by the adopted masterplan and associated land use and transport policies. ,QWKHGHYHORSPHQWRIWKHSURSRVDOVZHKDYHEHHQPLQGIXORIHQYLURQPHQWDODQGVXVWDLQDEOHRSSRUWXQLWLHV.H\ EHQH¿WVLQFOXGH (PSOR\PHQWXVHVLWXDWHGZLWKLQUHVLGHQWLDOPL[HGXVHDUHDVZLOOOLPLWFDUMRXUQH\V 5HXVHRIDSUHYLRXVO\GHYHORSHGVLWH ­ Building to be constructed of locally sourced materials by local contractors, Limiting transportation costs and asso­ FLDWHGFDUERQ +LJKTXDOLW\QDWXUDOPDWHULDOVZLOOKDYHDORZHPERGLHGHQHUJ\DUHUREXVWDQGZLOOODVWIRUJHQHUDWLRQV 1DWXUDOYHQWLODWLRQZLOOPDVVLYHO\UHGXFHHQHUJ\GHPDQGV 3URPRWHORZFDUERQSHGHVWULDQDQGF\FOLQJRYHUFDUXVH $GGLWLRQDOWUHHSODQLQJZLOOKHOSDEVRUE&2 ­ Lighting, services and sundial will be low energy and utilise solar power. CONCLUSION An icon for an emerging city...... :HKDYHHQGHDYRXUHGWRFUHDWHDQHZKHDUWWKDWUHVSHFWVDQGXQL¿HVDOOWKHKLVWRULFDOUHOLJLRXVDQGFXOWXUDOHOH­ ments of the City. ­ The new vibrant piazza will bring a grandeur to the city and become a focal point for the towns activities that will in turn stimulate growth. ­ The Worlds Largest Sundial will become an icon for this emerging country and City, and will attract tourism and investment to the local economy. ­ This scheme has employed local people in its design, and its simplicity of construction will ensure that it uses local people and materials in its execution. 267 268 5.5 Folding Arch. Michele Cro’ 'HVLJQ7HDP/DQGVFDSH$JU$ODLQ(QQLR$VFDUHOOL $UFKDHRORJLVW0+HOHQD0DUFKHWWL$UFK$OEHUWR&UR¶ /¶$0%,72',,17(59(172 La storia della Piazza ci consegna oggi uno spazio ancora incompiuto, soprattutto sul versante orientale, e tuttavia particolarmente denso di memorie e di storie, oltreché di presenze di rilevanza urbana e monumentale. Tutte le funzioni urbane principali si affacciano sulla piazza – la Sede Municipale, la Moschea Grande, il Palazzo della Cultura, la Prefettura – e tutti i principali monumenti storici della città sono a diretto contatto con essa, o distano dalla SLD]]DGLVWDQ]HDVVLPRGHVWHÊLOFDVRGHOFLWDWRJUDQGHDQ¿WHDWURURPDQRGDFXLVLDFFHGHSHUXQDVFDOLQDWD FKHSDUWHSURSULRGDOVXRYHUWLFH6XGRFFLGHQWDOHGLFLzFKHULPDQHLQVLWXGHOOHPXUDRWWRPDQH GLFXLVDUHEEHLQWH­ ressante ricostruire almeno la giacitura della Grande Porta, precedentemente citata), che anticipano il Castello, a cui risale proprio seguendone il tracciato, scomparso sul lato della Piazza (ne restano solo poche tracce a sinistra del Pa­ OD]]R&RPXQDOHQRWHFRPH³ODWRUUHGHOO¶RURORJLR´ PDFKHSRLULDFTXLVWDFRQVLVWHQ]DPRQXPHQWDOHROWUHLOFRQ¿QH GHOODSLD]]D(SRLDQFRUDLO)RUR%L]DQWLQRDOOHVSDOOHGHO3DOD]]RGHOOD&XOWXUDHGDOO¶DOWUDSDUWHYHUVRLOSRUWROXQJR O¶DWWXDOHFRUVRSULQFLSDOHJLjYLDGHO&RPPHUFLRO¶DQWLFR+DPPDQODJUDQGH7RUUH9HQH]LDQDHGLQXRYROHPXUD± JLjURPDQHIRUVHHOOHQLVWLFKHSRLEL]DQWLQHHRWWRPDQHFKHFKLXGRQROD&LWWj9HFFKLDGLFXL3LD]]D/LULDFRVWLWXLVFH oggi il cuore. La piazza appare oggi come un grande spazio, frammentato, denso e incompiuto, forse anche incom­ pleto, rispetto alla necessità di funzioni che oggi si chiedono ad una grande piazza contemporanea: spazio progettato dalla Storia, sia pure attraverso un percorso non lineare, ed in attesa, oggi, di un nuovo progetto, che ne valorizzi le identità passate attraverso l’invenzione creativa di una nuova immagine, di un nuovo paesaggio urbano. 7232*5$),$3$(6$**,2$0%,(17(',5,)(5,0(172 /¶DUHDVLSUHVHQWDVRVWDQ]LDOPHQWHLQSLDQRWUDQQHFKHSHULOVXRODWRRFFLGHQWDOHLQOHJJHURGHFOLYLR'DWDOHERUGR SDUWHLQIDWWLODULVDOLWDGHOIURQWHFROOLQDUHFKHSRLFRQGXFHDOODTXRWDPDJJLRUHSDUWHGHO3URPRQWRULR'XUD]]LDQRFKH presenta quote maggiori nello sviluppo del sistema collinare a Nord. Tale fronte si caratterizza per la presenza di una discreta copertura vegetale, formata da essenze tipiche del luogo, caratteristiche del paesaggio costiero mediterraneo. /DSLD]]DSUHVHQWDDQFKHDOVXRLQWHUQRXQDPRGHVWDFRSHUWXUDDUERUHD,ERUGLGHOOHVWUDGHVRQRRUQDWLGD¿ODULGL ligustri e da lecci e da altre specie vegetali arboree endemiche. Attorno al Palazzo della Cultura è presente una vegetazione fatta di siepi ornamentali (allori, pitosfori, ligustri, altre essenze) e alcuni alberi ad alto fusto (in prevalenza lecci). La Piazza e’ inoltre suddivisa in due da un ampio spazio ombreggiato da alcuni alti cedri del Libano, in buone condizioni vegetative. In relazione al proprio patrimonio vegetale, la piazza svolge anche un potenziale ruolo di riconnessione ecologica WUDOHSHQGLFLFROOLQDULVXFXLULVDOHODFLWWjYHUVRHVWHLTXDUWLHULFKHRFFXSDQRODSLDQDDOOXYLRQDOH¿QRDOEDFLQR portuale e alla fascia costiera, un tempo RFFXSDWDGDXQDÀRULGDSLQHWDFKHPHULWHUHEEHGLHVVHUHLQTXDOFKHPRGRULSULVWLQDWD SCELTE PROGETTUALI /¶LQWHUYHQWRVYLOXSSDWRQHOSURJHWWRJHQHUDOHVLSRQHLQWRWDOHVLQWRQLDFRQWXWWLLSULQFLSDOLRELHWWLYLGH¿QLWLGDOO¶$PPLQL­ VWUD]LRQHQHOOR6WUXPHQWRGLSLDQL¿FD]LRQHXUEDQLVWLFDFRPXQDOHHQHJOL$WWLGHO%DQGRGHO&RQFRUVRGL3URJHWWD]LRQH e tutti I suoi elementi, essendo informati al totale rispetto delle compatibilità ambientali del contesto paesaggistico DOODUJDWRVRQR¿QDOL]]DWLDGXQJOREDOHLQWHUYHQWRGLULTXDOL¿FD]LRQHXUEDQLVWLFDGHOOD3LD]]D,OLULDHLOVXRDPELWRFLUFR­ stante. La suddivisione in fasi dell’intervento corrisponde perfettamente alle principali scelte messe in atto nel progetto SHUULTXDOL¿FDUHHFRQ¿JXUDUHO¶LQWHUDDUHD 5LTXDOL¿FD]LRQHGHOIURQWHRYHVW³LOEHOYHGHUH´ La sua costituzione e ruolo tra spunto dall’idea dei portici sviluppata nel piano del ’42 per il fronte opposto e che pure YLHQHFRQIHUPDWD6LWUDWWDLQIDWWLGLXQ¶DPSLDWHUUD]]DSURVSLFLHQWHODPRVFKHDFKHUHWWL¿FDLOIURQWHGHOODSLD]]DH riordina i giardini alla base del promontorio durazziano. Il suo carattere è solo apparentemente contraddittorio marca con forza il lato occidentale della piazza ma la sua sporgenza sottile rimanda al fronte opposto e allude al mare. Al livello della piazza la differenza di quota, di circa 3.50 metri consente di ospitare attrezzature pubbliche per il turismo, e/o culturali­museali. Intorno alla moschea vengono riordinati i giardini che degradano con forme naturalistiche verso l’ambia pavimentazione della terrazza. ­ Sistemazione e arredo della piazza e nuova viabilità. Partito centrale di tutta la composizione, questo spazio assolve il complesso compito di far coincidere, le tre differenti 269 istanze della Piazza ( sosta­ percorso­monumento) delineate nel corso del progetto anche ad interpretazione sintetica GHOOHULFKLHVWHGHOEDQGRHGLQVHQVRSLDPSLRGHOFRQFHWWRGLSLD]]DFRQWHPSRUDQHD/¶LGHDDPELYDOHQWHFKHXQD SLD]]DqVLDXQOXRJRGLLQFRQWURHGLVRVWDHVLDGLSDVVDJJLRHGLVHSDUD]LRQHKDLQÀXHQ]DWRO¶LQWHUDFRQFH]LRQHGHO progetto artistico ed architettonico. L’inserimento a motivo di tassello, della scultura di Nunzio (Senza Titolo) esteso nella pavimentazione della piazza ha, così, permesso di salvaguardare una tale ambivalenza, in quanto vera ricchez­ za del progetto. Si offre come luogo dello stare, spazio privilegiato ma al contempo contaminato da tutti gli accessori necessari che rendono confortevole e sicuro uno spazio pubblico, alberi, panchine, illuminazione, arredo, etc. La scultura orizzontale, inserita nella pavimentazione, delimita, uno spazio ideale, esplicitando una presenza senza UHQGHUODPDQLIHVWDPHQWHHYLGHQWHRUHWRULFDFRQVHQWHQGRODWRWDOHIUXL]LRQHGHOODVXSHU¿FLH /DYLDELOLWjYLHQHRUJDQL]]DWDLQOLQHDDOOHLQGLFD]LRQLGHOO¶DWWXDOH3LDQR5HJRODWRUHPDGLIIHUHQ]LDQGROHVXSHU¿FLGL ¿QLWXUDGHOOHVHGLVWUDGDOLFKHLQYDGRQRODSLD]]D VXOODWRQRUG SULYLOHJLDQGRQHO¶XVRSHGRQDOHHLQFDQDODQGRLOÀXVVR attraverso l’uso di dispositivi dissuasori. Così come anche le altre percorrenze secondarie, di servizio e pista ciclabile, si stabiliscono sullo stesso basolato della piazza, senza che ulteriori segni ne contaminino l’unitarietà. ,QWHJUDWDFRQLOWUDI¿FRHDUPRQL]]DWDQHOQXRYRFRQWHVWRXUEDQRODSLD]]DVLSRQHFRPHQXRYDJHRJUD¿DGDOFDUDWWH­ re unitario in grado di esprimere un valore di riconoscibilità alto, necessario ad uno spazio così disperso per costituirsi in luogo metropolitano. ­ Nuovo assetto delle aree archeologiche. La creazione di un parco archeologico alle spalle del Palazzo della Cultura che comprende oltre l’antico Macellum DQFKHOHWHUPHURPDQHULDI¿RUDWHGXUDQWHODFRVWUX]LRQHGHO3DOD]]RVWHVVRQRQFKqODULTXDOL¿FD]LRQHGHOOHDOWUH WHVWLPRQLDQ]HSXQWXDOLDLERUGLGHOOD3LD]]D9DORUL]]DUHLOSDWULPRQLRVLJQL¿FDWUDGXUORLQOXRJKLUHDOLDGDOWDJRGLELOLWj renderli partecipi dell’attività pubblica della città e dei suoi spazi. In questo senso nel nostro progetto tutti gli antichi siti sono stati messi a sistema, non solo trà di loro accorpando ed ampliando le aree archeologiche, ma anche ricreando ambienti che attraverso il sistema del verde, dell’acqua o dell’arredo urbano in modo da conferire a questi spazi il VLJQL¿FDWRGLOXRJKLB'DOSXQWRGLYLVWDDUFKLWHWWRQLFRLOSURJHWWRULGRQDXQLIRUPLWjHRPRJHQHLWjDWXWWDODSLD]]DDWWUD­ verso la sua totale pedonalizzazione, collegando attraverso itinerari ideali e percorsi attuati tutte le evidenze archeo­ ORJLFKHFKHODFLUFRQGDQRHQHIDQQRSDUWH GLHSRFDURPDQDPDUJLQHQRUGPHUFDWRFLUFRODUHPDUJLQHVXGDQ¿WHDWUR mura bizantine, faro, foro etc.) che prima risultavano totalmente avulse dal contesto in cui si trovavano. /DSLD]]DDOOHJJHULWDFRVuGDOWUDI¿FRDXWRPRELOLVWLFRULDFTXLVWDODSURSULDFHQWUDOLWjDWWUDYHUVRHVRSUDWWXWWRODULTXDOL­ ¿FD]LRQHGHOSURSULRUXRORVWRULFRHODYDORUL]]D]LRQHGHOSDWULPRQLRFXOWXUDOHHGDUFKHRORJLFRFKHGLYHQWD¿QDOPHQWH fruibile al pubblico. ­ Il sistema del verde A questa operazione generale, condotta articolando spazialmente il piano base della piazza,che avvolge anche i giar­ dini intorno al Palazzo della Cultura si sovrappone la sistemazione del verde. Il sistema del verde assume in modo SLHYLGHQWHLOUXRORGLULFRQQHVVLRQHHFRORJLFDWUjOHSHQGLFLFROOLQDULDGHVWHLTXDUWLHULFKHRFFXSDQRORVSD]LR¿QR al bacino portuale ed alla fascia costiera. Un principale gruppo ordinato di alberi, attraversano i tasselli della scultura di Nunzio segnando una fascia orientata verso il mare e fornisce il maggior ombreggiamento della piazza. Le albe­ UDWXUHSLSRVVHQWLGLIURQWHDOUHFHQWLVVLPRLQWHUYHQWRHGLOL]LRDFFDQWRDOSDOD]]RFRPXQDOHQHPLWLJDO¶LPSDWWRHLQ parte ne occulta la visuale. A questo si aggiungono gruppi sparsi di alberi che sottolineano la sosta e il ristoro. Tracciando la nuova viabilità sul versante orientale si determina un resto urbano dalla forma variamente articolata sui IURQWLHVLVWHQWLODFXLVROX]LRQHVDUjDI¿GDWDDOODVLVWHPD]LRQHGLXQD¿WWDYHJHWD]LRQHGDOODGHQVLWjTXDVLERVFRVD anche a mitigare la presenza della spropositata torre residenziale al lato della Sede Municipale. Il fronte orientale GLYHQWDXQIURQWHYHUGHGDFXLqLSRWL]]DELOHWUDFFLDUHXQVLVWHPHGL¿ODULDOEHUDWLFKHDWWUDYHUVDQGRLTXDUWLHULLQWHU­ PHGLUDJJLXQJDQRODOLQHDGLFRVWD$QFKHO¶DFFHVVRDO3DOD]]RGHOOD&XOWXUDYLHQHPRGL¿FDWRULGXFHQGROHVFDOLQDWH d’ingresso e organizzando un nuovo giardino laterale, riportandolo ad una relazione di partità con la città. '(6&5,=,21('(/352*(772 Come precedentemente accennato, per esigenze gestionali dell’amministrazione la realizzazione dell’intervento sarà temporalizzata in tre fasi, ognuna delle quali è stata studiata in modo da poter essere attuata in autonomia rispetto a quella successiva. 5LTXDOLÀFD]LRQHGHOIURQWHRYHVW´LOEHOYHGHUHµ Cronologicamente è la prima parte del complesso di opere che viene realizzata. È strutturata su due livelli per un’estensione complessiva di circa 3700 mq, lascia inalterata la funzionalità attuale della piazza. Infatti lo sbancamen­ to preventivo eseguito alle pendici del promontorio, è molto arretrato rispetto alla attuale viabilità e si estende da sud YHUVRQRUGGDOOHPXUDRWWRPDQHVLQRDOO¶HGL¿FLRGHOOD3UHIHWWXUD6XFFHVVLYDPHQWH4XHVWRIURQWHVDUjRFFXSDWRGD una serie di episodi urbani allineati sul fronte stradale. Una prima gradinata che in corrispondenza delle mura serve l’ambito storico­naturalistico del promontorio e mette in collegamento con il “parco delle mura bizantine”. In questa SRU]LRQHWUDODQXRYDDUHDSDYLPHQWDWDDOODTXRWDVXSHULRUHHLOERVFRYLHQHULTXDOL¿FDWRLOSLFFRORPDVWUDWHJLFR ambito attualmente segnato da un bar che seppur di scarso pregio architettonico è molto frequentato dato il particola­ UHSUHJLRGHOOXRJR6LSURSRQHODULFRVWUX]LRQHGHOORVWHVVRVHFRQGRFULWHULDUFKLWHWWRQLFLSLDJJLRUQDWLVHSDUDQGROR ¿VLFDPHQWHGDOOHPXUDULGDQGRFRVuFRQWLQXLWjDOOHVWHVVH6LWUDWWDLQIDWWLGLXQDSLFFRODDUFKLWHWWXUDPROWRWUDVSD­ rente realizzata in acciaio, completamente vetrata e contornata da alberi. In posizione laterale, non distante, viene LQWURGRWWDXQ¶RSHUDG¶DUWHSHUORSLRUL]]RQWDOHDOOXVLYDGHOODVRVWDLQIRUPDGLFDUDWWHUHLOSRVWRHORWUDGXFHLQOXRJR )RUPDWDGDXQDVHULHGLSDUDOOHOHSLSHGLGLVSRVWLVXXQDSLDQWDTXDGUDWDVLHOHYDQRLQDOWH]]DGDDFPHOHFXL VXSHU¿FLYHUVRLOFLHORVRQRGHFRUDWHLQPRVDLFRDGLVHJQR HVHJXLWRGDOO¶DUWLVWD1XQ]LRGL6WHIDQR /DSDUWHFHQWUDOH del fronte, esteso nella dimensione della moschea, è risolto da una pensilina che al piano inferiore libera una serie di locali utili per attività culturali, mussali e ricettive, il cui fronte si offre alla piazza attraverso una cancellala in acciaio, FRQ¿QLWXUDDGRWWRQHFKHULHGLWDXQPRWLYRPRUHVFR/DSDUWHVXSHULRUHOLEHUDXQ¶DPSLDWHUUD]]DSDYLPHQWDWDLQ pietra di trani con ricorsi in travertino, dalla quale si gode un’ampia visuale della piazza sottostante. Il parapetto 272 273 UHDOL]]DWRLQFULVWDOORVWUDWL¿FDWRDPSOL¿FDODYLVLRQH6XOODWRGHOOD3UHIHWWXUDXQDVHFRQGDVFDOLQDWDSLDPSLD DQFK¶HVVD¿QLWDLQSLHWUDULFKLXGHDQRUGLORFDOLVRWWRVWDQWLHFRQ¿JXUDXQRVSD]LRGLVRVWDVRVSHVRWUDODSLD]]DHLO promontorio. Lo spazio complessivamente è arredato con panche monolitiche di travertino, lampioni in acciaio dalla colorazione dorata dell’ottone, sistemi illuminanti segnapasso e gruppi di paletti illuminanti che la sera costituiscono XQULIHULPHQWRYLVLYRSHULSDVVDQWLFKHVLRULHQWDQRYHUVRLOXRJKLSLVLJQL¿FDWLYL6RQRVWDWLDOWUHVuSUHGLVSRVWLGHL VLVWHPLLOOXPLQDQWLDGLQFDVVRQHOODWHUUDSHUO¶LOOXPLQD]LRQLRQHVFHQRJUD¿FDGHJOLDOEHULHGHOOHVLHSL/¶LQWHURVLVWHPD è allineato all’attuale posizione del marciapiede esistente. 2. Sistemazione e arredo della piazza e nuova viabilità. L’area è estesa per circa 11.000 mq, dal Palazzo della Cultura al Palazzo Comunale nella direzione nord–sud e nel senso trasversale, dalla moschea si inclina di circa mezzo metro verso un fronte edilizio variegato. Parzialmente riordinato dall’introduzione della pensilina a terrazza. La forma scultorea (disegnata in collaborazione con l’artista), XQEDVVRULOLHYRGLVWHVRQHOFHQWURGHOO¶LQWHUDVXSHU¿FLHUDFFRUGDOHGLIIHUHQ]HGLOLYHOORJHQHUDQGRGHOOHLQFLVLRQLFKH formano delle panche e zone concave vasche d’acqua dalla funzione decorativa e microclimatica. Realizzata in RSHUDGLFHPHQWRDYLVWDFRQXQD¿QLWXUDDQWLVGUXFFLRORWXWWLJOLVSLJROLHLJLXQWLVWUXWWXUDOLVRQRGLRWWRQH8QDGHOOH vasche invece, curata personalmente dall’artista sarà rivestita in lamina di rame e successivamente stagnata a mano, VHFRQGRO¶DQWLFDDUWHGHOODVWDJQDWXUD,OERUGRGHOOHYDVFKHqVRWWROLQHDWRGDFDGLWRLHOLQHDULSHUORV¿RURGHOO¶DFTXD PHQWUHDWHUUDVDUDQQRSUHGLVSRVWHFDGLWRLHDGKRFVHPSUHLQFHPHQWRGLSDUL¿QLWXUD7XWWDO¶DUHDRFFXSDWDGD questo “bassorilievo” è attraversata da vialetti trasversali, organizzati con panche in travertino, lampioni di illuminazio­ QHSXEEOLFDDOEHUDWXUHHUHODWLYDLOOXPLQD]LRQHFHVWLQLSRUWDUL¿XWLHFFOHVXSHU¿FLGLTXHVWLVHJPHQWLVRQRVRWWROLQHDWL SHUGLIIHUHQWH¿QLWXUDLQJKLDLDVWDELOL]]DWDQHOOH]RQHGLSHUFRUUHQ]DHVRVWD LYLDOHWWL HFRQJULJOLDWLG¶DFFLDLRHWHUUD VXOODWRGHOOHSLDQWXPD]LRQLDUERUHH9HUVRODWHUUD]]DDRYHVWXQ¶DPSLDIDVFLDUHDOL]]DWDLQFHPHQWRDYLVWDFRORUDWR scuro sottolinea la conclusione dell’opera e il passaggio della strada di servizio che continua verso il corso e in ultimo DOPDUH/DWHUDOPHQWHDOO¶RSHUDOHVXSHU¿FLVRQRSDYLPHQWDWHSULQFLSDOPHQWHLQSLHWUDGLWUDQLPRQWDWDDFRUUHUHPDLQ alcuni episodi il disegno di questa è articolato con l’introduzione di fasce in travertino. Sul lato del Palazzo Comunale un’ampia panca, realizzata di muratura e successivamente rivestita in travertino, ne sottolinea la presenza che di VHUDqUHVDDQFKHSLLQWHQVDGDOODSUHVHQ]DGLXQ¶LOOXPLQD]LRQHVFHQRJUD¿FDGHOODIDFFLDWDFRQODPSDGHLQFDVVDWH nel pavimento. Lo spazio antistante la sede Comunale è recintato da paletti dissuasori che “privatizzano” la viabilità di servizio e rappresentanza di accesso al Comune. Ampie aiuole sul lato orientale ospitano gruppi di cedri cono lo scopo di ridurre e mitigare, per quanto possibile, la presenza incombente del palazzo residenziale antistante, di UHFHQWHFRVWUX]LRQH6XOODWRGHO3DOD]]RGHOOD&XOWXUDSHUGDUHPDJJLRUHULVDOWRDOODVXSHU¿FLHGHOODSLD]]DHDOODVXD continuità, è stato ridotto il salto di quota attuale al piano di accesso, con conseguente riduzione della gradinata e JXDGDJQRGLVSD]LRGLULVSHWWR/DQXRYDYLDELOLWjVXTXHVWRODWRqRUGLQDWDDOODVWHVVDTXRWDGHOODSLD]]D¿QLWDQHOOR stesso modo, in pietra di trani (di spessore superiore) sottolineata solo dalla presenza di fasce in travertino a terra e dei paletti dissuasori in acciaio. Il sistema della viabilità, raccoglie le istanze indicate nel nuovo PRG ma in corri­ spondezza della piazza (fronte nord e est) le strade salgono al livello della piazza con conseguente limitazione della YHORFLWjGLSHUFRUUHQ]D6HQHRWWLHQHXQVLVWHPDFKHSULYLOHJLDO¶XVRSHGRQDOHGHOODVXSHU¿FLHDYDQWDJJLRGLWXWWHOH categorie di fruitori anche meno abili, bambini, anziani e disabili. Così senza perdere l’opzione dell’attraversamento si ottiene uno spazio complesso ma sicuro, libero da impedimenti dove la gente si riappropria della città. Le pavimen­ tazioni delle strade sono realizzate in pietra di trani, con basole di spessore superiore (6cm) e le rampe di accesso carrabile sono in cemento colorato stampato a righe, agisce come segnalatore sonoro di attraversamento invitando DULGXUUHODYHORFLWj*OLHOHPHQWLGL¿QLWXUDVRQRVWDWLVWXGLDWLDGKRFOHFDGLWRLHVRQR¿QLWHLQSLHWUDGLWUDQLIRUDWDDOOD sega nelle direzioni del montaggio del pavimento, le panche sono di tipo monolitico realizzate in travertino, i lampioni in acciaio dalla colorazione dorata dell’ottone, sistemi illuminanti segnapasso e gruppi di paletti illuminanti che la sera FRVWLWXLVFRQRXQULIHULPHQWRYLVLYRSHULSDVVDQWLFKHVLRULHQWDQRYHUVRLOXRJKLSLVLJQL¿FDWLYL 6RQRVWDWLDOWUHVuSUHGLVSRVWLGHLVLVWHPLLOOXPLQDQWLDGLQFDVVRQHOODWHUUDSHUO¶LOOXPLQD]LRQLRQHVFHQRJUD¿FDGHJOL alberi e delle siepi e delle facciate dei palazzi importanti. Sul fronte orientale, unico elemento emergente, è la pensi­ lina lineare calpestabile. Come accennato questo elemento compositivo trae spunto da certe indicazioni contenute QHO35*GHO¶FKHSUHYHGHYDQRVXTXHVWRIURQWHODUHDOL]]D]LRQHGLXQHGL¿FLROLQHDUHSRUWLFDWR6HQHSURSRQHLQ questo progetto una versione alleggerita ma che svolge lo stesso ruolo di geometrizzazione del fronte, con la differen­ za che il piano superiore è calpestabile e si offre alla piazza come un’ulteriore terrazza, contrapposta a quella della Moschea, servita da un piccolo punto di ristoro, un luogo privilegiato dal quale godere la vita che si svolge in piazza, e al piano inferiore dotata di un infopont per l’orientamento dei turisti e il ristoro durante la stagione estiva, visto l’ampia VXSHU¿FLHRPEUHJJLDWD5HDOL]]DWDLQDFFLDLRqXQDVWUXWWXUDPROWRWUDVSDUHQWHXQDVRUWDGLGLDIUDPPDWUDORVSD]LR della piazza e il giardino retrostante, è allestita con un ascensore di servizio al piano superiore oltre ad una gradinata WUDGL]LRQDOHHVWHUQD'RWDWDGLEDJQLDGHQWUDPEHLSLDQLOHVXSHU¿FLVRQRDPSLDPHQWHYHWUDWHHVFKHUPDWHFRQ frangisole lignei. Il piano superiore è in cemento a vista. 3. Nuovo assetto delle aree archeologiche. Sul lato settentrionale, già occupato da alcuni scavi archeologi che hanno evidenziato la presenza di un Macellum – )RUXPFLUFRODUHHGLDOFXQLYDQLSHUWLQHQWLD7HUPH3XEEOLFKHFKHFRQWLQXDQRYHUVRVXGVRWWRLO3DOD]]RGHOOD&XOWXUD la piazza viene strutturata con un sistema di terrazzamenti che scende verso le stesse evidenze archeologiche. Il IURQWHVXOODVWUDGDq¿QLWRFRQDLXROHHSLDQWXPD]LRQLDUERUHH/¶DFFHVVLELOLWjqFRQVHQWLWDDQFKHLQTXRWDFRQXQD passerella che consente un’osservazione panoramica delle emergenge: viene così realizzato un piccolo parco arche­ RORJLFRXQDVRUWDGL³PXVHRXUEDQR´DOO¶DULDDSHUWDDWWUDYHUVRFXLqSRVVLELOHOHJJHUHODVWRULDVWUDWLJUD¿FDGHOODFLWWj tutta l’area adiacente ad est alle strutture antiche è lasciata libera per eventuali ed ulteriori ampliamenti degli scavi FRQQXRYHFDPSDJQHGLLQGDJLQHDUFKHRORJLFD,OVXRSHULPHWURYLHQHDOODUJDWRHUL¿QLWRDLERUGLFRQXQDVLHSHFKHQH riordina l’attacco alla città. Ciò è consentito dal riordino della viabilità esistente riducendola a semplice penetrazione SHULUHVLGHQWLGHJOLHGL¿FLFRQWHUPLQL&RQQHVVRFRQLOSDUFRDUFKHRORJLFRSHUXQDSLIDFLOHOHWWXUDGHJOLDVSHWWLGL vita quotidiana dell’antica città e per integrare le conoscenze storiche, si potrà eventualmente predisporre, un 274 esposizione permanente ma in continuo sviluppo di quei materiali archeologici che gli scavi fanno emergere e che maggiormente attirano la curiosità di chi visita i siti archeologici. In continuità con questa area, sul lato opposto del 3DOD]]RGHOOD&XOWXUDYLHQHVYLOXSSDWRXQRVSD]LRLPPDJLQDWRÀHVVLELOHSHUFRQVHQWLUHO¶HYHQWXDOHVYLOXSSRGHJOL scavi. È infatti realizzato con materiali poveri, il cemento per le pavimentazioni e ampie aiuole popolate da alberi. Un’architettura “reversibile” sempre pronta a lasciar spazio a ulteriori indagini archeologiche. A questo lato della piazza viene idealmente unito attraverso un percorso guidato il settore nord dove, anche se al di fuori della stessa, si WURYDQRLUHVWLGHOO¶$Q¿WHDWURURPDQRGLHSRFDDGULDQHD ,,VHFG& XQDYROWDULSXOLWRGDJOLHGL¿FLIDWLVFHQWLFKHYLVL DGGRVVDQRHUHVWDXUDWRDQFKHO¶DQ¿WHDWURSRWUjHVVHUHXVXIUXLELOHULDFTXLVWDQGRFRVuODSURSULDLPSRUWDQ]DVWRULFDHG inserendosi all’interno della città moderna che si ristruttura sull’antico impianto urbanistico generale della città antica RULHQWDWR1RUGVXG FRPHLSRWL]]DWRSHUODVFRSHUWDGHOSUREDELOH'HFXPDQRVRWWRLO3DOD]]RGHOOD&XOWXUD ,OWUDFFLDWR è messo in atto dalla variazione di inclinazione della posa delle pietre del pavimento della piazza e da una sua diversa ¿QLWXUDVXSHU¿FLDOH3HUTXDQWRULJXDUGDOH0XUD%L]DQWLQHFKHVLWURYDQRDLPDUJLQLPHULGLRQDOLGHOODSLD]]DDQFK¶HV­ se vengono connesse alle altre evidenze archeologiche e rese fruibili attraverso camminamenti laterali che riproduco­ QRTXHOOLGLURQGDVXSHULRULLQSDUWHDQFRUDSHUFRUULELOLLOWUDWWRYHUVRHVWGRYHQRQVRQRSLFRQVHUYDWHYLHQHULFRUGDWR con un tracciato ipotetico che idealmente le unisce all’antica Torre dell’Orologio di cui facevano parte. ,/352*(772',3$(6$**,2 1. Condizioni ambientali, ecologiche e di paesaggio. /¶DUHDVLSUHVHQWDVRVWDQ]LDOPHQWHLQSLDQRWUDQQHFKHSHULOVXRODWRRFFLGHQWDOHLQOHJJHURGHFOLYLR'DWDOHERUGR SDUWHLQIDWWLODULVDOLWDGHOIURQWHFROOLQDUHFKHSRLFRQGXFHDOODTXRWDPDJJLRUHSDUWHGHO3URPRQWRULR'XUD]]LDQRFKH presenta quote maggiori nello sviluppo del sistema collinare a Nord. Tale fronte si caratterizza per la presenza di una discreta copertura vegetale, formata da essenze tipiche del luogo, caratteristiche del paesaggio costiero mediterra­ QHR/DSLD]]DSUHVHQWDDQFKHDOVXRLQWHUQRXQDPRGHVWDFRSHUWXUDDUERUHD,ERUGLGHOOHVWUDGHVRQRRUQDWLGD¿ODUL di ligustri e da lecci e da altre specie vegetali arboree endemiche. Attorno al Palazzo della Cultura è presente una vegetazione fatta di siepi ornamentali (allori, pitosfori, ligustri, altre essenze) e alcuni alberi ad alto fusto (in preva­ lenza lecci). La Piazza e’ inoltre suddivisa in due da un ampio spazio ombreggiato da alcuni alti cedri del Libano, in buone condizioni vegetative 2. Sistema del verde. Piazza liria di ampio respiro è in realtà soffocata rispetto alle sue componenti territoriali che la includono: la costa le FROOLQHLO3URPRQWRULR'XUD]]LDQRGRYHLQVHGLDPHQWLQRQSLDQL¿FDWLLQFRPERQRVXOFHQWURDQWLFRGL'XUD]]RHFRQIHUL­ VFRQRDVSLDJJHHFRVWDXQD¿VLRQRPLDXUEDQDFKHQRQHYRFDSHFXOLDULWjSRVLWLYHQHOFRQWHVWRPHGLWHUUDQHR Il binomio natura­cultura, e quindi il richiamo di un turismo culturale e ambientale, costituirebbe un messaggio positivo per l’immagine della piazza, oltre a valorizzarne gli usi da parte dei cittadini e dei residenti. L’interazione uomo­ ambiente, deve essere funzione del linguaggio del territorio che veicola i valori della comunità che lo abita e ne tra­ smette l’identità a chi vi si reca. La nuova organizzazione dello spazio pubblico si dirige verso la capacità di “recupe­ UR´GLFRQQHWWLYLWjWHUULWRULDOHHGHFRORJLFDDO¿QHGLIDYRULUHO¶DUPRQL]]D]LRQHWUDWHUULWRULRDSHUWRHWHUULWRULRFRVWUXLWR $WDO¿QHVLULWLHQHSULRULWDULDXQDULFRQQHVVLRQHHFRORJLFDWUDOHSHQGLFLFROOLQDULVXFXLULVDOHODFLWWjYHUVRHVWHL TXDUWLHULFKHRFFXSDQRODSLDQDDOOXYLRQDOH¿QRDOEDFLQRSRUWXDOHHDOODIDVFLDFRVWLHUD(¶SUHYLVWDODTXDVLWRWDOH ripiantumazione degli alberi esistenti in particolar modo degli 8 Cedri del Libano che si trovano al centro della piazza esistente delle palme che circondano il palazzo della cultura come anche dei ligustri e dei lecci che bordeggiano le strade. 3. Fronte ovest “il belvedere”. Tale fronte si caratterizza per la presenza di una discreta copertura vegetale, formata da essenze tipiche del luogo, caratteristiche del paesaggio costiero mediterraneo. Il nuovo disegno dell’area con la terrazza “belvedere” tende a mantenere sostanzialmente invariato lo stato attuale prevedendo una ripiantumazione degli alberi esistenti sempre­ verdi a “monte” (Cedrus libani, Cupressus sempervirens, Quercus ilex, Pinus, Ligustrum) ed introducendo una nuova piantumazione di specie di medie dimensioni non sempreverdi dell’area (Pistacia terebinthus, Arbutus unedo) nelle ¿RULHUHULFDYDWHQHOODSDYLPHQWD]LRQHGHOODWHUUD]]D 4. La “piazza”. Nella piazza lo spazio dato alla vegetazione è in funzione da una parte dell’ombreggiatura delle panchine e dei luoghi GLVRVWDGDOO¶DOWUDFRPHPLWLJDWXUDGLHGL¿FLHVLVWHQWL1HOODVHULHGLDLXROHDLODWLGHOODVFXOWXUDGL³1XQ]LR´YHUUDQQR ripiantumati alberi sempreverdi già presenti nell’area, in particolare i Cedri del Libano che si trovano al centro della piazza attuale. Nelle vasche di terra al centro della piazza everranno piantumati degli alberi di media dimensione non sempreverdi dell’area (Pistacia terebinthus, Arbutus unedo) e degli arbusti sempreverdi (Nerium oleander). 1HOOH¿RULHUHFKHFRVWHJJLDQRODVWUDGDGHOIRUREL]DQWLQRYHUUDQQRULSLDQWXPDWLGHLOLJXVWULHLQWXWWDO¶DUHDFKHFLUFRQ­ da il palazzo della cultura saranno ripiantumate essenze già presenti nell’area. Per quanto riguarda invece il perimetro della zona archeologica del foro bizantino sarà mitigato da siepi di alloro. 5. Fronte est. 3HULOIURQWHRSSRVWRDOODPRVFKHDVLSUHYHGHLOULSULVWLQRGHOODÀRULGDSLQHWDFKHRFFXSDYDLQDQWLFKLWjO¶DUHDFKHYD GDOODSLD]]DDOEDFLQRSRUWXDOHHDOODIDVFLDFRVWLHUD9HUUDQQRULSLDQWXPDWLGHL3LQLHVLVWHQWLQHOO¶DUHDHSLDQWXPDWLGL nuovi. Qualche arbusto sempreverde (Nerium oleander) inoltre sarà piantumato in ordine sparso fra i viottoli in ghiaia stabilizzata. Quest’area verde ad est ha la funzione di climatizzazione rispetto all’aerosol marino che vi entra dal fronte marino. 6. Sostenibilità. ,O¿QHXOWLPRGHOSURJHWWRROWUHFKHHVWHWLFDqVRSUDWWXWWRHWLFDFRQLQFUHPHQWRGHOODPRELOLWjFLFORSHGRQDOHXUEDQD con riduzione della Co2 da parte dei vegetali, diminuzione del consumo energetico per la climatizzazione 277 (protezione verso il vento, raffreddamento per aumento evapo traspirazione, ombreggiamento), diminuzione inqui­ namento acustico, migliora la qualità dell’aria (qualità atmosferica e cattura delle particelle), opera per il recupero estetico degli spazi degradati, minor consumo idrico, maggiore permeabilità dei suoli. Sono questi alcuni degli aspetti peculiari di una presenza ricca, in termini di qualità e quantità degli spazi, all’interno dell’ambiente urbano. 0$7(5,$/,(),1,785( La concezione del progetto è nello spirito minimalista, di una cosa su l’altra. Il materiale usato per le pavimentazioni è la pietra di TraniWUDWWDWDLQVXSHU¿FHPHGLDQWHSURFHGLPHQWRGLERFFLDU­ datura, il disegno prevalentemente “correre” è però impreziosito dall’utilizzo di differenti formati e l’inserimento di SH]]LDGLIIHUHQWH¿QLWXUDVXSHU¿FLDOH$QFKHSHURWWHQHUHXQHIIHWWRRSSRVWRDOODVWUXWWXUDSL³PRQROLWLFD´GHO³WDVVHOOR scultoreo”. Le caditoie stesse sono in pietra di Trani. I ricorsi in pietra di Trani a correre sono intervallati da cordoli in travertino. Le panche sono realizzate con un monolite di travertino. L’acciaio verniciatoqXVDWRFRPH¿QLWXUDGL tutti gli elementi metallici di arredo, lampioni e alcuni parapetti e i giunti delle pavimentazioni. Per quanto riguarda la realizzazione della scultura di Nunzio (Senza Titolo) si prevede la realizzazione delle intere partiture, mediante cola­ tura in opera di uno speciale impasto cementizio, all’interno di un’apposita centinatura di riferimento, che funge anche GDJLXQWRHODVWLFR6XFFHVVLYDPHQWHPDFRQSURFHGLPHQWR³IUHVFRVXIUHVFR´YHQJRQRUL¿QLWHOHVXSHU¿FLSHURIIULUH massima continuità e lisciatura. Una delle vasche inoltre verra sottoposta da Nunzio ad un procedimento di stagnatu­ UDFKHDPSOL¿FKHUjLULÀHVVLHOHULIUD]LRQL/DIDVFLDQHUDqUHDOL]]DWDFRQXQDPHVFRODDEDVHFHPHQWL]LDFRORUDWD Inoltre, aspetto altamente rilevante ma apparentemente banale, è che sulla scultura ci si possa camminare o sedere (grazie ai bordi che si incidono sul piano della piazza) e quindi consente alla scultura orizzontale di mutuare l’equili­ brio ambiguo ed ambivalente tra i percorsi e le zone di sosta. /DGHEROH]]DLQL]LDOHGLXQRVWDWRGLDPELJXLWjHFRQWUDGGL]LRQHGHOO¶DUHDVWHVVDqVWDWD¿QDOPHQWHWUDVIRUPDWDLQ ULFFKH]]DGLVLJQL¿FDWLGHOO¶LQWHUDRSHUD,QWHPDGL³VLFXUH]]D´GHOSHGRQHVLUHQGHQRWRFKHLQTXDOVLDVLDQJRORGL sezione della pavimentazione le pendenze sono ben al di sotto di quelle stabilite nella normativa vigente. a) pavimentazioni ODVWUHGLSLHWUDGL7UDQLVSHVVRUHFPGLPHQVLRQHFPOXQJKH]]DDFRUUHUH FRUGROLLQWUDYHUWLQRGLPHQVLRQL[ ULFRUVLLQWUDYHUWLQRVSHVVRUHFPGLPHQVLRQHFPOXQJKH]]DDFRUUHUH JKLDLDVWDELOL]]DWDDOOHWWDWDVXPDVVHWWRGLFHPHQWR FHPHQWR³IUHVFRVXIUHVFR´¿QLWXUDFRQLQHUWLGLTXDU]LWHFRORUDWRVHFRQGROHLQGLFD]LRQLGLSURJHWWR¿QLWXUD VXSHU¿FLDOHOHYLJDWRVWDPSDWRULJDWR b) rivestimenti ULYHVWLPHQWRGHOOHVHGXWHLQPDUPRWUDYHUWLQRVSHVVRUHFPGLPHQVLRQLDGLVHJQR ­ rivestimento dell’intradosso della terrazza “belvedere” in mosaico in pasta di vetro trasparente, dimensioni 2x2cm. ULYHVWLPHQWRFDIIHWWHULDGHOOH³PXUD´LQODVWUHGLDFFLDLRYHUQLFLDWRVSHVVRUHGLPHQVLRQHDGLVHJQR c) arredo urbano ­ apparecchi per esterno costituiti da pali in acciaio verniciato, altezza 400 e 500 cm (tipo “BEGA 8877, 8879”), con ODPSDGDÀXRUHVFHQWH FRUSLLOOXPLQDQWLGDWHUUD SDYLPHQWR LQDOOXPLQLRFRUQLFHLQDFFLDLRLQR[YHWURWHPSUDWRGLFKLXVXUD WLSR³/,*+783 :$/.L*8==,1,´ GLPHQVLRQLFPFRQODPSDGDDOHG FRUSLLOOXPLQDQWLGDWHUUDLQDOOXPLQLRFRUQLFHLQDFFLDLRLQR[YHWURWHPSUDWRGLFKLXVXUD WLSR³/,*+783L*8==,1,´  GLPHQVLRQLFPFRQODPSDGDÀXRUHVFHQWH ­ apparecchio di illuminazione a luce diretta da camminamento in alluminio verniciato (tipo iWay iGUZZINI), altezza FPGLIIXVRUHLQSROLFDUERQDWRFRQODPSDGDDOHG FHVWLQLSRUWDUL¿XWLLQODPLHUDG¶DFFLDLR]LQFDWRHYHUQLFLDWRDSROYHUL WLSR³0(7$/&263(1&(5´ GLPHQVLRQL + FP‘FP GLVVXDVRULDFFLDLRYHUQLFLDWR WLSR³0(7$/&2*(1(6,6´ GLPHQVLRQL+ FP‘FP ­ dissuasori a scomparsa in acciaio verniciato (tipo “METALCO MAGIC”), sistema di movimentazione con pistone a JDVGLPHQVLRQL+ FP‘FP IRQWDQHOODLQDFFLDLRYHUQLFLDWR WLSR³0(7$/&2)8(17(´ GLPHQVLRQL+ FP‘FP VDOYDSLDQWHLQFHPHQWRDUPDWR WLSR³0(7$/&2(6&2)(7&$50(/´ GLPHQVLRQL‘FP SDQFKHLQPRQROLWHGLWUDYHUWLQRFRPHGDGLVHJQRFRQSLDQRVXSHULRUHOHYLJDWR 62/8=,21,3(5,/683(5$0(172'(//(%$55,(5($5&+,7(7721,&+( ,OSURJHWWRSUHYHGHODUHDOL]]D]LRQHGLVXSHU¿FLSDYLPHQWDWHDOOLYHOORSLD]]DFRPSOHWDPHQWHDFFHVVLELOHVHFRQGR Legge 13/89 dello stato italiano e con la possibilità di un’agevole fruizione degli spazi verdi e di si sosta. Sono garantiti gli spazi minimi di manovra per la circolazione ed il passaggio delle sedie a ruote onde superare le barriere architettoniche. 279 280 5.6 Jury Decision/,OJLXGL]LR¿QDOHGHOOD*LXULD -85<'(&,6,21 7KHLQWHUQDWLRQDO-XU\RQ6DWXUGD\-DQXDU\WKLQ'XUUHV$0XVLX7KHDWUH $IWHUKDYLQJFDUHIXOO\UHYLHZHGWKHVXEPLVVLRQVKDVVHOHFWHGIRUWKHZLQQLQJSURMHFWWKHSURSRVDOQDPHG³)ROGLQJ´HODERUDWHGE\WKH group coordinated by the architect Michele Cro, recognizingthe following qualities: XUEDQTXDOLW\WKHSURMHFWSURSRVHVDXQL¿HGGHVLJQDQGDWWKHVDPHWLPHDEOHWRFUHDWHDGLDORJXHZLWKWKHYDULRXVSXEOLFEXLOGLQJVWKDW VXUURXQGWKH6TXDUH WKHSUHIHFWXUHWKH3DODFHRI&XOWXUHDQGWKH7RZQ+DOO 7KHSURMHFWSURSRVHVDQRULJLQDOVROXWLRQIRUWKH GLI¿FXOWUDSSRUWEHWZHHQWKHVTXDUHDQGWKHPRVTXHLQWURGXFLQJDJHQHURXVSXEOLFVSDFHZKLFKLVHOHYDWHGDWWKHKHLJKWRIWKHUHOLJLRXV EXLOGLQJ8QGHULWWKHUHZLOOEHDVHULHVRIVHUYLFHVRIXVHVWKDWZLOOEHXVHGE\WKHFLWL]HQVRI'XUUHVDVWKH\HQMR\WKHQHZVTXDUH 9HKLFXODUWUDI¿FWKURXJKDQDUWLFXODWHGSDYHPHQWV\VWHPDQGVPDOOYDULDWLRQLQKHLJKWWKHSURMHFWLQGXFHVDGHFLVLYHOLPLWWRWKHVSHHGRI WKHYHKLFOHVWKDWZLOOWUDQVLWZLWKLQWKHVTXDUHDWWKHVDPHWLPHLWZLOOSURYLGHWRWKHDGPLQLVWUDWLRQWRH[SHULPHQWLQWLPHGLIIHUHQWV\VWHPVRI circulation, until a possible complete pedestrianalization of the square. ­ Archaeological areas: the project foresees a strong connection of the two important archaeological areas – the Roman Amphitheatre and WKH%\]DQWLQH)RUXP7KHIRUPHU¿QGVLWVHOIDWDKHLJKWZLWKLQWKHSURSRVHGHOHYDWHGVTXDUHWKHODWWHULVUHLQWHJUDWHGWKURXJK various viewpoints. ­ Art and architecture: the project displays a strong capacity of integration between artistic and architectural features that includes the incorporation of a central water feature. The Jury makes the following recommendations for the implementation of the project: ­ To reconsider the angle of the new elevated portion of the new square, adjacent to the ottoman wall, by introducing a grand stair that FRQQHFWVWKHDYHQXHWRWKHHOHYDWHGSRUWLRQ 7RLQWURGXFHDQHOHYDWHGZDONZD\IURPWKHVDLGHOHYDWHGSRUWLRQWRWKH%\]DQWLQH)RUXPE\UHSOLFDWLQJWKHSURSRVHGSRUWLFRRQWKHHDVW VLGHRIWKHQHZVTXDUH ­ To reconsider the proposed lighting system by integrating it with the architecture of the new square and to utilize the prevailing systems of UHQHZDEOHHQHUJ\LWLVIXUWKHUPRUHVXJJHVWHGWRJLYHJUHDWHUFRQVLGHUDWLRQWRVXVWDLQDEOHWHFKQRORJLHV 7RJLYHPDMRUFRQVLGHUDWLRQWRWKHVHOHFWLRQRIDSSURSULDWHVSHFLHVRIYHJHWDWLRQVVSHFL¿FDOO\QDWLYHSODQWVDQGWKDWKDYHDFRKHUHQFH ZLWKWKHDGMDFHQWODQGVFDSH 7RJLYHIXUWKHUFRQVLGHUDWLRQWRWKHDUFKDHRORJLFDODUHDWKDWLQFRUSRUDWHVWKH+HOOHQLVWLFOLJKWKRXVHDQGWRLQFRUSRUDWHLWZLWKLQDWRXULVWV and cultural itinerary. ­ To maintain the public use of the proposed building on the north­eastern side of the new square and to dedicate it to a use which reinfor­ FHVWRXULVPDQGFXOWXUHDQGWROLPLWWKHKHLJKWDFFRUGLQJWRWKHVFDOHRIWKHDGMDFHQW3DODFHRIFXOWXUHDQGVXEMHFWWRWKHYHUL¿FDWLRQRIWKH FRPSDWLELOLW\RIWKHDUFKDHRORJLFDO¿QGLQJV The International Jury, composed by: Arch. Rocco Maragna, Arch. Luca Zevi Arch. Jean Monier, alternate member of Alain Coussaran, 'RWW$OEHUWR0RQWL'RWW(GXDUG0XND$UFK9LFWRU'KLPLTL$UFK0DULQ%LFRNX ,QJ9DQJMXVK'DNR+RQRUDU\3UHVLGHQWRIWKH,QWHUQDWLRQDO-XU\'XUUHV-DQXDU\WK VERBALE DELLA GIURIA /D*LXULDLQWHUQD]LRQDOH6DEDWRJHQQDLRD'XUD]]RQHO7HDWUR$0XVLXGRSRHVDPHDSSURIRQGLWRKDVHOH]LRQDWRFRPHSURJHWWR YLQFLWRUHODSURSRVWDFRQWUDVVHJQDWDGDOPRWWR)ROGLQJHODERUDWDGDOJUXSSRGHOO¶DUFK0LFKHOH&UzULVFRQWUDQGRQHOHVHJXHQWLTXDOLWj ­ urban qualityLOSURJHWWRSURSRQHXQGLVHJQRXQLWDULRPDFRQWHPSRUDQHDPHQWHFDSDFHGLGLDORJDUHFRQLVLQJROLHGL¿FLSXEEOLFLSUHVHQWL QHOOD3LD]]D SUHIHWWXUD3DOD]]RGHOOD&XOWXUD0XQLFLSLR ,OSURJHWWRSURSRQHXQDVROX]LRQHRULJLQDOHSHULOGLI¿FLOHUDSSRUWRWUDODSLD]]DH OD0RVFKHDLQWURGXFHQGRXQJHQHURVRVSD]LRSXEEOLFRVRSUDHOHYDWRDOODTXRWDGHOO¶HGL¿FLRUHOLJLRVRDOGLVRWWRGHOTXDOHYHQJRQRFROORFDWL servizi di utilità pubblica destinati ai frequentatori della piazza. ­ WUDI¿FR attraverso un sistema articolato di pavimentazionI e di piccole variazioni di quote, il progetto introduce una decisa limitazione GHOODYHORFLWjGHLPH]]LPHFFDQL]]DWLLQWUDQVLWRQHOODSLD]]DQHOORVWHVVRWHPSRFRQVHQWHDOO¶DPPLQLVWUD]LRQHGLVSHULPHQWDUHQHOWHPSR GLYHUVLVLVWHPLGLFLUFROD]LRQH¿QRDGXQDSRVVLELOHSHGRQDOL]]D]LRQHFRPSOHWDGHOODSLD]]D ­ aree archeologicheLOSURJHWWRSUHYHGHXQIRUWHFRLQYROJLPHQWRGHOOHGXHLPSRUWDQWLDUHHDUFKHRORJLFKHGHOO¶DQ¿WHDWURURPDQRHGHOIRUR EL]DQWLQRQHOODULFRQ¿JXUD]LRQHGHOODSLD]]DLOSULPRYLHQHDWURYDUVLDGXQDTXRWDPROWRSURVVLPDDTXHOODGHOODQXRYDSLD]]DVRSUDHOHYD­ WDLOVHFRQGRYLHQHUHLQWHJUDWRDWWUDYHUVRODSURSRVL]LRQHGLSLSXQWLGLYLVWDUHQGHQGRORDFFHVVLELOHHJRGLELOHDYDULHTXRWH ­ Arte e architettura: il progetto dimostra una forte capacità di integrazione tra aspetti artistici e architettonici, che culmina nella proposta dello spazio d’acqua centrale. /D*LXULDULYROJHDOJUXSSRYLQFLWRUHOHVHJXHQWLUDFFRPDQGD]LRQLSHUOHIDVLGLSURJHWWD]LRQHGH¿QLWLYDHGHVHFXWLYD ­ di ripensare lo spigolo della piazza superiore a ridosso delle mura ottomane, introducendovi una scalea di collegamento diretto tra il corso HODSLD]]DVXSHULRUH GLLQWURGXUUHXQFROOHJDPHQWRVRSUDHOHYDWRWUDODSLD]]DVXSHULRUHHO¶DUHDGHO0DFHOOXP )RUR%L]DQWLQR HYHQWXDOPHQWHUHSOLFDQGRLO SHUFRUVRSRUWLFDWRSURSRVWRVXOODWRRULHQWDOHGHOODSLD]]D ­ di ripensare il sistema di illuminazione proposto puntando ad una maggiore integrazione con l’architettura della piazza e l’utilizzazione di VLVWHPLGLFDSWD]LRQHGHOO¶HQHUJLDGDIRQWLULQQRYDELOLVLVXJJHULVFHLQROWUHXQDPDJJLRUHDWWHQ]LRQHDOO¶LQWURGX]LRQHGLWHFQRORJLHVRVWHQLELOL UHODWLYDPHQWHDJOLDVSHWWLHGLOL]LHGLGUDXOLFL ­ di dedicare maggiore attenzione alla selezione delle essenze vegetali, privilegiando le specie autoctone, in coerenza con i caratteri di SDHVDJJLRFLUFRVWDQWH ­ di considerare nell’approfondimento di progetto, la valorizzazione dell’area archeologica del Faro Ellenistico, anche all’interno di un SRVVLELOHFLUFXLWRWXULVWLFRFXOWXUDOH GLPDQWHQHUHLOFDUDWWHUHGLXVRSXEEOLFRGHOO¶HGL¿FLRSURSRVWRDPDUJLQHGHOFRQ¿QHQRUG±RFFLGHQWDOHGHOODSLD]]DSULYLOHJLDQGRQHXQD GHVWLQD]LRQHG¶XVRWXULVWLFDFROOHWWLYDRFXOWXUDOHOLPLWDQGRQHO¶DOWH]]DDOOHSUHVFUL]LRQLGLSLDQRHYHUL¿FDQGRQHODFRPSDWLELOLWjVXO piano archeologico. 281 7KHÀQDOGUDIW,OSURJHWWRGH¿QLWLYR Arch. Michele Cro’ 'HVLJQ7HDP/DQGVFDSH$JU$ODLQ(QQLR$VFDUHOOL $UFKDHRORJLVW0+HOHQD0DUFKHWWL$UFK$OEHUWR&UR¶ Premessa Il presente progetto, vincitore del bando di concorso promosso dall’Amministrazione nel maggio del 2008, è stato redatto in base alla stesura originaria e perfezionato in linea alle indicazioni della giuria internazionale e alle richieste sopravvenute dell’Amministra­ zione stessa. In un primo incontro avvenuto in data 5 maggio 2009 si è concorda­ WRFRQO¶DPPLQLVWUD]LRQHGLPRGL¿FDUHLOVLVWHPDGHJOLDFFHVVLDOOD terrazza belvedere predisponendo ampie gradinate a cielo aperto per raggiungere la quota della Moschea antistante, e di convertire l’idea originaria dell’albergo, ubicato sul fronte orientale, in una piccola struttura informativa per il turismo, pur mantenendo l’idea GHOODSHQVLOLQDSHUUHWWL¿FDUHLOIURQWHGHOOD3LD]]D In un secondo incontro avvenuto in data 4 giugno, 2009, sulla EDVHGHOOHLQGLFD]LRQLGHOO¶DPPLQLVWUD]LRQHFRPXQDOHHUDWL¿FDWHGDO 583LQJ$GULDQ&HODVLqGHFLVRGLVYLOXSSDUHLOSURJHWWRGH¿QLWLYR GHOOHRSHUHGLULTXDOL¿FD]LRQHGL3LD]]D,OLULDLQRUGLQHDWUHIDVLGL intervento. Tale richiesta è stata messa in atto per consentire da parte dell’am­ PLQLVWUD]LRQHGLSRWHUJHVWLUHSLDJHYROPHQWHO¶DPPRQWDUHJOREDOH GHOODVSHVDGLULTXDOL¿FD]LRQHGHOSURJHWWR¿VVDWDLQOLQHDJHQHUDOH in 5 milioni di euro dei lavori. L’indicazione dei perimetri di suddivisione delle fasi è stata sotto­ posta al RUP in un incontro preliminare e accettata nelle sue linee generali. Le tre fasi sono le seguenti: 5LTXDOL¿FD]LRQHGHOIURQWHRYHVW³LOEHOYHGHUH´XQ¶DPSLDWHUUD]]D SURVSLFLHQWHODPRVFKHDFKHUHWWL¿FDLOIURQWHGHOODSLD]]DHULRUGLQD i giardini alla base del promontorio durazziano. Al livello della piazza la differenza di quota, sarà occupata da attività turistico ricettive commerciali che si insediano proprio sotto la terrazza. 2. Sistemazione e arredo della piazza e nuova viabilità. In questa IDVHYLHQHULRUGLQDWDO¶LQWHUDVXSHU¿FLHTXDGUDQJRODUHGHOODSLD]]D rivista la viabilità e arredato tutto lo spazio. 3. Nuovo assetto delle aree archeologiche. La creazione di un parco archeologico alle spalle del Palazzo della Cultura che comprende ROWUHO¶DQWLFR0DFHOOXPDQFKHOHWHUPHURPDQHULDI¿RUDWHGXUDQWHOD FRVWUX]LRQHGHO3DOD]]RVWHVVRQRQFKqODULTXDOL¿FD]LRQHGHOOHDOWUH testimonianze puntuali ai bordi della Piazza. Le esigenze dell’Amministrazione Comunale Nel chiaro intento di rivitalizzare la scena urbana, quello di Piazza ,OLULDqXQRGHLSLWHPLPDJJLRUPHQWHHVHPSODULQHOTXDGURGL vivacizzazione della città introdotto dal PRG recentemente appro­ vato. L’ipotesi generale è quella di ristabilire un nuovo legame con ODVWRULDXUEDQDGL'XUD]]RULDYYLDQGRXQ¶RSHUDGLULYLWDOL]]D]LRQH e recupero del considerevole patrimonio culturale di cui ancora la FLWWjqGRWDWD'XUD]]RSRVVLHGHOHYHVWLJLDGLXQRGHLSLJUDQGL DQ¿WHDWULURPDQLGHL%DOFDQLOHPXUDDQFRUDLQWHJUHGHOODFLWWDGHOOD bizantina e ottomana, un importante Museo archeologico, un esteso patrimonio di tracce e monumenti delle molte epoche che ne hanno segnato il cammino. La compresenza di tutti questi elementi nella SLD]]DULVXOWDHYLGHQWH0ROWLGLTXHVWLWHPLVRQRVWDWLYLVVXWL¿QRDG oggi come vincoli, o impedimento allo sviluppo: ODSUHVHQ]DGLULOHYDQWLPRQXPHQWLDUFKHRORJLFLVSHVVRDI¿RUDWL QHOFRUVRGHOODFRVWUX]LRQHGLQXRYLHGL¿FLUHVLGHQ]LDOLRDQFKHGL LPSRUWDQWLDWWUH]]DWXUHXUEDQH ­ la presenza di funzioni collettive, proprie di uno spazio centrale, si è sovrapposta 282 DJOLXVLSLSURSULDPHQWHXUEDQLHGLTXDUWLHUHGLXQD]RQDFRPXQ­ TXHDGHOHYDWDGHQVLWjUHVLGHQ]LDOH ODFUHVFLWDGHOWUDI¿FRXUEDQRHORVYLOXSSRGHOODPRELOLWjSULYDWD in città – esperienza relativamente nuova in un paese di recente WUDQVL]LRQH±FRQÀLJJHRJJLFRQXQXVRSHGRQDOHHWUDGL]LRQDO­ mente lento di questo tradizionale spazio pubblico urbano. Una condizione d’uso che tende, peraltro, ad assumere sempre maggiore rilevanza con la scoperta della città da parte del turismo nazionale e internazionale e la crescita incessante dei visitatori e delle presenze. A tali temi può ancora essere aggiunto quello che deriva dalla condizione di una piazza che è inevitabilmente spazio di rappre­ sentazione funzionale e simbolica di una societas multiculturale, oltreché multi religiosa, dove si affacciano le tracce di un passato e di un presente ricco e complesso, espressione di una comunità varia e articolata, tanto negli stili di vita che nei comportamenti individuali e collettivi. (...) /HSUHYLVLRQLGHJOLVWUXPHQWLGLSLDQL¿FD]LRQH Il PRG di recente redazione e approvazione annovera lo spazio della piazza strategico del sistema delle nuove centralità, in parti­ colare l’APS5­Progetto dell’asse urbano corso Epidamnos. Il piano assegna a quest’area un ruolo di riconnessione trà le diverse parti di città, attraverso il recupero di forme di memoria urbana, senza dimenticare il presente ma puntando l’attenzione ai luoghi che costituiscono l’immagine dell’asse e della città stessa. La piazza rappresenta una delle due polarità insieme alla piazza GHOOD'RJDQD$VSHWWRLPSRUWDQWHqGHPDQGDWRDOULDVVHWWRGHOOD viabilità e mobilità sostenibile. L’area è pensata come un tessuto DWUDI¿FROLPLWDWR,OYLDOH(SLGDPQRVGLYHQWDODQXRYDVWUDGD passeggiata, la cui sezione diventa lo strumento di controllo che ne guida la trasformazione e ne valorizza la percezione. Tutto il sistema accessibile diventa vero luogo di connessione urbana che si struttura attraverso un sistema di piste ciclabili, nuove albera­ ture, il ridisegno delle pavimentazioni e spazi di sosta. La piazza GLYHQWDRJJHWWRGLULVWUXWWXUD]LRQHXUEDQLVWLFDDO¿QHGLWUDVIRUPDU­ si in polo urbano. Sono altresì previsti interventi di ristrutturazione, sia riconsiderando alcune previsioni del piano del ’42 (i portici lato est della piazza) sia per il Palazzo della Cultura oltre che il ridisegno dell’assetto stradale e la possibilità di dotarsi di strutture turistico ricettive culturali anche minute. L’ambito di intervento La storia della Piazza ci consegna oggi uno spazio ancora incom­ piuto, soprattutto sul versante orientale, e tuttavia particolarmente denso di memorie e di storie, oltreché di presenze di rilevanza urbana e monumentale. Tutte le funzioni urbane principali si affacciano sulla piazza – la Sede Municipale, la Moschea Grande, il Palazzo della Cultura, la Prefettura – e tutti i principali monumenti storici della città sono a diretto contatto con essa, o distano dalla piazza distanze assi PRGHVWHÊLOFDVRGHOFLWDWRJUDQGHDQ¿WHDWURURPDQRGDFXLVL accede per una scalinata FKHSDUWHSURSULRGDOVXRYHUWLFH6XGRFFLGHQWDOHGLFLzFKH rimane, in situ, delle mura ottomane (di cui sarebbe interessante ricostruire almeno la giacitura della Grande Porta, precedente­ mente citata), che anticipano il Castello, a cui risale proprio se­ guendone il tracciato, scomparso sul lato della Piazza (ne restano solo poche tracce a sinistra del Palazzo Comunale, note come “la torre dell’orologio”), ma che poi riacquista consistenza monumen­ WDOHROWUHLOFRQ¿QHGHOODSLD]]D(SRLDQFRUDLO)RUR%L]DQWLQRDOOH spalle del Palazzo della Cultura, e dall’altra parte, verso il porto, lungo l’attuale corso principale, già via del Commercio, l’antico +DPPDQODJUDQGH7RUUH9HQH]LDQDHGLQXRYROHPXUD±JLjUR­ mane, forse ellenistiche, poi bizantine e ottomane, che chiudono la &LWWj9HFFKLDGLFXL3LD]]D/LULDFRVWLWXLVFHRJJLLOFXRUH/DSLD]]D appare oggi come un grande spazio, frammentato, denso e incom­ piuto, forse anche incompleto, rispetto alla necessità di funzioni che oggi si chiedono ad una grande piazza contemporanea: spazio progettato dalla Storia, sia pure attraverso un percorso non lineare, ed in attesa, oggi, di un nuovo progetto, che ne valorizzi le identità passate attraverso l’invenzione creativa di una nuova immagine, di un nuovo paesaggio urbano. 7RSRJUD¿DSDHVDJJLRDPELHQWHGLULIHULPHQWR L’area si presenta sostanzialmente in piano, tranne che per il suo ODWRRFFLGHQWDOHLQOHJJHURGHFOLYLR'DWDOHERUGRSDUWHLQIDWWLOD risalita del fronte collinare che poi conduce alla quota maggiore, SDUWHGHO3URPRQWRULR'XUD]]LDQRFKHSUHVHQWDTXRWHPDJJLRUL nello sviluppo del sistema collinare a Nord. Tale fronte si caratte­ rizza per la presenza di una discreta copertura vegetale, formata da essenze tipiche del luogo, caratteristiche del paesaggio costiero mediterraneo. La piazza presenta anche al suo interno una mo­ GHVWDFRSHUWXUDDUERUHD,ERUGLGHOOHVWUDGHVRQRRUQDWLGD¿ODULGL ligustri e da lecci e da altre specie vegetali arboree endemiche. Attorno al Palazzo della Cultura è presente una vegetazione fatta di siepi ornamentali (allori, pitosfori, ligustri, altre essenze) e alcuni alberi ad alto fusto (in prevalenza lecci). La Piazza e’ inoltre sud­ divisa in due da un ampio spazio ombreggiato da alcuni alti cedri del Libano, in buone condizioni vegetative. In relazione al proprio patrimonio vegetale, la piazza svolge anche un potenziale ruolo di riconnessione ecologica tra le pendici collinari su cui risale la città, verso est, e i quartieri che occupano la piana alluvionale, ¿QRDOEDFLQRSRUWXDOHHDOODIDVFLDFRVWLHUDXQWHPSRRFFXSDWD GDXQDÀRULGDSLQHWDFKHPHULWHUHEEHGLHVVHUHLQTXDOFKHPRGR ripristinata. Scelte progettuali L’intervento sviluppato nel progetto generale si pone in totale VLQWRQLDFRQWXWWLLSULQFLSDOLRELHWWLYLGH¿QLWLGDOO¶$PPLQLVWUD]LRQH QHOOR6WUXPHQWRGLSLDQL¿FD]LRQHXUEDQLVWLFDFRPXQDOHHQHJOL$WWL del Bando del Concorso di Progettazione, e tutti I suoi elementi, essendo informati al totale rispetto delle compatibilità ambien­ WDOLGHOFRQWHVWRSDHVDJJLVWLFRDOODUJDWRVRQR¿QDOL]]DWLDGXQ JOREDOHLQWHUYHQWRGLULTXDOL¿FD]LRQHXUEDQLVWLFDGHOOD3LD]]D,OLULD e il suo ambito circostante. La suddivisione in fasi dell’intervento corrisponde perfettamente alle principali scelte messe in atto nel SURJHWWRSHUULTXDOL¿FDUHHFRQ¿JXUDUHO¶LQWHUDDUHD 5LTXDOL¿FD]LRQHGHOIURQWHRYHVW³LOEHOYHGHUH´ La sua costituzione e ruolo tra spunto dall’idea dei portici svi­ luppata nel piano del ’42 per il fronte opposto e che pure viene confermata. Si tratta infatti di un’ampia terrazza prospiciente la PRVFKHDFKHUHWWL¿FDLOIURQWHGHOODSLD]]DHULRUGLQDLJLDUGLQLDOOD 283 base del promontorio durazziano. Il suo carattere è solo apparen­ temente contraddittorio marca con forza il lato occidentale della piazza ma la sua sporgenza sottile rimanda al fronte opposto e allu­ de al mare. Al livello della piazza la differenza di quota, di circa 3.50 metri consente di ospitare attrezzature pubbliche per il turismo, e/o culturali­museali. Intorno alla moschea vengono riordinati i giardini che degradano con forme naturalistiche verso l’ambia pavimenta­ zione della terrazza. Sistemazione e arredo della piazza e nuova viabilità Partito centrale di tutta la composizione, questo spazio assolve il complesso compito di far coincidere, le tre differenti istanze della Piazza ( sosta­ percorso­monumento) delineate nel corso del pro­ getto anche ad interpretazione sintetica delle richieste del bando HGLQVHQVRSLDPSLRGHOFRQFHWWRGLSLD]]DFRQWHPSRUDQHD L’idea ambivalente che una piazza è sia un luogo di incontro e di VRVWDHVLDGLSDVVDJJLRHGLVHSDUD]LRQHKDLQÀXHQ]DWRO¶LQWHUD concezione del progetto artistico ed architettonico. L’inserimento a motivo di tassello, della scultura di Nunzio (Senza Titolo) esteso nella pavimentazione della piazza ha, così, permesso di salvaguardare una tale ambivalenza, in quanto vera ricchezza del progetto. Si offre come luogo dello stare, spazio privilegiato ma al contempo contaminato da tutti gli accessori necessari che rendono confortevole e sicuro uno spazio pubblico, alberi, pan­ chine, illuminazione, arredo, etc. La scultura orizzontale, inserita nella pavimentazione, delimita, uno spazio ideale, esplicitando una presenza senza renderla manifestamente evidente o retorica, FRQVHQWHQGRODWRWDOHIUXL]LRQHGHOODVXSHU¿FLH/DYLDELOLWjYLHQH organizzata in linea alle indicazioni dell’attuale Piano Regolatore PDGLIIHUHQ]LDQGROHVXSHU¿FLGL¿QLWXUDGHOOHVHGLVWUDGDOLFKH invadono la piazza (sul lato nord) privilegiandone l’uso pedonale HLQFDQDODQGRLOÀXVVRDWWUDYHUVRO¶XVRGLGLVSRVLWLYLGLVVXDVRUL Così come anche le altre percorrenze secondarie, di servizio e pista ciclabile, si stabiliscono sullo stesso basolato della piazza, senza che ulteriori segni ne contaminino l’unitarietà. Integrata con il WUDI¿FRHDUPRQL]]DWDQHOQXRYRFRQWHVWRXUEDQRODSLD]]DVLSRQH FRPHQXRYDJHRJUD¿DGDOFDUDWWHUHXQLWDULRLQJUDGRGLHVSULPHUH un valore di riconoscibilità alto, necessario ad uno spazio così disperso per costituirsi in luogo metropolitano. Nuovo assetto delle aree archeologiche La creazione di un parco archeologico alle spalle del Palazzo della Cultura che comprende oltre l’antico Macellum anche le terme ro­ PDQHULDI¿RUDWHGXUDQWHODFRVWUX]LRQHGHO3DOD]]RVWHVVRQRQFKq ODULTXDOL¿FD]LRQHGHOOHDOWUHWHVWLPRQLDQ]HSXQWXDOLDLERUGLGHOOD 3LD]]D9DORUL]]DUHLOSDWULPRQLRVLJQL¿FDWUDGXUORLQOXRJKLUHDOL ad alta godibilità, renderli partecipi dell’attività pubblica della città e dei suoi spazi. In questo senso nel nostro progetto tutti gli antichi siti sono stati messi a sistema, non solo trà di loro accorpando ed ampliando le aree archeologiche, ma anche ricreando ambienti che attraverso il sistema del verde, dell’acqua o dell’arredo urbano in PRGRGDFRQIHULUHDTXHVWLVSD]LLOVLJQL¿FDWRGLOXRJKL'DOSXQWR di vista architettonico il progetto ridona uniformità e omogeneità a tutta la piazza attraverso la sua totale pedonalizzazione, colle­ gando attraverso itinerari ideali e percorsi attuati tutte le evidenze archeologiche che la circondano e ne fanno parte (...) che prima risultavano totalmente avulse dal contesto in cui si trovavano. La SLD]]DDOOHJJHULWDFRVuGDOWUDI¿FRDXWRPRELOLVWLFRULDFTXLVWDOD SURSULDFHQWUDOLWjDWWUDYHUVRHVRSUDWWXWWRODULTXDOL¿FD]LRQHGHO proprio ruolo storico e la valorizzazione del patrimonio culturale ed DUFKHRORJLFRFKHGLYHQWD¿QDOPHQWHIUXLELOHDOSXEEOLFR Il sistema del verde A questa operazione generale, condotta articolando spazialmente il piano base della piazza,che avvolge anche i giardini intorno al Palazzo della Cultura si sovrappone la sistemazione del verde. Il VLVWHPDGHOYHUGHDVVXPHLQPRGRSLHYLGHQWHLOUXRORGLULFRQ­ nessione ecologica trà le pendici collinari ad est, e i quartieri che RFFXSDQRORVSD]LR¿QRDOEDFLQRSRUWXDOHHGDOODIDVFLDFRVWLHUD Un principale gruppo ordinato di alberi, attraversa i tasselli della scultura di Nunzio segnando una fascia orientata verso il mare e fornisce il maggior ombreggiamento della piazza. Le alberature 284 SLSRVVHQWLGLIURQWHDOUHFHQWLVVLPRLQWHUYHQWRHGLOL]LRDFFDQWRDO palazzo comunale, ne mitigano l’impatto e in parte ne occultano la visuale. A questo si aggiungono gruppi sparsi di alberi che sottoli­ neano la sosta e il ristoro. Tracciando la nuova viabilità sul versante orientale si determina un resto urbano dalla forma variamente articolata sui fronti esistenti, la FXLVROX]LRQHVDUjDI¿GDWDDOODVLVWHPD]LRQHGLXQD¿WWDYHJHWD]LR­ ne dalla densità quasi boscosa, anche a mitigare la presenza della spropositata torre residenziale al lato della Sede Municipale. Il fron­ te orientale diventa un fronte verde da cui è ipotizzabile tracciare XQVLVWHPHGL¿ODULDOEHUDWLFKHDWWUDYHUVDQGRLTXDUWLHULLQWHUPHGL raggiungano la linea di costa. Anche l’accesso al Palazzo della &XOWXUDYLHQHPRGL¿FDWRULGXFHQGROHVFDOLQDWHG¶LQJUHVVRHRUJD­ nizzando un nuovo giardino laterale, riportandolo ad una relazione di partità con la città. Descrizione del progetto Come precedentemente accennato, per esigenze gestionali dell’amministrazione la realizzazione dell’intervento sarà tempo­ ralizzata in tre fasi, ognuna delle quali è stata studiata in modo da poter essere attuata in autonomia rispetto a quella successiva. 5LTXDOL¿FD]LRQHGHOIURQWHRYHVW³LOEHOYHGHUH´ Cronologicamente è la prima parte del complesso di opere che viene realizzata. È strutturata su due livelli per un’estensione com­ plessiva di circa 3700 mq, lascia inalterata la funzionalità attuale della piazza. Infatti lo sbancamento preventivo eseguito alle pendici del promon­ torio, è molto arretrato rispetto alla attuale viabilità e si estende da VXGYHUVRQRUGGDOOHPXUDRWWRPDQHVLQRDOO¶HGL¿FLRGHOOD3UHIHWWX­ ra. Successivamente Questo fronte sarà occupato da una serie di episodi urbani allineati sul fronte stradale. Una prima gradinata che in corrispondenza delle mura serve l’ambito storico­naturalistico del promontorio e mette in collegamento con il “parco delle mura bizantine”. In questa porzione tra la nuova area pavimentata, alla TXRWDVXSHULRUHHLOERVFRYLHQHULTXDOL¿FDWRLOSLFFRORPDVWUDWH­ gico ambito attualmente segnato da un bar che seppur di scarso pregio architettonico è molto frequentato dato il particolare pregio del luogo. Si propone la ricostruzione dello stesso, secondo criteri DUFKLWHWWRQLFLSLDJJLRUQDWLVHSDUDQGROR¿VLFDPHQWHGDOOHPXUD ridando così continuità alle stesse. Si tratta infatti, di una piccola architettura molto trasparente realizzata in acciaio, completamente vetrata e contornata da alberi. In posizione laterale, non distante, YLHQHLQWURGRWWDXQ¶RSHUDG¶DUWHSHUORSLRUL]]RQWDOHDOOXVLYDGHOOD sosta, informa di carattere il posto e lo traduce in luogo. Realizzata in opera, formata da una serie di parallelepipedi disposti su una pianta quadrata si elevano in altezza da 35 a 70 cm e le cui su­ SHU¿FLYHUVRLOFLHORVRQRGHFRUDWHLQPRVDLFRDGLVHJQR HVHJXLWR dall’artista Nunzio di Stefano). La parte centrale del fronte, esteso nella dimensione della moschea, è risolto da una pensilina che al piano inferiore libera una serie di locali utili per attività culturali, mussali e ricettive, il cui fronte si offre alla piazza attraverso una FDQFHOODODLQDFFLDLRFRQ¿QLWXUDDGRWWRQHFKHULHGLWDXQPRWLYR moresco. La parte superiore, libera un’ampia terrazza, pavimentata in pietra di trani con ricorsi in travertino, dalla quale si gode un’ampia visuale GHOODSLD]]DVRWWRVWDQWH,OSDUDSHWWRUHDOL]]DWRLQFULVWDOORVWUDWL¿FD­ WRDPSOL¿FDODYLVLRQH 6XOODWRGHOOD3UHIHWWXUDXQDVHFRQGDVFDOLQDWDSLDPSLDDQFK¶HV­ VD¿QLWDLQSLHWUDULFKLXGHDQRUGLORFDOLVRWWRVWDQWLHFRQ¿JXUDXQR spazio di sosta sospeso tra la piazza e il promontorio. Lo spazio complessivamente è arredato con panche monolitiche di travertino, lampioni in acciaio dalla colorazione dorata dell’ottone, sistemi illuminanti segnapasso e gruppi di paletti illuminanti che la sera costituiscono un riferimento visivo per i passanti che si orientano YHUVRLOXRJKLSLVLJQL¿FDWLYL6RQRVWDWLDOWUHVuSUHGLVSRVWLGHL sistemi illuminanti ad incasso, nella terra per l’illuminazionione VFHQRJUD¿FDGHJOLDOEHULHGHOOHVLHSL/¶LQWHURVLVWHPDqDOOLQHDWR all’attuale posizione del marciapiede esistente. Sistemazione e arredo della piazza e nuova viabilità L’area è estesa per circa 11000 mq si estende dal Palazzo della Cultura al Palazzo Comunale nella direzione nord–sud e nel senso 285 trasversale, dalla moschea si inclina di circa mezzo metro verso un fronte edilizio variegato. Parzialmente riordinato dall’introdu­ zione della pensilina a terrazza. La forma scultorea (disegnata in collaborazione con l’artista), un EDVVRULOLHYRGLVWHVRQHOFHQWURGHOO¶LQWHUDVXSHU¿FLHUDFFRUGDOH differenze di livello generando delle incisioni che formano delle panche e zone concave vasche d’acqua dalla funzione decorati­ va e microclimatica. Realizzata in opera di cemento a vista, con XQD¿QLWXUDDQWLVGUXFFLRORWXWWLJOLVSLJROLHLJLXQWLVWUXWWXUDOLVRQR di ottone. Una delle vasche invece, curata personalmente dall’ar­ tista sarà rivestita in lamina di rame e successivamente stagnata a mano, secondo l’antica arte della stagnatura. Il bordo delle YDVFKHqVRWWROLQHDWRGDFDGLWRLHOLQHDULSHUORV¿RURGHOO¶DFTXD mentre a terra saranno predisposte caditoie ad hoc sempre in FHPHQWRGLSDUL¿QLWXUD7XWWDO¶DUHDRFFXSDWDGDTXHVWR³EDVVRUL­ lievo” è attraversata da vialetti trasversali, organizzati con panche in travertino, lampioni di illuminazione pubblica, alberature e UHODWLYDLOOXPLQD]LRQHFHVWLQLSRUWDUL¿XWLHFFOHVXSHU¿FLGLTXHVWL VHJPHQWLVRQRVRWWROLQHDWLSHUGLIIHUHQWH¿QLWXUDLQJKLDLDVWDEL­ lizzata nelle zone di percorrenza e sosta (i vialetti) e con grigliati G¶DFFLDLRHWHUUDVXOODWRGHOOHSLDQWXPD]LRQLDUERUHH9HUVRODWHU­ razza a ovest un’ampia fascia realizzata in cemento a vista colo­ rato scuro sottolinea la conclusione dell’opera e il passaggio della strada di servizio che continua verso il corso e in ultimo al mare. /DWHUDOPHQWHDOO¶RSHUDOHVXSHU¿FLVRQRSDYLPHQWDWHSULQFLSDO­ mente in pietra di trani montata a correre ma in alcuni episodi il disegno di questa è articolato con l’introduzione di fasce in traver­ tino. Sul lato del Palazzo Comunale un’ampia panca, realizzata di muratura e successivamente rivestita in travertino, ne sottolinea ODSUHVHQ]DFKHGLVHUDqUHVDDQFKHSLLQWHQVDGDOODSUHVHQ]D GLXQ¶LOOXPLQD]LRQHVFHQRJUD¿FDGHOODIDFFLDWDFRQODPSDGH incassate nel pavimento. Lo spazio antistante la sede Comunale è recintato da paletti dissuasori che “privatizzano” la viabilità di servizio e rappresentanza di accesso al Comune. Ampie aiuole sul lato orientale ospitano gruppi di cedri cono lo scopo di ridurre e mitigare, per quanto possibile, la presenza incombente del palazzo residenziale antistante, di recente costruzione. Sul lato GHO3DOD]]RGHOOD&XOWXUDSHUGDUHPDJJLRUHULVDOWRDOODVXSHU¿FLH della piazza e alla sua continuità, è stato ridotto il salto di quota attuale al piano di accesso, con conseguente riduzione della gradinata e guadagno di spazio di rispetto. La nuova viabilità su TXHVWRODWRqRUGLQDWDDOODVWHVVDTXRWDGHOODSLD]]D¿QLWDQHOOR stesso modo, in pietra di trani (di spessore superiore) sottoline­ ata solo dalla presenza di fasce in travertino a terra e dei paletti dissuasori in acciaio. Il sistema della viabilità, raccoglie le istanze indicate nel nuovo PRG ma in corrispondezza della piazza (fronte nord e est) le strade salgono al livello della piazza con conse­ guente limitazione della velocità di percorrenza. Se ne ottiene un VLVWHPDFKHSULYLOHJLDO¶XVRSHGRQDOHGHOODVXSHU¿FLHDYDQWDJJLR di tutte le categorie di fruitori anche meno abili, bambini, anziani e disabili. Così senza perdere l’opzione dell’attraversamento si ottiene uno spazio complesso ma sicuro, libero da impedimenti dove la gente si riappropria della città. Le pavimentazioni delle strade sono realizzate in pietra di trani, con basole di spessore superiore (6cm) e le rampe di accesso carrabile sono in cemento colorato stampato a righe, agisce come segnalatore sonoro di attraversamento invitando a ridurre la velocità. Gli elementi di ¿QLWXUDVRQRVWDWLVWXGLDWLDGKRFOHFDGLWRLHVRQR¿QLWHLQSLHWUD di trani forata alla sega nelle direzioni del montaggio del pavi­ mento, le panche sono di tipo monolitico realizzate in travertino, i lampioni in acciaio dalla colorazione dorata dell’ottone, sistemi illuminanti segnapasso e gruppi di paletti illuminanti che la sera costituiscono un riferimento visivo per i passanti che si orientano YHUVRLOXRJKLSLVLJQL¿FDWLYL6RQRVWDWLDOWUHVuSUHGLVSRVWLGHL sistemi illuminanti ad incasso, nella terra per l’illuminazionione VFHQRJUD¿FDGHJOLDOEHULHGHOOHVLHSLHGHOOHIDFFLDWHGHLSDOD]]L importanti. Sul fronte orientale, unico elemento emergente, è la pensilina lineare calpestabile. Come accennato questo elemento compositivo trae spunto da certe indicazioni contenute nel PRG del ’42 che prevedevano su questo fronte la realizzazione di un HGL¿FLROLQHDUHSRUWLFDWR6HQHSURSRQHLQTXHVWRSURJHWWRXQD versione alleggerita ma che svolge lo stesso ruolo di geometriz­ zazione del fronte, con la differenza che il piano superiore è cal­ 286 pestabile e si offre alla piazza come un’ulteriore terrazza, contrappo­ sta a quella della Moschea, servita da un piccolo punto di ristoro, un luogo privilegiato dal quale godere la vita che si svolge in piazza, e al piano inferiore dotata di un infopont per l’orientamento dei turisti e il ULVWRURGXUDQWHODVWDJLRQHHVWLYDYLVWRO¶DPSLDVXSHU¿FLHRPEUHJJLD­ ta. Realizzata in acciaio, è una struttura molto trasparente, una sorta di diaframma tra lo spazio della piazza e il giardino retrostante, è allestita con un ascensore di servizio al piano superiore oltre ad una JUDGLQDWDWUDGL]LRQDOHHVWHUQD'RWDWDGLEDJQLDGHQWUDPEHLSLDQLOH VXSHU¿FLVRQRDPSLDPHQWHYHWUDWHHVFKHUPDWHFRQIUDQJLVROHOLJQHL Il piano superiore è in cemento a vista. Nuovo assetto delle aree archeologiche Sul lato settentrionale, già occupato da alcuni scavi archeologi che KDQQRHYLGHQ]LDWRODSUHVHQ]DGLXQ0DFHOOXP±)RUXPFLUFRODUH e di alcuni vani pertinenti a Terme Pubbliche che continuano verso sud, sotto il Palazzo della Cultura, la piazza viene strutturata con un siatema di terrazzamenti che scende verso le stesse evidenze DUFKHRORJLFKH,OIURQWHVXOODVWUDGDq¿QLWRFRQDLXROHHSLDQWXPD­ zioni arboree. L’accessibilità è consentita anche in quota con una passerella che consente un’osservazione panoramica delle emer­ genge: viene così realizzato un piccolo parco archeologico, una sorta di “museo urbano” all’aria aperta attraverso cui è possibile leggere ODVWRULDVWUDWLJUD¿FDGHOODFLWWjWXWWDO¶DUHDDGLDFHQWHDGHVWDOOH strutture antiche è lasciata libera per eventuali ed ulteriori amplia­ menti degli scavi con nuove campagne di indagine archeologica. Il VXRSHULPHWURYLHQHDOODUJDWRHUL¿QLWRDLERUGLFRQXQDVLHSHFKHQH riordina l’attacco alla città. Ciò è consentito dal riordino della viabilità esistente riducendola a semplice penetrazione per i residenti degli HGL¿FLFRQWHUPLQL&RQQHVVRFRQLOSDUFRDUFKHRORJLFRSHUXQDSL facile lettura degli aspetti di vita quotidiana dell’antica città e per integrare le conoscenze storiche, si potrà eventualmente predisporre, un esposizione permanente ma in continuo sviluppo di quei materiali archeologici che gli scavi fanno emergere e che maggiormente attira­ no la curiosità di chi visita i siti archeologici. In continuità con questa area, sul lato opposto del Palazzo della Cultura, viene sviluppato XQRVSD]LRLPPDJLQDWRÀHVVLELOHSHUFRQVHQWLUHO¶HYHQWXDOHVYLOXSSR degli scavi. È infatti realizzato con materiali poveri, il cemento per le pavimentazioni e ampie aiuole popolate da alberi. Un’architettura “reversibile” sempre pronta a lasciar spazio a ulteriori indagini arche­ ologiche. A questo lato della piazza viene idealmente unito attraverso un percorso guidato il settore nord dove, anche se al di fuori della VWHVVDVLWURYDQRLUHVWLGHOO¶$Q¿WHDWURURPDQRGLHSRFDDGULDQHD ,, VHFG& XQDYROWDULSXOLWRGDJOLHGL¿FLIDWLVFHQWLFKHYLVLDGGRVVDQR HUHVWDXUDWRDQFKHO¶DQ¿WHDWURSRWUjHVVHUHXVXIUXLELOHULDFTXLVWDQGR così la propria importanza storica ed inserendosi all’interno della città moderna che si ristruttura sull’antico impianto urbanistico generale della città antica orientato Nord/sud.(come ipotizzato per la scoperta GHOSUREDELOH'HFXPDQRVRWWRLO3DOD]]RGHOOD&XOWXUD ,OWUDFFLDWRq messo in atto dalla variazione di inclinazione della posa delle pietre GHOSDYLPHQWRGHOODSLD]]DHGDXQDVXDGLYHUVD¿QLWXUDVXSHU¿FLDOH Per quanto riguarda le Mura Bizantine, che si trovano ai margini meridionali della piazza, anch’esse vengono connesse alle altre evi­ denze archeologiche e rese fruibili attraverso camminamenti laterali che riproducono quelli di ronda superiori in parte ancora percorribili: il WUDWWRYHUVRHVWGRYHQRQVRQRSLFRQVHUYDWHYLHQHULFRUGDWRFRQXQ tracciato ipotetico che idealmente le unisce all’antica Torre dell’Orolo­ gio di cui facevano parte. Condizioni ambientali, ecologiche e di paesaggio L’area si presenta sostanzialmente in piano, tranne che per il suo lato RFFLGHQWDOHLQOHJJHURGHFOLYLR'DWDOHERUGRSDUWHLQIDWWLODULVDOLWD del fronte collinare che poi conduce alla quota maggiore, parte del 3URPRQWRULR'XUD]]LDQRFKHSUHVHQWDTXRWHPDJJLRULQHOORVYLOXSSR del sistema collinare a Nord. Tale fronte si caratterizza per la presen­ za di una discreta copertura vegetale, formata da essenze tipiche del luogo, caratteristiche del paesaggio costiero mediterraneo. La piazza presenta anche al suo interno una modesta copertura arborea. I ERUGLGHOOHVWUDGHVRQRRUQDWLGD¿ODULGLOLJXVWULHGDOHFFLHGDDOWUH specie vegetali arboree endemiche. Attorno al Palazzo della Cultura è presente una vegetazione fatta di siepi ornamentali (allori, pitosfori, ligustri, altre essenze) e alcuni alberi ad alto fusto (in prevalenza lecci). La Piazza e’ inoltre suddivisa in due da un ampio spazio ombreggiato da alcuni alti cedri del Libano, in buone condizioni vegetative. Sistema del verde Piazza liria di ampio respiro è in realtà soffocata rispetto alle sue componenti territoriali che la includono: la costa le colline LO3URPRQWRULR'XUD]]LDQRGRYHLQVHGLDPHQWLQRQSLDQL¿FDWL LQFRPERQRVXOFHQWURDQWLFRGL'XUD]]RHFRQIHULVFRQRDVSLDJJH HFRVWDXQD¿VLRQRPLDXUEDQDFKHQRQHYRFDSHFXOLDULWjSRVLWLYH nel contesto mediterraneo. Il binomio natura­cultura, e quindi il richiamo di un turismo culturale e ambientale, costituirebbe un messaggio positivo per l’immagine della piazza, oltre a valorizzarne gli usi da parte dei cittadini e dei residenti. L’interazione uomo­ambiente, deve essere funzione del linguag­ gio del territorio che veicola i valori della comunità che lo abita e ne trasmette l’identità a chi vi si reca. La nuova organizzazione dello spazio pubblico si dirige verso la capacità di “recupero” di FRQQHWWLYLWjWHUULWRULDOHHGHFRORJLFDDO¿QHGLIDYRULUHO¶DUPRQL]]D­ ]LRQHWUDWHUULWRULRDSHUWRHWHUULWRULRFRVWUXLWR$WDO¿QHVLULWLHQH prioritaria una riconnessione ecologica tra le pendici collinari su cui risale la città, verso est, e i quartieri che occupano la piana al­ OXYLRQDOH¿QRDOEDFLQRSRUWXDOHHDOODIDVFLDFRVWLHUD(¶SUHYLVWD la quasi totale ripiantumazione degli alberi esistenti in particolar modo degli 8 Cedri del Libano che si trovano al centro della piaz­ za esistente delle palme che circondano il palazzo della cultura come anche dei ligustri e dei lecci che bordeggiano le strade. Fronte ovest “il belvedere” Tale fronte si caratterizza per la presenza di una discreta copertu­ ra vegetale, formata da essenze tipiche del luogo, caratteristiche del paesaggio costiero mediterraneo. Il nuovo disegno dell’area con la terrazza “belvedere” tende a mantenere sostanzialmente invariato lo stato attuale prevedendo una ripiantumazione degli alberi esistenti sempreverdi a “monte” (Cedrus libani, Cupressus sempervirens, Quercus ilex, Pinus, Ligustrum) ed introducendo una nuova piantumazione di specie di medie dimensioni non sempreverdi dell’area (Pistacia terebin­ WKXV$UEXWXVXQHGR QHOOH¿RULHUHULFDYDWHQHOODSDYLPHQWD]LRQH della terrazza. La “piazza” Nella piazza lo spazio dato alla vegetazione è in funzione da una parte dell’ombreggiatura delle panchine e dei luoghi di sosta, GDOO¶DOWUDFRPHPLWLJDWXUDGLHGL¿FLHVLVWHQWL1HOODVHULHGLDLXROH ai lati della scultura di “Nunzio” verranno ripiantumati alberi sem­ preverdi già presenti nell’area, in particolare i Cedri del Libano che si trovano al centro della piazza attuale. Nelle vasche di terra al centro della piazza everranno piantumati degli alberi di media dimensione non sempreverdidell’area (Pistacia terebinthus, Arbu­ tus unedo) e degli arbusti sempreverdi (Nerium oleander). Nelle ¿RULHUHFKHFRVWHJJLDQRODVWUDGDGHOIRUREL]DQWLQRYHUUDQQR ripiantumati dei ligustri e in tutta l’area che circonda il palazzo della cultura saranno ripiantumate essenze già presenti nell’area. Per quanto riguarda invece il perimetro della zona archeologica del foro bizantino sarà mitigato da siepi di alloro. Fronte est Per il fronte opposto alla moschea si prevede il ripristino della ÀRULGDSLQHWDFKHRFFXSDYDLQDQWLFKLWjO¶DUHDFKHYDGDOODSLD]]D DOEDFLQRSRUWXDOHHDOODIDVFLDFRVWLHUD9HUUDQQRULSLDQWXPDWLH integrati i Pini esistenti. Qualche arbusto sempreverde (Nerium oleander) inoltre sarà piantumato in ordine sparso fra i viottoli in ghiaia stabilizzata. Quest’area verde ad est ha la funzione di climatizzazione rispetto all’aerosol marino che vi entra dal fronte marino. Sostenibilità ,O¿QHXOWLPRGHOSURJHWWRROWUHFKHHVWHWLFDqVRSUDWWXWWRHWLFDFRQ incremento della mobilità ciclo pedonale urbana, con riduzio­ ne della Co2 da parte dei vegetali, diminuzione del consumo energetico per la climatizzazione (protezione verso il vento, 288 raffreddamento per aumento evapo traspirazione, ombreggia­ mento), diminuzione inquinamento acustico, migliora la qualità dell’aria (qualità atmosferica e cattura delle particelle), opera per il recupero estetico degli spazi degradati, minor consumo idrico, maggiore permeabilità dei suoli. Sono questi alcuni degli aspetti peculiari di una presenza ricca, in termini di qualità e quantità degli spazi, all’interno dell’ambiente urbano. 0DWHULDOLH¿QLWXUH La concezione del progetto è nello spirito minimalista, di una cosa su l’altra. Il materiale usato per le pavimentazioni è la pietra GL7UDQLWUDWWDWDLQVXSHU¿FHPHGLDQWHSURFHGLPHQWRGLERFFLDU­ datura, il disegno prevalentemente “correre” è però impreziosito dall’utilizzo di differenti formati e l’inserimento di pezzi a differente ¿QLWXUDVXSHU¿FLDOH$QFKHSHURWWHQHUHXQHIIHWWRRSSRVWRDOOD VWUXWWXUDSL³PRQROLWLFD´GHO³WDVVHOORVFXOWRUHR´/HFDGLWRLHVWHV­ se sono in pietra di Trani. I ricorsi in pietra di Trani a correre sono intervallati da cordoli in travertino. Le panche sono realizzate con un monolite di travertino. L’acciaio verniciato è usato come ¿QLWXUDGLWXWWLJOLHOHPHQWLPHWDOOLFLGLDUUHGRLODPSLRQLDOFXQL parapetti e i giunti delle pavimentazioni. Per quanto riguarda la realizzazione della scultura di Nunzio (Senza Titolo) si prevede la realizzazione delle intere partiture, mediante colatura in opera di uno speciale impasto cementizio, all’interno di un’apposita centinatura di riferimento, che funge anche da giunto elastico. Successivamente, ma con procedimento “fresco su fresco” ven­ JRQRUL¿QLWHOHVXSHU¿FLSHURIIULUHPDVVLPDFRQWLQXLWjHOLVFLDWXUD Una delle vasche inoltre verra sottoposta da Nunzio ad un proce­ GLPHQWRGLVWDJQDWXUDFKHDPSOL¿FKHUjLULÀHVVLHOHULIUD]LRQL La fascia nera è realizzata con una mescola a base cementizia colorata. Inoltre, aspetto altamente rilevante ma apparentemente banale, è che sulla scultura ci si possa camminare o sedere (grazie ai bordi che si incidono sul piano della piazza) e quindi consente alla scultura orizzontale di mutuare l’equilibrio ambiguo ed ambivalente tra i percorsi e le zone di sosta. La debolezza iniziale di uno stato di ambiguità e contraddizione dell’area stessa qVWDWD¿QDOPHQWHWUDVIRUPDWDLQULFFKH]]DGLVLJQL¿FDWLGHOO¶LQWHUD opera. In tema di “sicurezza” del pedone si rende noto che in qualsiasi angolo di sezione della pavimentazione le pendenze sono ben al di sotto di quelle stabilite nella normativa vigente. a) pavimentazioni ­ lastre di pietra di Trani: spessore 5­6 cm, dimensione 20­30­50 FPOXQJKH]]DDFRUUHUH &RUGROLLQWUDYHUWLQRGLPHQVLRQL[ ­ Ricorsi in travertino, spessore 5 cm, dimensione 20cm, lunghez­ ]DDFRUUHUH *KLDLDVWDELOL]]DWDDOOHWWDWDVXPDVVHWWRGLFHPHQWR &HPHQWR³IUHVFRVXIUHVFR´¿QLWXUDFRQLQHUWLGLTXDU]LWH FRORUDWRVHFRQGROHLQGLFD]LRQLGLSURJHWWR¿QLWXUDVXSHU¿FLDOH OHYLJDWRVWDPSDWRULJDWR b) rivestimenti ­ Rivestimento delle sedute in marmo travertino, spessore 3 cm, GLPHQVLRQLDGLVHJQR ­ Rivestimento dell’intradosso della terrazza “belvedere” in mosai­ co in pasta di vetro trasparente, dimensioni 2x2cm. ­ Rivestimento caffetteria delle “mura” in lastre di acciaio vernicia­ WRVSHVVRUHGLPHQVLRQHDGLVHJQR c) arredo urbano ­ apparecchi per esterno costituiti da pali in acciaio verniciato, altezza 400 e 500 cm (tipo “BEGA 8877, 8879”), con lampada ÀXRUHVFHQWH ­ corpi illuminanti da terra (pavimento) in alluminio, cornice in DFFLDLRLQR[YHWURWHPSUDWRGLFKLXVXUD WLSR³/,*+783:$/. L*8==,1,´ GLPHQVLRQLFPFRQODPSDGDDOHG ­ corpi illuminanti da terra in alluminio, cornice in acciaio inox, YHWURWHPSUDWRGLFKLXVXUD WLSR³/,*+783L*8==,1,´ GLPHQVLR­ QLFPFRQODPSDGDÀXRUHVFHQWH ­ apparecchio di illuminazione a luce diretta da camminamento in DOOXPLQLRYHUQLFLDWR WLSRL:D\L*8==,1, DOWH]]DFPGLIIXVRUH LQSROLFDUERQDWRFRQODPSDGDDOHG FHVWLQLSRUWDUL¿XWLLQODPLHUDG¶DFFLDLR]LQFDWRHYHUQLFLDWR WLSR³0(7$/&263(1&(5´ GLPHQVLRQL+ FP‘FP ­ dissuasori acciaio verniciato (tipo “METALCO GENESIS”), GLPHQVLRQL+ FP‘FP ­ dissuasori a scomparsa in acciaio verniciato (tipo “METALCO MAGIC”), sistema di movimentazione con pistone a gas, dimen­ VLRQL+ FP‘FP IRQWDQHOODLQDFFLDLRYHUQLFLDWR WLSR³0(7$/&2)8(17(´  GLPHQVLRQL+ FP‘FP VDOYDSLDQWHLQFHPHQWRDUPDWR WLSR³0(7$/&2(6&2)(7 &$50(/´ GLPHQVLRQL‘FP ­ panche in monolite di travertino, come da disegno, con piano VXSHULRUHOHYLJDWR 9DULD]LRQLDOOHLQGLFD]LRQLFRQWHQXWHQHOSURJHWWRGH¿QLWLYR Sulla base delle necessità dell’Amministrazione espresse dal 583LQJ$GULDQ&HODLOSURJHWWRGH¿QLWLYRqVWDWRVYLOXSSDWR in tre distinte fasi di realizzazione che eventualmente saranno redatte in esecutivo per diventare oggetto di appalto autonomo. È stato aggiornato il progetto della terrazza belvedere, ridotta la VXSHU¿FLHGHOODWHUUD]]DDIDYRUHGHOO¶LQWURGX]LRQHGLGXHDPSLH scalinate in corrispondenza delle mura ottomane e del palazzo della Prefettura. Sul lato orientale, la struttura alberghiera propo­ sta nel concorso è stata sostituita da un elemento porticato che contiene un infobox e un piccolo punto ristoro. È stata allargata O¶DUHDGHJOLVFDYL¿QRDFRPSUHQGHUHO¶LQWHURFHUFKLRGHOIRUR EL]DQWLQRVSRVWDQGRODYLDELOLWjVXOODWRRSSRVWRHODUHODWLYD¿OD di parcheggi. Soluzioni per il superamento barriere architettoniche ,OSURJHWWRSUHYHGHODUHDOL]]D]LRQHGLVXSHU¿FLSDYLPHQWDWHDO livello piazza, completamente accessibile secondo Legge 13/89 dello stato italiano e con la possibilità di un’agevole fruizione degli spazi verdi e di si sosta. Sono garantiti gli spazi minimi di manovra per la circolazione ed il passaggio delle sedie a ruote onde superare le barriere architettoniche. (OHQFRHODERUDWLGHOSURJHWWRGH¿QLWLYR '$,QTXDGUDPHQWRXUEDQLVWLFR '$3ODQLPHWULDJHQHUDOHVWDWRGLIDWWR '$3ODQLPHWULDJHQHUDOHLQGLYLGXD]LRQHGHOOHIDVLG¶LQWHUYHQWR '$3ODQLPHWULDJHQHUDOHYLDELOLWjHSDUFKHJJL '$3ODQLPHWULDJHQHUDOHVLVWHPDGHOYHUGH '$3ODQLPHWULDJHQHUDOHDUUHGRXUEDQR '$3ODQLPHWULDJHQHUDOHHSUR¿OLORQJLWXGLQDOLHWUDVYHUVDOL '$3LDQWDJHQHUDOHVWUDOFLRQƒ '$D3LDQWDJHQHUDOHVWUDOFLRQƒ '$E3LDQWDJHQHUDOHVWUDOFLRQƒ '$F3LDQWDJHQHUDOHVWUDOFLRQƒ '$G3LDQWDJHQHUDOHVWUDOFLRQƒ '$H3LDQWDJHQHUDOHVWUDOFLRQƒ '$I3LDQWDSURVSHWWRHVH]LRQHGHOODWHUUD]]D³%HOYHGHUH´ '$3LDQWDSURVSHWWRHVH]LRQHGHOODFDIIHWWHULDGHOOH³0XUD´ '$3LDQWDSURVSHWWRHVH]LRQHGHOSRUWLFRODWRHVW´ '$9LVWHSURVSHWWLFKH³$´ '$9LVWHSURVSHWWLFKH³%´ '$9LVWHSURVSHWWLFKH³&´ '55HOD]LRQHJHQHUDOHWHFQLFRLOOXVWUDWLYD '55HOD]LRQHWHFQLFRVSHFLDOLVWLFD '5&RPSXWRPHWULFRHVWLPDWLYR 289 290 291 6. Assessment, outcomes, prospects/ Bilanci, esiti, prospettive 6.1 Una strategia per la città/A strategy for the city Luca Zevi, architect/architetto Chairman of the International Jury/Presidente della Giuria Internazionale ,1$5&+ ,VWLWXWR1D]LRQDOHGL$UFKLWHWWXUD5RPD ,WDOLD National Institute of Architecture), Roma (Italy) Il concorso internazionale per la risistemazione di piazza Illiria a 'XUD]]RVLLQVHULVFHLQXQDVWUDWHJLDXUEDQLVWLFDGLOXQJRUHVSL­ ro elaborata dall’Amministrazione Comunale in carica, mirata a cercare di regolare uno sviluppo della città che, a partire dall’ultimo GHFHQQLRKDFRQRVFLXWRXQDFUHVFLWDGHPRJUD¿FDHTXLQGLHGLOL]LD tumultuosa. Il primo passo di questa strategia è stato segnato da un altro impor­ tante concorso internazionale, relativo all’elaborazione di un piano urbanistico dell’area portuale. Il progetto risultato vincitore, caratte­ UL]]DWRFRQWHPSRUDQHDPHQWHGDULJRUHHÀHVVLELOLWjKDSHUPHVVR di orientare le iniziative edilizie nell’area centrale, in collaborazione con la missione archeologica italiana incaricata di valorizzare le importanti testimonianze antiche presenti nel bel mezzo del tessuto storico urbano. E’ sembrato naturale all’Amministrazione Comunale, lungo questo SHUFRUVRGLSLDQL¿FD]LRQHSHQVDUHFRPHVHFRQGDWDSSDVLJQL¿FD­ WLYDDOODULFRQ¿JXUD]LRQHGHOODSLD]]DFHQWUDOHGHOODFLWWjSLD]]D,OOL­ ria. E di farlo ancora una volta attraverso un concorso internaziona­ le mirato a un confronto fra le migliori energie progettuali disponibili. La risposta non è mancata, attraverso le molte proposte pervenute da vari angoli d’Europa. A selezionare le offerte migliori è stata invitata una giuria internazio­ nale comprendente tutte le competenze coinvolte nella complessità del progetto: architettura, paesaggistica, archeologia, trasportistica. 'RSRXQDWWHQWRHVDPHODJLXULDKDVFHOWRXQGLVHJQRFKHqSDUVR meritevole di risultare vincitore per alcune qualità: la creazione di un grande invaso pedonale a servizio della vita sociale cittadina, DQ]LWXWWRLQVHFRQGROXRJRODFDSDFLWjGLFROOHJDUHHI¿FDFHPHQWHOH principali funzioni circostanti il grande invaso urbano, dall’importante area archeologica limitrofa alla soprastante moschea. Particolarmente apprezzata è stata proprio la soluzione proposta per la moschea, mirata non semplicemente a renderla facilmente raggiungibile, ma a dotarla di una vera e propria piazza sopraele­ vata capace di romperne l’isolamento, da una parte, di articolare altimetricamente piazza Illiria in sistema complesso di spazi urbani, 298 The international competition for the rehabilitation RI,OO\ULDVTXDUHLQ'XUUHVLVSDUWRIDORQJWHUP planning strategy prepared by the Municipal $GPLQLVWUDWLRQRI¿FHDLPHGWRWU\WRUHJXODWHWKH development of a city that, since the last decade, has known a tumultuous demographic and building grown. 7KH¿UVWVWHSRIWKLVVWUDWHJ\KDVEHHQPDUNHGE\ another important international competition about the preparation of an urban plan of the port. The winner project, characterized by both rigor and ÀH[LELOLW\KDVDOORZHGXVWRRULHQWLQWKHFHQWUDO building initiatives, in collaboration with the Italian archaeological mission that was responsible for enhancing the important ancient testimonies in the middle of the historic urban texture. ,WµVVHHPHGQDWXUDOWRWKHPXQLFLSDODGPLQL­ stration, along this route planning, thinking, as a VHFRQGVLJQL¿FDQWVWHSWKHUHFRQ¿JXUDWLRQRIWKH city’s central square, Illyria square. And to do it again through an international competition aimed to compare the best available design skills. The answer is not failed, through the many proposals received from various corners of Europe. To select the best deal was invited an internatio­ nal jury, which included all the skills involved in the complexity of the project: architecture, lan­ dscape, archeology, transport terms. After careful examination, the jury chose a design that seemed WREHDZRUWK\ZLQQHUIRUFHUWDLQTXDOLWLHV¿UVW the creation of a large pedestrian reservoir to serve the city social life, second, the ability to connect the main functions surrounding the big city to the important archaeological site adjacent to the mosque above. Particularly appreciated was the solution for the mosque, which is not aimed simply to make it easy to reach, but to provide it with a real square À\RYHUDEOHWREUHDNWKHLVRODWLRQRQWKHRQH hand, to articulate altimetrically Square Illyria in a complex system of urban areas, on the other, and ¿QDOO\JLYHWRWKHXUEDQVSDFHEHORZDQDUFDGH built on the basement of the mosque square, on GDOO¶DOWUDHGLGRWDUHLQ¿QHLOVRWWRVWDQWHVSD]LRXUEDQRSULQFLSDOHGL un percorso porticato, ricavato nel basamento della piazza della mo­ schea, sul quale si aprono negozi e locali di ritrovo chiamati a animare TXHVWRVDORWWRGHOOD'XUD]]RGHOWHU]RPLOOHQQLR Alla capacità di bandire e portare a termine in breve tempo il concorso internazionale ha fatto seguito, all’indomani della proclamazione del progetto vincitore, il conferimento dell’incarico per l’elaborazione della SURJHWWD]LRQHGH¿QLWLYDHHVHFXWLYDHO¶DYYLRSHUVWUDOFL±LOSULPRGHL quali relativo proprio alla piazza alta prospiciente la moschea – della realizzazione. 1HOULQJUD]LDUHGXQTXHO¶$PPLQLVWUD]LRQH&RPXQDOHGL'XUD]]RSHU l’onore attribuitomi con la nomina a membro di una commissione giu­ dicatrice così prestigiosa, rivolgo all’Amministrazione stessa i migliori auguri per una felice e rapida conclusione dei lavori di piazza Illiria e, SLLQJHQHUDOHSHUXQRVYLOXSSRHTXLOLEUDWRGHOODFLWWjGL'XUD]]RDO quale tanto impegno e energia sono stati dedicati negli ultimi anni. which there are shops and meeting places that DUHFDOOHGWRDQLPDWHWKLVORXQJHRI'XUUHVRIWKH third millennium. The ability to ban and complete in a short time the international competition was followed, after the proclamation of the winning project, by the HQWUXVWPHQWIRUWKHSUHSDUDWLRQRI¿QDODQG executive design and for start­up of extracts ­ the ¿UVWRIWKHPUHODWLYHWRWKHVTXDUHRYHUORRNLQJWKH mosque ­ for the realization. ,QWKDQNLQJWKH0XQLFLSDOLW\RI'XUUHVIRUWKH honor given to me with his appointment as a member of such a prestigious jury, I extend my best wishes for a happy and speedy conclusion of the work of Illyria square and in general, for a ba­ ODQFHGGHYHORSPHQWRIWKHFLW\RI'XUUHVWRZKLFK so much effort and energy have been devoted in recent years. Luca Zevi 'XUUHV6HSWHPEHUJHQHUDOYLHZRIWKHFLW\IURPDVN\VFUDSHURQWKH6RXWKHUQ:DWHUIURQWDurazzo, settembre 2008, veduta della città da un grattacielo del waterfront meridionale 299 7RURQWR DERYH DQG'XUUHV EHORZ FRPSDULVLRQDWWKHVDPHVFDOH WKHLPDJHVVKRZVNPRIZDWHUIURQW Toronto (sopra) e Durazzo (sotto): comparazione alla stessa scala (le immagini mostrano 10 km di waterfront) 6.2 Memories about Durres and his square/ Memorie di Durazzo e della sua piazza Rocco Maragna, architect/architetto Member of the International Jury/Membro della Giuria Internazionale MOAA, MRAIC The desire to transform Liria Square was a manifestation of the DVSLUDWLRQVRIWKHFLWL]HQVRI'XUUHVWRUHLQIRUFHWKHLUSODFHZLWKLQ their state and within the larger community of the Adriatic Sea. It was an honour to have been invited to participate in the jury that would eventually select a winning scheme. In considering the task whose outcome would leave a physical legacy on the urban fabric of the city, I began the search to familiarize myself with the place, from my city of Toronto. Any city is more than the sum total of its functions. It is more than its infrastructure systems. It is a place of and for its people. It is that artifact that allows humanity to partake in the totality of its social, political, economical and spiritual orders. )RUDOORIWKLVWRWDNHSODFHWKHFLW\KDVGHYHORSHGXUEDQFKDUDF­ WHULVWLFVWKDWDUHUHÀHFWHGLQWKHFROOHFWLRQRIEXLOGLQJVDQGXUEDQ spaces. With all of its complexities, the city constantly exhibits a miraculous existence in its operation. More often than not cities develop like phantoms with no direction in sight. And those who follow this dictum do little to enhance the total image of the city. The interests of contemporary functionalism, plundered by unscrupulous speculators give rise to banal and anonymous urban landscapes. The ultimate measure of an act of urban intervention of qualitative YDOXHFDQRQO\EHPHDVXUHGZLWKWLPH+RZPDQ\RIWKHVHXQGHUWD­ kings will become emblematic of an era and how fewer, will at best, become ruins for future generations to decipher the dreams and the LPDJLQDWLRQVRIWKHSDVW" These thoughts and more occupied my time as the endless drone RIWKHÀ\LQJEHKHPRWKFURVVHGWKH$WODQWLFWRZDUGV$OEDQLD:KLOH above the clouds I read the few factual notes that I had jotted down about the place that I was heading towards. But somehow the facts offered hardly any indication of what to expect and how to conduct myself. Therefore, I put the notes away, with the professional thoughts in abeyance, and visited my memories of my existence hoping that VRPHZKHUH,ZRXOG¿QGDIHZWKUHDGVWKDWZRXOGDVVLVWP\VHQVHV in connecting with the task that was waiting. Il desiderio di trasformare la piazza Liria è una DVSLUD]LRQHGHLFLWWDGLQLGL'XUD]]RWHVDD rafforzare il loro posto all’interno del loro Stato HDOO¶LQWHUQRGHOODSLDPSLDFRPXQLWjGHO0DUH Adriatico. E’ stato un onore, per me, essere invitato a partecipare alla giuria che avrebbe se­ lezionato il progetto vincitore del concorso per la nuova piazza. Considerando l’importanza di tale l’attività, il cui esito avrebbe lasciato una eredità ¿VLFDVXOWHVVXWRXUEDQRGHOODFLWWjKRFRPLQFLDWR una ricerca per familiarizzare con il luogo, pur a distanza, dalla mia città di Toronto. 2JQLFLWWjqSLGHOODVRPPDGHOOHVXHIXQ]LRQL(¶ SLGHLVXRLVLVWHPLGLLQIUDVWUXWWXUH2JQLFLWWjq un luogo della e per la sua gente. È quel manufat­ to che permette all’umanità di partecipare alla totalità degli ordini sociali, politici, economici e spirituali. Per tutto questo ogni città ha sviluppato FDUDWWHULVWLFKHXUEDQHSURSULHFKHVLULÀHWWRQRQH­ JOLHGL¿FLHQHJOLVSD]LXUEDQL1HOOHVXHFRPSOHV­ sità, la città esibisce costantemente il miracolo YLWDOHGHOVXRIXQ]LRQDPHQWR3LVSHVVROHFLWWj si sviluppano come fantasmi senza una visione di riferimento. Nelle città che seguono questo dictum, si fa ben poco per migliorarne l’immagi­ ne complessiva. Gli interessi del funzionalismo contemporaneo ed il saccheggio da parte di speculatori senza scrupoli dà luogo a paesaggi urbani banali e anonimi. /DTXDOLWj¿QDOHGLXQLQWHUYHQWRXUEDQLVWLFRSXz essere misurato soltanto con il tempo. Quante di queste imprese diventeranno emblema di un’epoca storica, e ancor meno, nella migliore delle ipotesi, quante di queste diventeranno rovine utili a decifrare, per le generazioni future, I VRJQLHOHIDQWDVLHGHOSDVVDWR" Questi pensieri ed altri hanno occupato il mio WHPSRPHQWUHLOGURQHLQ¿QLWRGHOFRORVVRYRODQWH attraversava l’Atlantico verso l’Albania. Mentre, sorvolando le nuvole, leggevo gli appunti che DYHYREXWWDWRJLULJXDUGRDOOXRJRYHUVRLOTXDOH mi stavo dirigendo, non avevo quasi nessuna indicazione di cosa mi aspettasse e di come PLVDUHLRULHQWDWR'LFRQVHJXHQ]DPLVLYLDJOL appunti, sospesi le mie preoccupazioni professio­ nali, e passai ai ricordi della mia esistenza nella speranza che da qualche parte potessi trovare qualche legame con il compito che mi stava aspettando. Il mio pensiero ritorna a due parti­ 301 0\WKRXJKWVFDPHWRUHVWRQWZRPQHPRQLFPRPHQWV7KH¿UVWEHLQJ the stories that I heard, as a little boy, from returning visitors to Albania and the second from Canadians of Albanian background, who like me, KDGVHWWOHGLQRXUDGRSWHG&DQDGD)URPERWKRIWKHVHRUDOQDUUDWL­ ves, albeit decades apart, emerged a “feeling” about the place that I ZDVDERXWWRYLVLWIRUWKH¿UVWWLPH Upon arrival and prior to the beginning of the deliberations I toured Liria Square and its adjacent areas. I marveled at the layering of histo­ rical interventions and was particularly struck by the publicness of the space and its sense of social relevancy. ,SHUFHLYHGWKHVTXDUHDVWKHNH\HOHPHQWWKDWGH¿QHVWKHFLW\,WLV a three dimensional space as a result of its location on the sloping terrain. It is a crossroad that bonds the sea on one side and the hin­ terland beyond the hills. It is a landing of a great staircase that allows a user to change direction, to wait and observe, to meet and partake in the social life. I observed seniors with their grandchildren under the shade of the SLQHWUHHV,QRWHGWKHHQHUJHWLF\RXWKVVFXUU\LQJDORQJWKHµFRUVR¶WR the waterfront ready to shape and be shaped by what is to come in the context of a global reality. At the waterfront as I smelled the sea salt and enjoyed the rolling waves I noticed the speculative plundering of that most valuable urban asset. Alas, dwelling on this latter obser­ vation was not the raison d’être’ of being here. It was time to begin our deliberations. More than 30 submissions, from many parts of the world, confronted each of us as members of the jury. Each of the submissions purpor­ ted, according to its author, a potential valuable idea. In evaluating the ¿UVWURXQGVXEPLVVLRQ,VHOHFWHGWKRVHWKDWDGGUHVVHGLVVXHVVXFK as: urban morphology, symbolic association and historical continuum. (DFKRIWKHRWKHUVL[PHPEHUVKDGPDGHWKHLURZQVHOHFWLRQ)LQDOO\ DIWHUPXFKGHEDWHZHDJUHHGRQDVKRUWOLVWRI¿YH7KHFRPSHWLWLRQ was seen by the jury as a positive step in recuperating this space for WKHFLWL]HQ6KRUWO\WKHUHDIWHU,OHIWIRU7RURQWR¿OOHGZLWKWKHNQRZOHGJH DQGWKHDGPLUDWLRQRI'XUUHVDQGLWVLQKDELWDQWV :LWKLQDIHZPRQWKV,UHWXUQHGWRSDUWDNHLQWKH¿QDOURXQGRIWKH VHOHFWLRQSURFHVV2QFHDJDLQÀ\LQJRYHUWKDWJUHDWH[SDQVHRI water, I felt the exhilaration inherent in the task awaiting me and the RWKHUPHPEHUVRIWKHMXU\,ZDVH[FLWHGDWWKHWKRXJKWRIVHHLQJ¿UVW hand the resolution of the short listed few. The task of selecting the winning scheme is a daunting one, since the decision would play a de WHUPLQDQWUROHLQVKDSLQJWKHXUEDQHQYLURQPHQWRI'XUUHVIRU\HDUVWR come. The schemes were exhibited in the lobby of the Teatri Alek­ VDQGHU0LXQVL$W¿UVWJODQFHDOORIWKHGHVLJQVFRQYH\HGWKURXJK plans, renderings and models, the authors’ commitment to excel. The ensuing discussion by the jury was a manifestation to insure that the 302 colari ricordi. Il primo riguarda le storie che ho sentito, da ragazzino, da alcuni visitatori di ritorno GDOO¶$OEDQLDLOVHFRQGROHVWRULHGLFDQDGHVLGL origine albanese che, come me, si erano stabiliti HGHUDQRVWDWLDGRWWDWLGDO&DQDGD'DTXHVWL racconti orali è emersa una “sensazione” circa il posto che stavo per visitare per la prima volta. All’arrivo e prima dell’inizio dei lavori ho girato piazza Liria e le zone adiacenti. Mi ha meraviglia­ WRODVWUDWL¿FD]LRQHVWRULFDGHJOLLQWHUYHQWLHVRQR stato particolarmente colpito dallo spazio publico HGDOODVXDULOHYDQ]DVRFLDOH+RSHUFHSLWROD SLD]]DFRPHHOHPHQWRFKLDYHFKHGH¿QLVFHOD città. E’ un spazio tridimensionale grazie alla sua posizione sul terreno in pendenza. E’ di un incrocio che presenta il mare da un lato e l’entro­ terra oltre le colline. E’ l’atterraggio di una grande scalinata che permette all’utente di cambiare direzione, di aspettare e osservare, di incontrarsi HSDUWHFLSDUHDOODYLWDVRFLDOH+RRVVHUYDWRJOL DQ]LDQLFRQLORURQLSRWLVRWWRO¶RPEUDGHLSLQL+R notato i giovani energici che correvano lungo il µFRUVR¶LOOXQJRPDUHSURQWLDHVVHUHPRGHOODWL GDOO¶DYYHQLUHLQXQFRQWHVWRGLUHDOWjJOREDOH'L fronte al porto, allo stesso modo in cui ho sentito l’odore del sale marino e ho goduto dell’infran­ gersi delle onde ho notato il saccheggio spe­ culativo di tale preziosa risorsa urbana. Ahimè, quest’ultima osservazione non era la ragione per cui ero venuto qui. Era il momento di iniziare le QRVWUHGHOLEHUD]LRQL3LGLSURSRVWHSURYH­ nienti da molte parti del mondo, erano di fronte ad ognuno di noi membri della giuria. Ciascuna FRQWULEXWRSRUWDYDVHFRQGRLOVXRDXWRUHXQµLGHD potenzialmente valida. Nel valutare le proposte della prima fase del concorso, ho scelto quelle che affrontavano questioni come la morfologia urbana, l’associazione simbolica e il continuum storico. Ciascuno degli altri sei membri della giu­ ULDDYHYDVYROWRODSURSULDVHOH]LRQH,Q¿QHGRSR molte discussioni, abbiamo concordato una breve OLVWDGLFLQTXHSURJHWWL¿QDOLVWL1HOFRPSOHVVRLO concorso è stato considerato dalla giuria come un passo positivo nel recupero di questo spazio per il cittadino. Poco dopo sono partito per Toronto colmo della conoscenza e dell’ammirazione per 'XUD]]RHSHULVXRLDELWDQWL 'RSRSRFKLPHVLVRQRWRUQDWRD'XUD]]R SHUSDUWHFLSDUHDOODIDVH¿QDOHGHOSURFHVVR di selezione. Ancora una volta, volando sopra quella grande distesa d’acqua, ho sentito l’euforia trasmessa dal compito che attendeva me e gli altri membri della giuria. Ero eccitato al pensiero di vedere in prima persona la conclusione del concorso. Il compito di selezionare il progetto vincitore era veramente importante, in quanto la decisione avrebbe giocato un ruolo determinante QHOSODVPDUHO¶DPELHQWHXUEDQRGL'XUD]]RSHUJOL anni a venire. I progetti sono stati esposti nella hall del Alek­ efforts of all involved in this undertaking would result in the highest GLYLGHQGIRUWKHFLW\RI'XUUHV:KLFKRIWKHVFKHPHVZRXOGJHQH­ rate a catalytic intervention in the making of place and foster the creation of vital public destinations After an exhaustive time each one of us searched in the individual GHVLJQVWKRVHHOXVLYHTXDOLWLHVWKDWVLJQL¿HGGLIIHUHQFHWRJHWKHUZH ORRNHGIRUWKRVHRXWVWDQGLQJTXDOLWLHVWKDWVLJQL¿HGVDPHQHVV7KH former led each of us in making an individual choice, whereas the latter resulted in a design that would enhance the urban order. The two opposites converged in the winning scheme of architect Cro. Too often projects in the urban landscape are primarily associated ZLWKWKHVHQVHRIVLJKW+RZHYHUKHDULQJVPHOOWDVWHDQGWRXFK can be equally or more decisive than sight when one perceives or experiences a given landscape. The winning design’s inherent sen­ sory characteristics will shape the future identity of Liria Square. In its urban context it has the potential of achieving grace and beauty only through the test of time. +DYLQJVXFFHVVIXOO\FRPSOHWHGRXUWDVNWKHUHUHPDLQHGIRUPHWR FRQYH\P\VLQFHUHVWWKDQN\RXWRWKHFLWL]HQVRI'XUUHVWR0D\RU 9DQJMXVK'DNR'HSXW\0D\RU$GULDQ&HODDQGIHOORZDGPLQLVWUD­ tions, to the members of the jury and Piero Rovigatti, the competi­ tion advisor. Rocco Maragna 'XUUHV6HSWHPEHU6RXWKHUQZDWHUIURQW Durazzo, settembre 2008, waterfront meridionale sander Teatri Miusiu. A prima vista, tutti i disegni, attraverso i piani, i rendering e i plastici, de­ notavano l’eccellente l’impegno degli autori. La di­ scussione che ne è derivata da parte della giuria è stata la garanzia che gli sforzi di tutti i coinvolti in questa impresa avrebbero portato un dividendo HOHYDWRSHUODFLWWjGL'XUD]]R4XDOHGHLSURJHWWL avrebbe generato un intervento catalizzante per la valorizzazione di luogo di interesse pubblico YLWDOH"'RSRLOWHPSRDGHJXDWRFLDVFXQRGLQRL ha ricercato nei singoli progetti quelle qualità VIXJJHQWLFKHOLGLIIHUHQ]LDYDQRLQVLHPHDEELDPR cercato le qualità eccezionali che li uniformavano. Il primo criterio ha portato ognuno di noi a fare una scelta individuale, mentre il secondo ha indi­ cato un progetto che avrebbe migliorato l’assetto urbano. La composizione di questi due concetti opposti ha portato al progetto vincente dell’archi­ tetto Cro. Troppo spesso i progetti di paesaggio urbano sono principalmente associati al senso della vista. Tuttavia, udito, olfatto, gusto e tatto SRVVRQRHVVHUHDOWUHWWDQWRRSLGHFLVLYLGHOOD YLVWDTXDQGRVLSHUFHSLVFRQRRVLYHUL¿FDQRLQXQ dato paesaggio. caratteristiche intrinseche sen­ soriali. Il progetto vincente conformerà la futura identità di Liria Square. Nel contesto urbano, ha il potenziale per raggiungere la grazia e la bellezza solo attraverso la prova del tempo. A conclusione del mio compito, vorrei esprimere LOPLRSLVLQFHURULQJUD]LDPHQWRDLFLWWDGLQLGL'X­ UD]]RDO6LQGDFR9DQJMXVK'DNRDO9LFH6LQGDFR Adrian Cela e ai colleghi dell’amministrazione, ai membri della giuria e a Piero Rovigatti, advisor della competizione e dell’iniziativa. 'XUUHV6HSWHPEHUYLHZVRIWKHDQFLHQW%\]DQWLQH:DOOVVXUURXQGHGE\QHZEXLOGLQJV Durazzo, settembre 2008, vedute delle antiche mura bizantine circondante da nuove costruzioni. 6.3 A letter to the city and hits inhabitans/ Una lettera alla città e ai suoi abitanti Alberto Monti, archeologist/archeologo Member of the International Jury/Membro della Giuria Internazionale &RQRVFREHQH'XUD]]R0LqVLPSDWLFDHSHUFHUWLYHUVLODDPRDQ­ che: da principio, quando mi ci sono trovato varie volte, da solo, set­ te o otto anni fa, ha rappresentato un’avventura: l’Albania, un posto “oltre cortina”, nel quale assaporare un’aria diversa da quella della placida ed organizzata Modena, dove vivo. Poi è quasi diventata XQDFDVDTXDQGRKRDYXWRXQQXPHURVXI¿FLHQWHGLGXUD]]LQLFKH mi salutavano mentre passavo, e per rispondere ho imparato le pri­ PHSDUROHLQOLQJXD(DQFRUDGLSLTXDQGR$OPD7HGHVFKLQLPLKD dato le chiavi di casa sua e mi ha detto di andarci quando volevo, indipendentemente che lei e suo marito Josef ci fossero: io arrivavo GDOO¶,WDOLDLQ¿ODYRODFKLDYHQHOODWRSSDHGHQWUDYR(GDYHYROD³PLD stanza”, come uno di famiglia. O quando rientravo a tarda sera in PRWRGD'XEURYQLNR2KULGFRQOHVWUDGHGHVHUWHLVHPDIRULFKH lampeggiavano in giallo, ed ero arrivato. Mi sono trovato sempre EHQHD'XUD]]RHTXLQGLKRVHPSUHFHUFDWRGLULFDPELDUH9ROHYR fare qualcosa per questa città. Qualcosa oltre la carta del rischio archeologico che abbiamo creato insieme a Sara Santoro ed Afrim +RWLTXDQGRDQFRUDLQFLWWjRSHUDYDQR8QRSVH6LOYLD)DGGD9ROH­ vo fare qualcosa perchè, avendoci trascorso parecchio tempo dal 2002 ad oggi, ho avuto modo di vederla trasformare in un modo che QRQPLSLDFHYD+RYLVWRDUULYDUHLOSURJUHVVR+RYLVWRLGXUD]]LQL migliorare la loro esistenza ma, purtroppo, ho visto anche la città imbruttirsi. Perchè prima, quando arrivavamo con il traghetto da $QFRQD9LOOD=RJVLVWDJOLDYDDQFRUDLVRODWDVXOFULQDOHEHQIXRUL dall’abitato. Ed anche la torre veneziana che domina la città dall’alto si vedeva dalla nave, mentre ora si vedono solo dei brutti palazzoni. Lo skiline, oggi, è quello di un qualunque anonimo paesone moder­ no e vagamente deprimente. Senza alcuna personalità. La torre, su in alto, era il mio posto preferito, e guardando in basso, ODVHUDULFRQRVFHYRODFKLD]]DEXLDGHOO¶DQ¿WHDWURODEDVKNLDLOOXPL­ nata, qualche palazzo moderno ma anche i resti del quartiere turco FRQOHVXHOXFLQH¿RFKHVWUHWWRWUDOHPXUDEL]DQWLQHHGLOERXOHYDU Quando ci sono salito per l’ultima volta, dopo aver inventato una scusa per sganciarmi un’oretta dalla compagnia degli altri giurati del FRQFRUVRDOOD¿QHGHOO¶LPPDJLQHFKHKRYLVWRQRQFRUULVSRQ­ GHYDSLFRQTXHOODQHOODPLDPHPRULD3LOXFHQHOODQRWWHWURSSD ULVSHWWRDOO¶RVFXULWjFKHULFRUGDYR1RQPLVRQRSLGLYHUWLWRDFDP­ minare sulla cresta delle mura, nel punto in cui dovevo contorcermi ,DPIDPLOLDUZLWK'XUD]]R,OLNHLWDQGORYHLWDV well: it has been an adventure from the beginning, when seven or eight years ago, I’ve been there several times, alone. Albania, a place “behind the Iron Curtain,” in which you can feel a different air from that of Modena, the calm and organized city where I live. Then it almost became a house, ZKHQ,KDGHQRXJK'XUUHV¶VLQKDELWDQWVWKDW greeted me as I passed, and I learned to answer WKH¿UVWZRUGVLQWKHDOEDQLDQODQJXDJH$QGHYHQ more when Alma Tedeschini gave me the keys to her house and told me to go there when I wanted. So I came from Italy, I put the key in the lock and entered regardless she and her husband Josef were there. And I had “my room” as in a family. 2UZKHQ,UHWXUQHGODWHDWQLJKWIURP'XEURYQLN or Ohrid on a motorcyle with deserted streets, WUDI¿FOLJKWVÀDVKLQJ\HOORZDQG,KDGDUULYHG, KDYHDOZD\VIRXQGJRRGLQ'XUUHVVR,DOZD\V tried to reciprocate. I wanted to do something for this city. Something other than paper of archae­ ological risk that we created together with Sara 6DQWRURDQG$IULP+RWLZKLOHVWLOORSHUDWLQJLQWKH FLW\81236DQG6LOYLD)DGGD,ZDQWHGWRGR something because, having spent there conside­ rable time since 2002, I got to see it transformed in a way that I did not like. I have seen coming the SURJUHVV,¶YHVHHQ'XUUHV¶VLQKDELWDQWVLPSURYH their lives but, unfortunately, I have also seen the city became ugly. Because before, when we DUULYHGE\IHUU\IURP$QFRQD9LOOD=RJVWLOOVWRRG out, isolated, on the ridge outside the town. And HYHQ\RXFRXOGVHHIURPWKHVKLSWKH9HQHWLDQ tower which dominates the city, while now we see only the ugly apartment blocks. The Skiline today is that of any anonymous, modern and vaguely depressing town. Without any personality. The tower, on top, was my favorite place, and looking down in the evening, I saw the dark stain of the amphitheater, the bashkia lit, some modern bu­ ilding but also the remains of the turkish quarter with its dim lights, close between the Byzantine walls and Boulevar. At the end of 2008, when I went there for the last time, after inventing an excuse to go away for an hour from other judges of the competition, the image that I saw no longer corresponded with that in my memory. More light 305 per passare tra il ramo di un pino marittimo che sporge da destra e la nicchia della postazione di un cannone piazzatovi ai tempi del socia­ lismo. Sei anni prima dovevo farlo nel buio completo, mentre quella volta era tutto illuminato dalle luci dei palazzi circostanti. 'XUD]]RHO¶$OEDQLDFDPELDQRFRPHWXWWRLOPRQGR(GqJLXVWRLO tempo passa e tutto cambia. Ma è anche importante che il cambia­ mento avvenga in meglio, per quanto si può. La domanda che mi SRQJRJXDUGDQGR'XUD]]RRJJLqVHVLDSRVVLELOHIDUHLQPRGRFKHJOL Albanesi possano soddisfare il loro diritto alla modernità ed al benes­ sere – e se lo sono guadagnato con decenni di isolamento – senza per questo rovinare tutto quello di buono – e ce n’era tanto ! – che quell’isolamento aveva preservato. Gli uomini savi devono saper dare una direzione a questo sviluppo – ed il concorso “Revitalization Iliria Square” è stato un piccolo contributo in questa direzione – perchè lo VYLOXSSRVHOYDJJLR¿QLUHEEHFRPHVHPSUHQHOOHPDQLGHLSLVSUHJLX­ dicati, di coloro che pensano solo al proprio interesse e non a quello della collettività. Qui si pone una scelta etica, e culturale, e di civiltà: come ho sempre GHWWRDFKLXQTXHDFFRPSDJQDVVLLQJLURSHUODFLWWjD'XUD]]RF¶qXQD GHQVLWjPRQXPHQWDOHFKHVHEEHQHRYYLDPHQWHVLDPROWRSLULGRWWD in quanto ad estensione, come quantità e come qualità è paragona­ ELOHDTXHOODGHLSLIDPRVLHGLPSRUWDQWLVLWLDUFKHRORJLFLGHOPRQGR Roma inclusa. Non è possibile smuovere uno strato di terra o fare un 'XUUHV6HSWHPEHUYLHZRIWKH9LOOD=RJ WRSRQWKHULJKW IURP6RXWKHUQZDWHUIURQW Durazzo, settembre 2008, Villa Zog (in alto a destra) dal waterfront meridionale in the night, too, compared to the darkness I remembered. I have never enjoyed a walk on the crest of the walls where I had to contort to switch between a pine branch that protrudes from the right and a niche of a cannon placed there in the time of socialism. Six years before I had to do it in complete darkness, while that time it was all lit by the lights of the surrounding buildings. 'XUUHVDQG$OEDQLDDUHFKDQJLQJDVWKHZKROH world. And it is right: time passes and everything changes. But it is also important that the change takes place the better as you can. Looking at 'XUUHVWRGD\WKHTXHVWLRQ,DVNLVZKHWKHULWLV possibile that the Albanians can satisfy their right to modernity and well­being ­earned through decades of isolation­ without ruining everything good­ and was there so much! ­ that the isolation had preserved. The wise men must be able to give direction to this development ­ and the com­ petition “Revitalization Iliria Square” was a small contribution in this direction­ because the wild development would, as always in the hands of the unscrupulous, those who only think about their own interest and not that of the community. But here is an ethical, cultural, and of civilization choise: as I ever told anyone I accompany around WKHFLW\LQ'XUUHVWKHUHLVDGHQVLW\DQGTXDOLW\ of monuments comparable to that of the most famous and important archaeological sites in the buco di un minimo di profondità senza portare alla luce marmi, mo­ saici, muri monumentali, senza contare le strutture fortunatamente DQFRUDLQSLHGL4XHVWDqOD'XUD]]RDUFKHRORJLFDDQ]LOD'XUD]]R YHUD$OORUDOHSRVVLELOLWjTXDQGRVLSLDQL¿FDLOIXWXURGHOODFLWWjVRQR VRORGXHRVLID¿QWDFKHTXHVWDUHDOWjQRQHVLVWDFKHFLVLWURYLLQ mezzo alla campagna, e si considerano lo spazio ed il sottosuolo FLWWDGLQRFRPHYROXPLYXRWLQHLTXDOLVSLDQDUHLQ¿JJHUHSDOLVFDYD­ re garages, far passare condotte e tubazioni, o si accetta – ed anzi si gioisce nello scoprirlo ! – la città per quello che è: un tesoro se­ SROWR'DOSXQWRGLYLVWDHWLFRODVFHOWDVDUHEEHRYYLDFUHGRFKHSHU FKLXQTXHVDSSLDGLVFHUQHUHLOEHQHGDOPDOHHFRQRVFDLOVLJQL¿FDWR di termini quali cultura, tradizione, identità, radici, lo scegliere tra il rispettare l’eredità del passato e l’ignorarla non dovrebbe costituire un problema. Ma anche dal punto di vista economico basterebbe un poco di lungimiranza per dirimere la questione: a chi è utile, guar­ GDQGRDQFKHVRORSRFRSLLQOjGHOSUHVHQWHLPPHGLDWRURYLQDUH ciò che la città può vantare come unicità rispetto a tante altre. Per JXDGDJQDUHTXDOFKHHWWDURGLWHUUHQRHGL¿FDELOHTXDQGREDVWDIDUVL GLHFLPLQXWLG¶DXWRSHUWURYDUHWHUUHOLEHUH¿QFKpVLYXROH"(¶SRV­ VLELOHQRQFDSLUOR"(SRVVLELOHQRQDYHUHFKLDURFKHqSHUJXVWDUH quello che è stato lasciato da tremila anni di storia e non ciò che può essere costruito oggi che gente da tutto il mondo potrebbe voler YHQLUHD'XUD]]R"3RUWDQGRVYLOXSSRHEHQHVVHUH(DOORUDSHUFKq rovinare il tessuto storico, le aree archeologiche, la spiaggia ed il mare con operazioni edilizie che sono già brutte mentre nascono, e ¿JXUDUVLFRVDVDUDQQRLQIXWXUR" 3HQVLDPRFL/DFLWWjQRQqQLHQWHSLFKHXQLQVLHPHGLHGL¿FLIDWWL di materia inerte, perchè la sua vita vera è nei suoi abitanti e sono questi, e non le strade, le piazze, i palazzi o i resti archeologici che fanno la differenza. La città è bella e vivibile se coloro che la popo­ ODQRHODDPPLQLVWUDQRODFRQVLGHUDQRSHUTXHOORFKHSLSURIRQGD­ mente dovrebbe essere, e cioè uno spazio comune, organizzato, nel quale convivere, all’ombra del proprio passato e delle proprie radici, rispettandosi e collaborando. Se i durazzini, gli albanesi, gli italiani, gli uomini, non capiscono che la qualità della vita discende solo dal rispetto e dalla collaborazione reciproche non vi è progetto urbanistico che tenga. Questa, come ogni altra città, sarà sempre SLFDRWLFDGHSULPHQWHDOLHQDQWHUHSHOOHQWHHGLOYLYHUHLQVLHPH GLYHQWHUjVHPSUHSLSHULFRORVRVSLDFHYROHGHSUHFDELOH /DSLD]]DULQDVFHVSHULDPRULYLWDOL]]DWD9RUUHLFKHLGXUD]]LQLFLVL recassero a discutere del valore della loro città e del loro passato e del peso che possono – e debbono ! – avere nel goderne, conti­ nuandola nel solco dei suoi tremila anni di storia. Per il bene di tutti. Alberto Monti world, including Rome, although it is obviously much ORZHUDVWRH[WHQVLRQ<RXFDQQRWPRYHDOD\HURI earth or make a hole of a minimum depth without bringing to light marble, mosaics, monumental walls, not counting the structures still standing. This is the DUFKDHRORJLFDO'XUUHVWKHWUXH'XUUHVLQGHHG6R when we planning the future of a city we have two possiblities: or you pretend that this reality does not exist that we are in the countryside, and we consider the space and the underground as empty volumes in which pave, drive stakes, dig garages, feed pipes and tubes, Or we accept ­and indeed one rejoices to discover!­ the city for what it is: a buried treasure. )URPWKHHWKLFDOSRLQWRIYLHZWKHFKRLFHLVREYLRXV I think for anybody who can discern right from wrong and knows the meaning of terms such as culture, tradition, identity, roots, the choice between the past and respect the legacy of ignorance should not be a problem. But also from economic point of view a little foresight would be enough to settle the issue: who is useful, looking just a little further than the immediate present, ruin what the city can boast as unique compared to many others. To gain a few acres of building land, when just in ten minute drive \RXFDQ¿QGIUHHODQGDVORQJDV\RXZDQW"<RXFDQ QRWXQGHUVWDQGLW"<RXFDQQRWPDNHLWFOHDUWKDWLW is to enjoy what was left for three thousand years of history and not what we built today that people from DURXQGWKHZRUOGPLJKWZDQWWRFRPHWR'XUUHV" Bringing development and prosperity. So why ruin the historical fabric, archaeological areas, the beach and the sea with building operations that are already bad while they born, and imagine what will be in the IXWXUH" We have to think about it. The city is nothing more than a collection of buildings made of inert matter, because its real life is in its people and is the peol­ ple, not the streets, squares, buildings or archaeo­ logical remains that make the difference. The city is beautiful and livable if the population and those who administer it , consider more deeply what it should be, that is a common and organized place, in which to live in the shadow of the past and of the roots in UHVSHFWDQGFROODERUDWLRQ,I'XUUHV¶VLQKDELWDQWV Albanians, Italians, men do not understand that the quality of life comes down only by respect and mutual cooperation, there is no urban planning that can withstand. This, like every other city will be even more chaotic, depressing, alienating, repellent, and living together will become increasingly dangerous, unpleasant, despicable. The square is born again, hopefully revitalized. I ZLVKWKDWLQKDELWDQWVRI'XUUHVZHQWKHUHWRGLVFXVV the value of their city and their past and the impor­ tance they can ­ and must! ­ have in enjoying it, still in the wake of its three thousand years of history. )RUWKHJRRGRIDOO 307 6.4 From the competition site to a virtual museum of urban history and culture of the project/Dal sito del concorso al museo virtuale di storia urbana e di cultura del progetto. 3LHUR5RYLJDWWL,VLGD'XND Il concorso internazionale di piazza Liria è stato un occasione di rilancia­ UHQHOODVFHQDLQWHUQD]LRQDOHXQ¶LPPDJLQHDWWLYDGHOODFLWWjGL'XUD]]R e di favorire l’applicazione di nuove forme di attenzione ai temi dello spazio pubblico e delle attrezzature collettive, in una città per molti anni profondamente segnata dalla politica della rendita e della speculazione edilizia. Inaspettatamente, il concorso a avuto una grande adesione da parte di molti gruppi internazionali oltre a quelli Albanesi (Italia, Inghil­ terra, Giappone, Portogallo, Spagna, Germania, Austria, Stati Uniti), grazie forse alla gratuità dell’iscrizione al concorso e alla pubblicazione del bando nel grande spazio web. Oltre a ciò, va ricordato il patrocinio GHOO¶,VWLWXWR1D]LRQDOHGL$UFKLWHWWXUD ,1$5&+ HGHO)RUXPGHOOH&LWWj GHOO¶$GULDWLFRHGHOOR,RQLRFKHDWWUDYHUVROHORUR¿WWHUHWLGLUHOD]LRQHHGL attività, hanno contributo in primis alla diffusione del concorso in chiave LQWHUQD]LRQDOH'XUDQWHODUHGD]LRQHGHOEDQGRROWUHDGXQDWWHQWDULFHU­ ca preliminare dedicata a tutti gli elementi che compongono il contesto urbano dove risiede la piazza, e la realizzazione di tutti gli altri materiali che compongono un bando, un’attenzione particolare è stata infatti dedicata alla costruzione di un portale web dedicato esclusivamente all’interazione a distanza con i partecipanti. Tale sito, disponibile per lun­ go tempo alla pagina: http://www.iliriasquarecompetition.org, ha avuto grande successo in termini di frequentazioni (oltre 15.000 contatti) ed è servito a raccoglie e offrire una grande mole di informazioni e di carto­ JUD¿HDQFKHDGHOHYDWDGH¿QL]LRQHHDQFKHDOGLIXRULGHOODGLPHQVLRQH VSHFL¿FDGHOO¶DUHDGLLQWHUHVVHGHOFRQFRUVR Il portale ha svolto durante tutto il concorso diverse funzioni: ­ spazio di documentazione generale ( raccogliendo e mettendo a dispo­ sizione in formato elettronico tutti i materiali prodotti per la redazione GHOEDQGR GHVFUL]LRQLGDWLHVWXGLSUHFHGHQWLIRWRYLGHRJOLsteps del EDQGR DFFHVVLELOLHVFDULFDELOLIDFLOPHQWHGDWXWWLJOLLQWHUHVVDWL ­ spazio di aggiornamento e formazione sui temi del bando (il sito veniva DJJLRUQDWRUHJRODUPHQWHGDOFRPLWDWRVFLHQWL¿FRFRQPDWHULDOLLQIRUPD­ to elettronico prodotto dagli esperti internazionali anche in occasione dei vari eventi che hanno seguito lo svolgimento del concorso (visite, ZRUNVKRS  ­ strumento di informazione in tempo reale sulla partecipazione al con­ corso ( il sito visualizzava in tempo reale il numero delle visite che era­ no state effettuate) un calcolo che ha permesso di valutare l’importanza dello spazio web nella divulgazione delle informazioni e l’interattività che esso permette di avere con soggetti che si trovano in luoghi diversi nello stesso tempo. In tal senso, l’utilizzo di un sito web, anche se non nuovo in esperienze di questo genere, ha costituito anche un banco di prova e di sperimenta­ ]LRQHSHUO¶$PPLQVWUD]LRQH/RFDOHGL'XUD]]RFKHSXzDGHVVRHUHGLWDUH 308 The international competition of the square Liria was an opportunity to revive in the international VFHQHDQDFWLYHLPDJHRIWKHFLW\RI'XUUHVDQG to encourage the application of new forms of attention to issues of public space and commu­ nity facilities in a city for many years profoundly affected by the policy of income and property speculation. Unexpectedly, the competition had a large membership by many international groups as well as those Albanians (Italy, England, Japan, Portugal, Spain, Germany, Austria, USA), thanks perhaps to free partecipation and to publication of the Brief in the large web space. In addition, it should be noted the sponsorship of the National ,QVWLWXWHRI$UFKLWHFWXUH ,1$5&+ DQGWKH)RUXP of Adriatic and Ionian, which through their dense networks of relationships and activities, primarily contributed to the spread of the competition international twist. 'XULQJWKHGUDIWLQJRIWKHFRQWUDFWSOXVDFDUHIXO preliminary research dedicated to all the elements that make up the urban environment where is the square, and the achievement of all other materials that make a contract, in fact, special attention has been devoted to building of a web portal dedicated exclusively to the interaction with remote participants. This site, available for a long time the page http://www.iliriasquarecompetition. org, has had great success in terms of attendan­ ce (over 15,000 contacts) and was used to collect and deliver large amounts of information and PDSVDOVRKLJKGH¿QLWLRQDQGDOVRRXWVLGHRI VSHFL¿FDVSHFWVRIWKHLQWHUHVWRIWKHFRPSHWLWLRQ The portal has several functions throughout the competition: ­ General documentation space (collecting and making available in electronic form all mate­ rials produced for the preparation of the notice (descriptions, data and previous studies, photos, video, the steps of the call) and can be downloa­ GHGHDVLO\DFFHVVLEOHE\DOOVWDNHKROGHUV ­ space and refresher training on the topics of the call (the site was regularly updated by the Scien­ WL¿F&RPPLWWHHRIPDWHULDOVLQHOHFWURQLFIRUPDW produced by international experts in the course of various events that have followed the progress of WKHFRPSHWLWLRQ YLVLWVDQGZRUNVKRSV  ­ tool for real­time information on the form (the site displays in real time the number of visits that were made) a calculation that allowed us to evaluate the importance of the web space in the una esperienza da rielaborare e utilizzare per nuove, analoghe occasioni. L’esperienza del Concorso internazionale di piazza Liria è stata dunque un occasione per la città non solo in termini tecnici ­ progettuali ma anche per sviluppare una consapevolezza da parte dell’amministrazione locale sull’ importanza della condivisione della conoscenza tramite lo spazio web. Tale consapevolezza è stata rafforzata nell’esperienza, in corso di progettazione, del progetto ReCon2URB (Reti condivise di conoscenza e ricostruzione urbana tra le città storiche in paesi in transizione. Albania, 0RQWHQHJUR6HUELD LOFXL¿QHSULQFLSDOHqTXHOORGLFRVWUXLUHXQSRUWDOH WEB che colleghi e rafforzi alcuni costituendi musei di storia urbana e di cultura del progetto contemporaneo di architettura e di urbanistica, SHQVDWLQRQVRORFRPHDUFKLYLGLFRQRVFHQ]DHVSD]LGLULÀHVVLRQHVXOOH esperienze urbane, passare e recenti di queste città, ma come vero e proprio strumento, partecipato e condiviso tra i cittadini e i soggetti por­ tatori di interesse, per la gestione presente e futura delle città storiche in paesi in transizione. Questo progetto coinvolge molti partner internazionali ROWUHDTXHOOLORFDOL,Q$OEDQLDOHFLWWjFRLQYROWHVRQR'XUD]]RH6KNRGHU ma è in animo dei promotori del progetto (che coincidono in buona parte con gli animatori della presente esperienza del concorso), di estendere tale partecipazione ad altre città italiane segnate da particolari processi di transizione, anche in Italia (ad esempio la città dell’Aquila, dopo il terribile terremoto del 6 aprile 2009), e in altri paesi dello spazio adriatico. dissemination of information and interactivity that it allows to have with people who are in different places at the same time. In this sense, the use of a website, although not new in this kind of experience, has also been a testing and experimentation for the 0XQLFLSDOLW\RI'XUUHVZKLFKFDQQRZLQKHULW an experience to reprocess and use for new, similar occasions. The experience of the international Square Liria was therefore an opportunity for the city not only in technical terms ­ but also to develop an awareness of WKHORFDODGPLQLVWUDWLRQRQµWKHLPSRUWDQFHRI sharing knowledge through the web space. This awareness has been reinforced by experience, being designed, the project ReCon2URB (networks of shared knowledge and urban reconstruction of historic cities in countries in transition. Albania, Montenegro, Serbia), whose main purpose is to build a web portal that links and reinforces some of forming urban history museums and culture of contemporary design in architecture and urbanism. 'XUUHVDHULDOYLHZRIWKHFHQWHUDurazzo, veduta aerea, 1963. 309 'XUUHV6HSWHPEHUH[9ROJD+RWHO WRSRQWKHULJKW IURP6RXWKHUQZDWHUIURQW$ERYHYLHZRIWKHVSLUDOVWDLUFDVHLQVLGH Durazzo, settembre 2008, ex Hotel Volga; veduta della scala elicoidale interna. 6.5 What learning from this experience/ Cosa apprendere da questa esperienza Piero Rovigatti, Urban planner $GYLVRURIWKHFRPSHWLWLRQ0HPEHURIWKH7HFKQLFDODQG6FLHQWL¿F&RPPLWWH FRQVXOHQWHGHO&RQFRUVRPHPEURGHOOD6HJUHWHULD7HFQLFR6FLHQWL¿FD '$57)DFROWjGL$UFKLWHWWXUDGL3HVFDUD $'XUD]]RDPHWjGHOO¶HVWDWHDSSHQDWUDVFRUVDVRQRFRPLQFLDWL i lavori d’esecuzione di una prima parte del progetto vincitore del concorso per la rivitalizzazione della sua piazza principale, dopo appena due anni dall’avvio del Concorso internazionale A. Se c’è una prima cosa da apprendere, da questa esperienza, in fondo è proprio questo. Anche in una città caotica, in piena trasformazione, o meglio, a metà strada di una trasformazione epocale, che nel giro di neanche due decenni ha sovvertito economie, società, e forme urbane, si può realizzare un concorso di architettura, aprendolo alla partecipazione LQWHUQD]LRQDOHULFHYHUHLQEUHYHWHPSRXQDTXDOL¿FDWDDGHVLRQHGD gruppi compositi di architetti, ingegneri, paesaggisti, archeologi, artisti, da ogni parte del mondo, selezionare le proposte migliori, condurre una seconda fase di concorso in forma partecipata, chiamando a con­ tribuire anche esperti che da tempo lavorano nella città, e convergere rapidamente, sia pure attraverso una inevitabile attuazione per fasi, YHUVRO¶DWWXD]LRQHGLXQSURJHWWRFKHXQDTXDOL¿FDWDJLXULDLQWHUQD­ zionale, composta anche da esperti nazionali, ha reputato essere la soluzione migliore rispetto ad un tema di grande complessità e delica­ tezza. Ma quest’esperienza, pur tra le inevitabili occasioni mancate, presenta anche altri motivi di grande interesse. Progettare spazi, attrezzature pubbliche, siti archeologici accessibili Il primo è stato di riportare attenzione al tema dello spazio pubblico e delle attrezzature pubbliche, dopo l’amnesia generale degli anni della transizione all’economia di mercato. E’ su questo aspetto che era stato impostato il Piano per l’area Centrale, è questa la motivazione di fondo che ha animato tutta l’iniziativa del Concorso internazionale e le molte iniziative collaterali svolte in collaborazione con l’Amministrazio­ ne locale. Non è un caso che a partire dal Concorso l’amministrazione abbia dato avvio ad un esteso programma di opere pubbliche, molte delle quali in corso di esecuzione, su cui hanno lavorato molti giovani architetti europei – tra cui molti italiani – che hanno scoperto la città di 'XUD]]RSURSULRDWWUDYHUVRLO&RQFRUVRLQWHUQD]LRQDOH Il secondo è stato quello di riportare all’attenzione generale – sia in campo nazionale, che, ancora, internazionale – il senso complessivo della città e in particolare la sua condizione di città storica, densa ,Q'XUUHVLQWKHPLGGOHRIWKHVXPPHU¶VHYHQWV ZRUNVWDUWHGRQWKHLPSOHPHQWDWLRQRIWKH¿UVW part of the winning design for the revitalization of its main square, after two years since the ,QWHUQDWLRQDO&RPSHWLWLRQ$,IWKHUHLVD¿UVWWKLQJ to learn from this experience, is ultimately just that. Even in a bustling city, in full transformation, or rather, half­way of an epochal transformation, that within less than two decades has subverted the economies, societies, and urban forms, you can create an architectural competition, opening to international participation , get in a short time E\DTXDOL¿HGPHPEHUVKLSFRPSRVLWHJURXSV of architects, engineers, landscape architects, archaeologists, artists from all over the world, select the best proposals, conducting a second round of competition in the form of participation, calling in experts to contribute to time working in the city, and converge quickly, even through the inevitable implementation in stages towards WKHLPSOHPHQWDWLRQRIDSURMHFWWKDWDTXDOL¿HG international jury, also composed of national experts, it considered to be the better solution than an issue of great complexity and delicacy. But this experience, despite the inevitable missed opportunities, it also presents other reasons of great interest. Designing spaces, public facilities, archaeological sites accessible 7KH¿UVWZDVWREULQJDWWHQWLRQWRWKHLVVXH of public space and public facilities, following the general amnesia of years of transition to a market economy. On this issue the Plan for the &HQWUDODUHDKDGEHHQVHWWKLVLVWKHXQGHUO\LQJ motivation that inspired the whole initiative of the International Competition and the many related initiatives carried out in collaboration with the lo­ cal administration. It is no coincidence that since the competition authorities have started an exten­ sive program of public works, many of which are in progress, they’ve been working a lot of young European architects ­ including many Italians ­ ZKRKDYHGLVFRYHUHGWKHFLW\'XUUHVULJKWWKURXJK the International Competition. The second was to bring to general attention ­ both nationally, 311 di tracce e vestigia del proprio complesso passato, sperimentando un’inedita attenzione progettuale al tema del senso delle permanen­ ]HFRPHRFFDVLRQHSHUJHQHUDUHQXRYLDVVHWWLHUHOD]LRQL¿VLFKHH VLPEROLFKH6LSRWHYDIDUHGLSLDGLPRVWUD]LRQHFKHDQFKHLPLJOLRUL architetti – e ce ne sono stati tanti, d’eccellenti, tra i tanti che hanno partecipato anche alla prima fase, molti dei quali noti nel panorama internazionale – spesso sono indifferenti al tema del recupero e della messa in valore del patrimonio culturale, spesso inseguendo logiche HJRFHQWULFKHWHVHDODVFLDUHVHJQLDQFKHODGGRYHqIRUVHSLQHFHV­ sario sottrarre, piuttosto che aggiungere, proprio per non alterare il rumore di fondo che proviene dal passato, e che invece deve essere ULSXOLWRHVHSRVVLELOHDPSOL¿FDWR3HUQRQGLUHGLFKLIRUVHVWUL]­ zando l’occhio ai sempre presenti interessi immobiliari e speculativo, incurante di un bando di concorso che confermava – non potendo fare altrimenti, ma anche per convinzione culturale – il divieto di nuove HGL¿FD]LRQLSHUWXWWRLOFHQWURVWRULFRVDQFLWRGDO3LDQR8UEDQLVWLFR approvato nel 2007 e tuttora vigente, ha preso pretesto del concorso GHOODSLD]]DSHUSURSRUUHVWUDQLDQWLHIXRULOXRJRHGL¿FLYHUWLFDOLFKH DYUHEEHURPHVVRODSDUROD¿QHDOO¶DVVHWWRFRPSOHVVLYRGHOFHQWUR urbano, a compimento di un’azione di sovversione dei caratteri e delle TXDOLWjGHOODFLWWjFKHKDDYXWRLOVXRDSLFH¿QRDOOD¿QHGHOO¶DSSURYD­ ]LRQHGHOQXRYR3LDQR6LSRWHYDIDUHGLSLFRPHSHUDOWURULFKLHGHYD which, again, international ­ the overall sense of the city and in particular its state of the historical city, full of traces and vestiges of its complex past, experiencing a new attention to the design theme of a sense of permanence as an opportunity to generate new structures and reporting physical DQGV\PEROLFUHODWLRQVKLSV<RXFRXOGGRPRUH proving that even the best architects ­ and there were many, of excellent, among the many who KDYHSDUWLFLSDWHGLQWKH¿UVWSKDVHPDQ\RI which are known in the international scene ­ often are indifferent to the issue of recovery and HQKDQFHPHQWRIFXOWXUDOKHULWDJH9HU\RIWHQWKH architects demonstrate their self­centeredness in a tendency to leave marks even if it is perhaps more necessary to subtract rather than add, so as not to alter the background noise that comes from the past, but which must be cleaned and, if SRVVLEOHDPSOL¿HG7RVD\QRWKLQJRIWKRVHZKR perhaps with an eye for the ever­present specula­ tive real estate interests, regardless of the Brief of &RPSHWLWLRQWKDWFRQ¿UPHGFRXOGQRWGRRWKHUZL­ se, but also for cultural beliefs ­ a ban on new buildings throughout the historic center as set the Urban Plan, approved in 2007 and still in force, took the pretext of the competition for proposing 'XUUHV$XJXVWPHQDWDZRUNIRUWKHQHZVTXDUH/LULD'XUD]]RDJRVWRFDQWLHUHGHOODQXRYDSLD]]D 312 ORVWHVVR%DQGRGL&RQFRUVRQHOVXJJHULUHVWUDWHJLHVSHFL¿FKHHG innovative per il reperimento di nuovo spazio pubblico, attraverso azioni perequative, che ampliassero la dotazione attuale attorno alla piazza, a vantaggio di una migliore integrazione e funzionalità tra le aree di utilizzo pubblico e i siti di interesse storico e archeologico, DOFXQLGHLTXDOLLQHGLWLRIUXWWRGLUHFHQWLVFRSHUWH'XROHDOULJXDUGR il disinteresse del progetto vincitore per la sistemazione e la difesa dell’area del recente ritrovamento del faro ellenistico di via Tropolini, SXUHYLGHQ]LDWDFRPHWHPDVSHFL¿FRQHOEDQGRGLVHFRQGDIDVHH FRQVRODLQYHFHLOPRGRHOHVROX]LRQLFRQFXLDOWULSURJHWWL¿QDOLVWL hanno invece considerato il tema, nella speranza che l’Amministra­ zione possa in qualche modo riprendere anche quelle interessanti soluzioni. Incoraggia, invece, la soluzione del progetto vincitore per O¶DUHDGHO)RUXPEL]DQWLQRWHVDDULDQQRGDUHHUHQGHUHIUXLELOHXQ¶DUHD oggi separata dalla città, tutti coloro che oggi possono giustamente pretendere un uso attivo delle memorie, fatte salve le necessarie PLVXUHSHUODSURWH]LRQHHODWXWHODGHLPRQXPHQWLSLYXOQHUDELOLFKH ne considera la fruizione come parte del patrimonio di spazi pubblici di cui la città deve tornare ad essere dotata. 6LSRWHYDIDUHGLSLQHOIDYRULUHQXRYHIRUPHGLSDUWHFLSD]LRQHHGL condivisione da parte dei cittadini – futuri utenti dei nuovi spazi recu­ SHUDWL±QHOODFRVWUX]LRQHGHLSURJHWWL¿QDOLVWLDGHVHPSLRDSUHQGR alle scuole e agli studenti i seminari che ne hanno accompagnato la formazione, e che invece sono stati realizzati a porte chiuse. Inco­ raggia, al riguardo, la grande partecipazione che c’è stata sia per la presentazione dei progetti di seconda fase, sia alla mostra, inedita, realizzata con la proiezione all’aperto di tutti i progetti al termine della prima fase, e che ha permesso a una moltitudine di persone di toccare con mano quanto prodotto da oltre trenta gruppi di progettazione per la rivitalizzazione della piazza principale della loro città. Il progetto come strumento di conoscenza urbana 'DTXHVWRSXQWRGLYLVWDLO&RQFRUVRGL$UFKLWHWWXUDVLFRQIHUPD essere, quando si investe anche in questo aspetto, uno strumento per alimentare e incrementare le conoscenze sulla città, sulle sue forme e sulle sue molte storie, secondo la regola che progettare è anche conoscere, e che conoscere è anche progettare. E’ questo il motivo che ci ha portato a pubblicare quasi per intero tutti i materiali prodotti dai concorrenti della prima fase, che molto spesso dimostrano una conoscenza accurata e fertile della città e del contesto oggetto del loro intervento. Questa è anche un’indicazione per l’Amministrazione della FLWWj±HDQFKHSHUTXHOOHGLDOWUHFLWWjDOEDQHVL±DI¿QFKpFRQVLGHULQR i costi di una tale iniziativa come un investimento che produce risultati che sono maggiori della produzione di un solo progetto cantierabile – anche se naturalmente ciò è l’obiettivo principale – e che riguardano conoscenza e cultura urbana, prima ancora che immaginazione del futuro. Il Concorso di Piazza Liria ha anche probabilmente dimostrato la alienating, inappropriate vertical buildings, which would put an end to the overall image of the city FHQWHULQIXO¿OOPHQWRIDQDFWLRQIRUVXEYHUVLRQ of the characteristics and qualities of the city that had its apex until the end of the approval of the QHZSODQ<RXFRXOGGRPRUHDVDOVRUHTXLUHG WKHVDPHDQQRXQFHPHQWVXJJHVWLQJVSHFL¿FDQG LQQRYDWLYHVWUDWHJLHVIRU¿QGLQJQHZSXEOLFVSDFH by equalizing actions that increase the current al­ ORFDWLRQDURXQGWKHVTXDUHWRWKHEHQH¿WRIEHWWHU integration and functionality between public use areas and sites of historical and archaeological interest, some of them unpublished, or the result of recent discoveries. Regrets in this regard, the disinterest of the winning design for the accommodation and the defense of the recent discovery of the lighthouse +HOOHQLVWLFKLJKOLJKWHGDVDVSHFL¿FWKHPHLQ the invitation to the second stage, and comfort the way and solutions with which, other projects ¿QDOLVWVKDYHFRQVLGHUHGWKLVLVVXHLQWKHKRSH that the Public Administration can somehow also catch those interesting solutions. Encourages, instead, the solution of the winning design for the DUHDRI%\]DQWLQH)RUXPZKLFKDLPVWRUHQHZ and make available an area separate from the city today, all those who today can rightly claim an active use of memory, subject to the necessary measures to the protection and conservation of monuments most vulnerable, which considers the use as part of the assets of public spaces that WKHFLW\PXVWRQFHDJDLQEHSURYLGHG<RXFRXOG do more to foster new forms of participation and sharing by the citizens ­ the future users of the new space recovered ­ in the construction of the ¿QDOLVWVIRUH[DPSOHE\RSHQLQJWKHZRUNVKRSV that have accompanied the formation of the second phase projects, and which instead has been made behind closed doors. Encourages, in this regard, that there was great participation for the presentation of the projects second phase, both at the show, unpublished, created with the outdoor screening of all projects at the end of WKH¿UVWSKDVHDQGWKDWDOORZHGWRDPXOWLWXGHRI people to touch the product for over thirty design teams for the revitalization of the main square of their city. The project as a tool of urban knowledge )URPWKLVSRLQWRIYLHZWKHDUFKLWHFWXUDOFRP­ SHWLWLRQZLOOEHFRQ¿UPHGDWRROWRFUHDWHDQG increase knowledge about the city, its forms and its many stories, according to the rule design is also know, and knowing is also design. This is the reason that led us to publish almost all of all ma­ WHULDOVSURGXFHGE\FRPSHWLWRUVRIWKH¿UVWSKDVH which often demonstrate a thorough knowledge of the city and of the his context. This is also an indication for the administration of the city ­ and also those of other Albanian cities ­ to consider 313 relativa facilità con cui è possibile organizzare tale genere di iniziati­ ve, usufruendo delle nuove opportunità che le nuove tecnologie – la rete, tanto per cominciare – mettono a disposizione, e il fatto che tale attività sia stata anche una sorta di on job training, per alcuni giovani FROODERUDWRULGHOO¶8I¿FLR8UEDQLVWLFRODVFLDVSHUDUHFKHWXWWRFLzSRVVD essere facilmente e presto ripetuto, anche a prescindere dalla coope­ razione offerta in questa occasione. Il Concorso come catalizzatore di nuovi interessi internazionali &RPHSLYROWHULFRUGDWRLO&RQFRUVRRUJDQL]]DWRLQGXHIDVLKDYLVWR nella prima fase una vasta partecipazione internazionale (36 progetti SDUWHFLSDQWL QHOODVHFRQGDORVYLOXSSRGLFLQTXHSURJHWWL¿QDOLVWL anche attraverso attività e seminari partecipati, che hanno portato alla selezione del progetto vincitore, in corso di esecuzione. L’Albania non è nuova all’esperienza del Concorso internazionale, tuttavia si tratta di esperienze ancora limitate, che in genere riguardano la città capitale – come nel caso del Concorso Internazionale per piazza Skanderbeg ­ , e gli spazi o le occasioni di architettura di massimo interesse. Nel favorire una maggiore utilizzazione di questo strumento, non solo, come è stato appena detto, per produrre interventi di qualità HGHI¿FDFLYDDQFKHVHJQDODWRFRPHDWWUDYHUVRTXHVWHHVSHULHQ]HOH città albanesi possono aprirsi alla collaborazione delle migliori avan­ guardie internazionali, anche riguardo alle tecniche costruttive e alle pratiche realizzative di interventi complessi, partecipando di un circuito di idee e di innovazioni da cui per tanti anni sono state estromesse. E qui il riferimento non è, solo, agli anni del regime comunista – durante il quale almeno alcuni temi del recupero urbano sono stati condivisi a livello internazionale ­ ma anche e soprattutto ai primi due decenni della transizione, duranti i quali la città, e buona parte dell’Albania, si è riempita di pessime architetture, anche da un punto di vista qualitativo (lasciando da parte per una volta il disastro urbanistico), forse perché prodotto da progettisti di pessima qualità (o, meglio, con poche con­ vinzioni etiche), o addirittura per esportazione dei “fondi di magazzino” GHJOLVWXGLGLDUFKLWHWWXUDGLTXDOFKHSDHVHFRQ¿QDQWH« Durazzo laboratorio per una nuova generazione di architetti europei 'DTXHVWRSXQWRGLYLVWDGRSRWDQWLDQQLGLGHJUDGRLQFXULDHSURGX­ zione di degrado del nuovo benessere , potrebbe davvero diventare una città laboratorio per una nuova generazione di architetti albanesi europei, anche in ragione degli innegabili migliori risultati prodotti da una nuova schiera di architetti nazionali, che oggi ha già poco da invidiare, come capacità organizzativa e potenzialità , a tanti studi di progettazione italiani. Lo dimostrano anche alcune delle proposte pre­ VHQWDWHDTXHVWRFRQFRUVRSURYHQLHQWLGDVWXGLGL7LUDQDHGL'XUD]]R spesso in collaborazione con architetti italiani, spagnoli, portoghesi, tedeschi, inglesi. 314 the costs of such an initiative as an investment that produces results that are greater than the production of a single project sites ­ although of course this is the main goal ­ and that concern knowledge and urban culture, even before the imagination of the future. The competition has also likely demonstrated the relative ease with which it is possible to organize such kind of initiatives, taking advantage of new opportunities that new technologies ­internet, for example ­ make available, and the fact that the activity is also a kind of on job training, for some young FROODERUDWRUV7RZQ3ODQQLQJ2I¿FHRIIHUVKRSH that another similar experience can be easily and quickly repeated, apart from cooperation deals on this occasion. The competition as a catalyst for new international interests The experience of an international competition of architecture is not entirely new to Albania, however it is still limited experience, typically affecting the capital city ­ such as the International Competition for Skanderbeg Square ­ and the spaces or opportunities of greatest interest in architecture. In promoting greater use of this tool, not only, as has just been said to produce quality and effective interventions, it is also reported as these experiences through the Albanian cities may be open to collaboration of the best international avant­garde, including on construction techniques and practical realization of complex interventions, participating in a circuit of ideas and innovations ZKLFKIRUPDQ\\HDUVKDYHEHHQGULYHQRXW+HUH the reference is not only to the years of communi­ st rule ­ during which at least some of the themes of urban renewal have been shared at interna­ WLRQDOOHYHOEXWHVSHFLDOO\WKH¿UVWWZRGHFDGHV of transition, during which the city, and good part RI$OEDQLDZDV¿OOHGZLWKEDGDUFKLWHFWXUHHYHQ from a qualitative point of view (leaving aside for a time, disaster planning), perhaps because product by poor quality designers. Durazzo lab for a new generation of European architects )URPWKLVSRLQWRIYLHZDIWHUPDQ\\HDUVRIGHFD\ neglect and production of degradation of the new wealth, the city could really become a laboratory for a new generation of European architects Albanians, also due to the undeniable best results produced by a new breed of architects national, which today has little to envy, as organizational capacity and potential, many studies of Italian design. This is also demonstrated some of the proposals submitted to this contest, from studies RI7LUDQDDQG'XUUHVRIWHQLQFROODERUDWLRQZLWK Italian, Spanish, Portuguese, German, English DUFKLWHFWV)LQDOO\HYHQLIWKHKRSHLVWKDWLQVWHDG of having helped to open up a path ­ Per concludere – anche se l’auspicio è invece quello di aver contribuito ad aprire un percorso ­il Concorso, nel suo complesso, è stata davvero l’occasione per raccogliere attorno al tema dello VSD]LRSXEEOLFRHSLLQJHQHUDOHGHOUHFXSHURHGHOODULYLWDOL]]D­ ]LRQHXUEDQDD'XUD]]RHLQ$OEDQLDGRSRPROWLDQQLGLLQFXULD e indifferenza, una vasta area di esperti già impegnati in loco: archeologi, urbanisti, architetti, tecnici della pubblica amministra­ zione, riannodando legami tra architetti di diverse generazioni tra le due sponde del mare Adriatico. A dimostrazione che anche nella turbinosa Albania della transizione all’economia di mercato e dell’incontrollato sviluppo edilizio è possibile provare a pensare alla qualità e alla vivibilità urbana come valori fondanti e condivisi di una nuova stagione urbana. La speranza è che quest’esperien­ ]DQRQULPDQJDD'XUD]]RXQHSLVRGLRLVRODWRLQTXHVWDGLI¿FLOH HDIIDVFLQDQWHDYYHQWXUDFKHODFLWWjVHPEUDDYHU¿QDOPHQWH intrapreso. (P.R.). Competition, as a whole, it was really an opportunity to gather around the theme of public space and, more generally, the recovery and urban regeneration, LQ'XUUHVLQ$OEDQLDDQGDIWHUPDQ\\HDUVRIQHJOHFW and indifference, a wide area of experts already working on site: archaeologists, urban planners, ar­ chitects, technicians, public administration, strengthe­ ning ties between different generations of architects between the two shores of the Adriatic Sea. Proving that even in turbulent Albania’s transition to a market you can try to think of the quality and urban livability and shared core values as a new urban season. The hope is that this experience does not remain, LQ'XUUHVDQLVRODWHGLQFLGHQWLQWKLVGLI¿FXOWDQG fascinating adventure that the city seems to have ¿QDOO\EHJXQ Tirana, June 2010, Nene Tereze square, site of a next International competition, supported by Embassy of Italy/ Tirana, giugno 2010, piazza Madre Teresa, sito di un prossimo concorso internazionale di architettura, supportato dall’Ambasciata d’Italia. 315 'XUUHVJHQHUDOYLHZRIWKHFLW\GXULQJWKH,WDOLDQERPELQJDJDLQVWWKHRFFXS\LQJ$XVWULDQ Durazzo, 1918, veduta della città durante il bombardamento italiano contro gli occupanti austriaci. Appendix/ Appendice Il senso delle memorie nelle città della transizione all’economia di mercato. Un’ipotesi di ricerca per le città costiere adriatiche Piero Rovigatti 1. Memorie e strutture di permanenza nelle città di transizione E’ ancora possibile dare un senso alle memorie e alle strutture di permanenza urbane1­ intese come patrimonio ereditario comune, materiale ed immateriale, delle molte storie delle città e delle sue popolazioni – assumendole come motivo, assieme, di ricerca e di conoscenza condivisa, che coinvolga in primis le comunità locali, i FLWWDGLQLHLSRUWDWRULGLLQWHUHVVHORFDOHGHOOHFLWWj"3XzWXWWRFLzFRVWL­ tuire la base comune, a cui legare un progetto, condiviso, di sviluppo e di rigenerazione urbana sostenibile, in senso culturale, oltre che ambientale, nelle città adriatiche e balcaniche della transizione all’eco­ nomia di mercato, dopo gli anni della crescita e dello sviluppo incon­ trollato, operato al di fuori di ogni governo e governance territoriale UHVSRQVDELOH"'RSRTXDVLYHQW¶DQQLGLTXHVWRJHQHUHGLVYLOXSSRLQ cui le economie informali, assieme alle forze del mercato immobiliare e della speculazione urbana (o peggio) hanno fatto quasi tabula rasa dei paesaggi urbani originali e di gran parte delle eredità storiche ­ spesso sopravvissuti in questi contesti nonostante la modernità e la sua capziosa interpretazione operata dai regimi collettivistici ­ alte­ rando dalle fondamenta l’immagine, l’assetto e forse anche il senso complessivo di queste città, è ancora possibile costruire nuove trame di relazioni tra le città adriatiche, che svolgano anche nuovi progetti di convivenza, tra le città e all’interno di esse, tra le diverse etnie che ancora compongono – quando non sono state spazzate via, inesora­ bilmente, dalle ultime guerre interetniche –intese anche e soprattutto FRPHVWUDRUGLQDULHSHFXOLDULFRVWUX]LRQLVRFLDOL"(YLWDQGRDOFRQWHPSR di rimanere intrappolati nelle retoriche del ricordo e della nostalgia, e nelle trappole, nelle ambiguità e nei pericoli che, nel passato recente, e ancora oggi, si associano ad un uso perverso2GHOWHPDLGHQWLWDULR" Sono queste le ipotesi di base su cui prova a prendere corpo l’idea di un progetto di ricerca, e assieme di cooperazione decentrata, che in­ tende esplorare sul campo, attraverso il partenariato di università, isti­ tuzioni della tutela e amministrazioni locali, la fertilità di un programma che attraverso azioni comuni di ricerca e di gestione del patrimonio culturale locale, vuole avvalorare un senso attivo, progressivo, delle memorie3 , riconosciute come parte integrante del patrimonio culturale globale, generale, e come base comune di nuove politiche urbane e WHUULWRULDOLLQWHJUDWHFKHDWWHQGRQRTXHVWHFRPSOHVVHDUHHJHRJUD¿­ che, dall’altra parte del mare adriatico. Partendo anche dalla consta­ tazione che la memoria delle città adriatiche è molto spesso memoria di convivenza e di pace, e che la loro storia è stata per molto tempo storia concreta di città aperte, amichevoli, interetniche e intereligiose, (1) La nozione qui adoperata di “strutture urbane di permanenza” va intesa in riferimento a quell’insieme VWUXWWXUDWRRVWUXWWXUDELOHGLHOHPHQWL¿VLFLGLULOHYDQ]D storico culturale che rimanda ed è testimonianza di DVVHWWL¿VLFLHIXQ]LRQDOLDQWHFHGHQWL7DOHGH¿QL]LRQH include ma non si riduce alla sola sommatoria dei “monumenti storici” e dei siti di interesse storico e DUFKHRORJLFRFKHVRQRHYLGHQWHPHQWHVRORODSDUWHSL tutelata o venerata di tali strutture. (2) Sui rischi e i fraintendimenti legati all’uso della QR]LRQHGLLGHQWLWjVLYHGDQRLWHVWL)5(0277, Contro l’identità, Sagittari Laterza, Roma – Bari 1996, HLOSLUHFHQWH)5(0277,/¶RVVHVVLRQHLGHQWLWD­ ULD/DWHU]D5RPD±%DUL'DOO¶LQWURGX]LRQHD TXHVW¶XOWLPRVFULWWR³,QXQPRQGRIDWWRVRORGLµQRL¶HQHO quale le relazioni sono dominate dal perseguimento dei propri interessi, la logica dell’identità trova la sua piena realizzazione. E’ un mondo strapieno di beni e di merci, di ricchezza e desolatamente povero di relazioni e di progetti di convivenza”. (3) Sul tema della memoria e dell’uso consapevole del­ OHHUHGLWjFXOWXUDOLGHOSDVVDWRSLRPHQRUHFHQWHVRQR DVVDLSRFKHOHRFFDVLRQLGLULÀHVVLRQHRSHUDWHLQULIHUL­ PHQWRDOFRQWHVWRDOORVWXGLRXQ¶LQWHUHVVDQWHHFFH]LR­ ne al riguardo è costituita dalle iniziative promosse da Osservatorio sui Balcani, http://www.balcanicaucaso. org/ , in particolare quella intitolata “Cattive memorie”, e dedicata al tema della memorie delle guerre balcaniche  HTXHOODLQWLWRODWD³0HPRULDLQ(XURSD´SL recente, del 2009, incentrate soprattutto sulle vicende della ex Jugoslavia. 319 ,QDOWR'XUD]]RODWUDVIRUPD]LRQHXUEDQDDWWUDYHUVRODFRPSDUD]LRQHIRWRJUD¿FD ,QEDVVR'XUD]]RFHQWURVWRULFRIRWRDUHD 320 DOPHQR¿QRDOODFULVLFKHSURSULRQHJOLXOWLPLDQQLGHO1RYHFHQWRKD riportato in vita tutti i mali di una parte di quella regione, come la propensione all’odio e alla rivendicazione identitaria su base etnico razziale. Nelle note che seguono, viene dato conto dello sviluppo di tale pro­ gramma, in termini di proposta, tutt’ora aperta alla cooperazione di quanti condividano l’approccio proposto, destinato a trovare attua­ zione nelle nuove occasioni di cooperazione decentrata favorite dalla programmazione comunitaria, e in particolare in quella destinata agli stati in condizione di preadesione allo spazio europeo4. 2. Le conseguenza urbane e territoriali della transizione nelle città balcaniche e adriatiche Chi ha pratica attuale delle città albanesi (ma in buona parte lo stes­ so si può dire di molte altre città adriatiche e balcaniche), o ha anche solamente avuto modo di visitarne qualcuna recentemente, sa bene GDFKHJHQHUHGLWUDVIRUPD]LRQH¿VLFDHIXQ]LRQDOHVLDQRVWDWHIDWWH oggetto negli ultimi anni (in particolare nei primi anni del secolo XXI), e che sorte abbiano conosciuto i loro centri storici, o semplicemen­ te le loro aree urbane centrali, o qualsivoglia altro sito di interesse storico culturale, in particolare se ubicato nei pressi nelle maggiori aree urbane, o lungo la costa adriatica. Le città albanesi sono oggi IRUVHODPDQLIHVWD]LRQHSLHYLGHQWHHGHORTXHQWHGLXQDJHQHUDOH rimozione del passato, condivisa in gran parte della popolazione e soprattutto nei comportamenti dei portatori di interesse locale (costruttori, imprenditori edili, imprese locali) e dei decisori politici nazionali e locali. Il turbinoso processo di sviluppo e di trasformazione urbana che si è sviluppato dai primi anni della transizione all’economia di mercato e tuttora in corso, in molte città balcaniche e adriatiche, non ha infatti risparmiato le principali città storiche di queste regioni, alterandone LQSURIRQGLWjO¶DVVHWWR¿VLFRIXQ]LRQDOHHORVWHVVRYDORUHFXOWXUDOHH simbolico. Si tratta di fenomeni che hanno conosciuto scarsa atten­ zione e analisi, tanto a livello nazionale che internazionale, forse DQFKHSHUHIIHWWRGHOODUDSLGLWjGHOFDPELDPHQWRPDDQFRUGLSLSHU una sorta di complicità culturale che ha coinvolto anche le università e gli intellettuali, con scarsissime eccezioni5. Ciò è avvenuto per molteplici cause, sia di natura strutturale, che di natura politica e culturale. Un generale “diritto all’oblio” (A. Giusti,  FRPHVRVWDQ]LDOHUL¿XWRGLRJQLHUHGLWjOHJDWDDOSDVVDWRVLq affermato come convinzione diffusa tanto tra i decisori pubblici che, VRSUDWWXWWRWUDJOLDWWRULGHOORVYLOXSSRFXLKDQQRRSSRVWR¿QRDG oggi, debole resistenza le istituzioni della tutela, della società civile e del mondo culturale. 3. La transizione e i suoi esiti sulle città: un processo concluso? Se il fenomeno di forte alterazione – se non di vera e propria di­ struzione – dei paesaggi storici culturali appare in buona parte di queste regioni, in particolare lungo la costa adriatica, un dato ormai acquisito6 , la domanda che piuttosto va posta è se la fenomenologia GHVFULWWDULJXDUGDXQDIDVHVSHFL¿FDGHOODVWRULDGLTXHVWHFLWWjOD (4) IPA, Adriatic Cross­border Cooperation Programme http://www.adriaticipacbc.org/ .  )DWRV/XERQMHXQRWUDLSRFKLLQWHOOHWWXDOLGHOSDHVH a costituirsi come coscienza critica anche nei confronti dei processi urbani, vistosa metafora di un’economia della transizione ancora fortemente incardinata nei PHUFDWLFULPLQDOLGHOWUDI¿FRGLHVVHULXPDQLGHOOD droga e della prostituzione, sviluppa in un recente arti­ colo una interessante analogia tra l’appello di Roberto Saviano all’Onu per salvare l’Italia da se stessa, e ciò che dovrebbero fare gli intellettuali albanesi nel proprio SDHVHDUULYDQGRDFRQFOXVLRQLDQFRUDSLGHVRODQ­ WL³DQFKHLO3DHVHGHOOHDTXLOHQRQUHDJLVFHSLD corruzione e ingiustizia. E impedisce ai suoi cittadini la felicità e la vita”. Così come in Italia, “Anche la rinascita della società albanese richiede alternative all’economia FULPLQDOH'RYUHPPRFHUFDUOHDSDUWLUHGDOO¶HGXFD]LRQH GHLEDPELQL¿QRDLYDORULVSLULWXDOLHDLSULQFLSLPRUDOL HFRQWLQXDUH¿QRDOODULIRUPDGLXQLQWHURVLVWHPDFKH al momento lascia prosperare il crimine e la disonestà come forme di ingiustizia e di infelicità. Ma questo non è il lavoro di un giornalista. Questo deve essere il lavoro di tutti quelli che, per risollevarsi da questa morte sociale, creeranno vere alternative di rinascita”. Cfr.: http://www.balcanicaucaso.org/aree/Albania/Bella­ e­perduta. (6) Con buona pace di chi ancora ne propone l’immagi­ ne turistico pubblicitaria di “ultima frontiera” dell’Europa, come proponeva un recente sondaggio pubblicato da un noto quotidiano nazionale (http://viaggi.repubblica.it/ articolo/albania­il­paradiso­a­sorpresa/222373 ). 321 Tirana, piazza Skanderbeg, Museo Nazionale transizione all’economia di mercato e i suoi esiti sulle città – e soprat­ tutto se si tratti, ormai a quasi due decenni dal suo avvio, iniziato con la dissoluzione dei regimi comunisti, di un processo concluso, carat­ terizzato in particolare dalla quasi totale assenza di governo pubblico, spontaneismo della crescita, manifestazione del cosiddetto spirito animale del capitalismo, cui è destinato a far seguito un normale sviluppo urbano successivo, come sembrano orientate a suggerire alcune analisi, ad esempio, di autorevoli soggetti internazionali7. &RPHRVVHUYD0DUFR'RJR8, forse si tratta, ancora, soltando della PDQLIHVWD]LRQHSLUHFHQWHGHLFDUDWWHULWLSLFLGLXQDOXQJDVWRULDFKH copre <due secoli di storia dei Balcani, dalla guerra civile ottoma­ QDGL¿QHµDOODULVWUXWWXUD]LRQHJHRSROLWLFDWXWWRUDLQFRUVR8QD “transizione alla modernità” che è (in realtà) un penoso processo di adattamento, segnato dalla tensione fra le strutture ereditate e i PRGHOOLGLVXFFHVVRSURSRVWLGDOODSLDYDQ]DWDHVSHULHQ]DHXURSHD! Espressione dunque, di <un processo mai concluso: da condizione normale di esistenza dei piccoli popoli balcanici, la precarietà si è incorporata come tratto caratteristico nelle loro stesse identità nazio­ QDOLVRJJHWWHDSUHVVLRQLVHPSUHSLHVSORVLYH!0DF¶qDQFKHFKL vede nei fenomeni urbani contemporanei dell’area segnali di diverso colore, notando come, <Nonostante siano state coinvolte in profondi cambiamenti ­ spesso drammatici ­ e segnate dallo scontro violento tra interessi pubblici e privati, le città dei Balcani mantengono un forte spirito europeo, e sono spesso in grado di elaborare proprie soluzioni urbanistiche originali>9. Molti indizi sembrano tuttavia indicare con nettezza un’attenuazione 322 (7) Tra questi, World Bank, che propone una inter­ pretazione della crescita urbana articolata in tre fasi: la prima, caratterizzata dal prevalere dei processi di HGL¿FD]LRQHLQIRUPDOHODVHFRQGDLQFXLDTXHVWLVL associano le prime manifestazioni del mercato formale, cui segue ora la fase dello sviluppo urbano regolato dal mercato legale e dalle sue regole urbanistiche (Cfr.: $/%$1,$85%$16(&7255(9,(:-DQXDU\ 6XVWDLQDEOH'HYHORSPHQW'HSDUWPHQW(XURSH and Central Asia Region, World Bank, January 2007).  0DUFR'RJR³6WRULHEDOFDQLFKH3RSROLH6WDWLQHOOD transizione alla modernità”, Editrice Gorizia, Gorizia 1999. (9) Cfr.: Luisa Chiodi, Chiara Sighele, La metamorfosi delle città in transizione, disponibile alla pagina: http:// www.balcanicaucaso.org/aree/Italia/La­metamorfosi­ delle­citta­in­transizione . Sull’argomento si veda anche il dossier completo “Città balcaniche”, alla SDJLQDKWWSZZZEDOFDQLFDXFDVRRUJ'RVVLHU&LWWD balcaniche.  &IU)DWRV/XERQMDKWWSZZZEDOFDQLFDXFDVR org/aree/Albania/Perche­stiamo­diventando­una­ pattumiera . (11) Su questo si veda l’interessante analisi delle poli­ tiche di tutela durante il regime comunistica ricostruita da A. GIUSTI, nel saggio La cura del tempo. Restauro e tutela del patrimonio culturale albanese, in: <Portola­ no Adriatico>, I, 2005. dello sviluppo urbano, proprio a partire dagli ultimi anni, per cau­ se molteplici, e con questa la necessità e l’opportunità di favorire e avviare nuove politiche di sviluppo e rigenerazione urbana. Tra queste, in primo luogo la diminuzione delle rimesse dei migranti(e forse anche un loro nuovo impiego, oltre la logica del mattone, che ne ha governato l’utilizzo nei primi anni del fenomeno migratorio), ma anche “la riduzione della domanda di abitazioni della gente, legata alla drammatica caduta della qualità della vita nelle città principali a FDXVDGHOO¶LQXUEDPHQWRVHOYDJJLR « ODULGX]LRQHGHJOLLQYHVWLPHQWL GLJXDGDJQLRWWHQXWLGDLWUDI¿FLGLGURJDHSURVWLWX]LRQHFKHSUHFHGHQ­ temente alimentavano tale industria”10 . 4. Le trappole dell’identità Parlare, all’interno di ciò, anche di politiche di tutela e valorizzazione del patrimonio culturale urbano, è tuttavia un’operazione che appare affatto complessa, anche in ragione delle eredità negative delle forme HGHLVLJQL¿FDWLDVVXQWLGDOOHSROLWLFKHSXEEOLFKHLQTXHVWRVHWWRUHGX­ rante il passato regime collettivistico, quando tutelare i centri storici e il patrimonio era parte integrante di una politica di propaganda dai forti connotati ideologici11. Parlare oggi di identità urbana rischia peraltro di essere fuorviante rispetto a obiettivi di comune interesse. Le trappole dell’identità sono sempre pronte a scattare, e così come durante il regime, anche oggi, ancorare le politiche di tutela del patrimonio cul­ turale ad un sempre presente moto d’orgoglio nazionale, fortemente intriso di valori nazionalistici e sciovinisti, rischia di produrre risultati di grande rischio culturale, come sembrano indicare alcune tendenze di revisione degli apparati statali in materia, realizzati in nome della retorica nazionalistica della “Grande Albania”12. 5. Tutela e valorizzazione del patrimonio occasione di cooperazione Che il tema della tutela sia un tema di estremo interesse e urgenza per possibili programmi di cooperazione è dunque sotto gli occhi di WXWWLIRUVHPHQRSDOHVHqODUDULWjGHLSURJHWWLHGHOOHHVSHULHQ]HDV­ VLHPHDOODVFDUVDHI¿FDFLDHGRSHUDWLYLWjGHOOHVWUXWWXUHVWDWDOLHORFDOL attive in materia. Anche rispetto all’attività degli organismi internazio­ nali di cooperazione, a cominciare dall’UNESCO, appare evidente O¶LQFDSDFLWjGLLQFLGHUHLQPDQLHUDVLJQL¿FDWLYDVXLSURFHVVLLQFRUVR anche se qualche segnale in controtendenza comincia a manifestar­ si13. Quello che va favorito è assieme la crescita di consapevolezza LQPDWHULDGDSDUWHGHOODFRVLGHWWDVRFLHWjFLYLOH WHUPLQHGLGLI¿FLOH interpretazione anche nell’Albania contemporanea, e probabilmente in buona parte dei Balcani contemporanei) e la capacità delle ammi­ nistrazioni locali, prime responsabili del governo della trasformazione, che attendono di essere indirizzate anche attraverso esperienze di buone pratiche urbane. C’è spazio, su questi temi, tanto per la coope­ razione decentrata che per progetti che sappiano cogliere le oppor­ tunità della nuova programmazione europea, che individuano proprio nella tutela e valorizzazione delle “natural and cultural resources”, assieme al tema del “risk prevention”, una delle priorità14 su cui far convergere l’azione combinata delle città europee. (12) Tra questi, la riarticolazione del sistema della tutela sotto la direzione di un unico Istituto di Albanologia, che sovrintende ai precedenti Istituto dei Monumenti di Cultura, e all’Istituto Archeologico. (13) Come è noto, solo solo due i riconoscimenti UNE­ 6&2 :RUOG+HULWDJH)RXQG FKHULJXDUGDQRO¶$OEDQLD uno riguarda il sito archeologico naturalistico di Butrinto, LOVHFRQGRLGXHVLWLVHSDUDWLLQVHQVRJHRJUD¿FRGL%HUDW e Gjiorkaster, esempi pressocchè unici di centri storici di impronta ottomana.  &IU,3$$'5,$7,&&5266%25'(5&223(5$­ TION PROGRAMME, 30 giugno 2010, pag. 69, disponi­ bile alla pagina: http://www.adriaticipacbc.org/download/ 352*5$00(B'2&80(176,3$B$'5,$7,&B&%&B PROGRAMME_C_2010_3780.pdf . E’ interessante notare come la misura 2.2 del programma di priorità “Natural and Cultural Resource Management and Preven­ tion of Natural and Technological Risks”, metta assieme la gestione delle risorse Naturali e culturali assieme alla prevenzione dei rischi naturali e tecnologici. (15) Che devono in primo luogo provare a dare risposta a problemi come l’innalzamento delle densità abitative, la riduzione/marginalizzazione dello spazio pubblico, l’abbassamento degli standard urbanistici (attrezzature pubbliche) e dell’offerta di servizi pubblici (istruzione, sanità, cultura, verde, tempo libero), la JHQWUL¿FDWLRQ delle aree centrali e di maggior pregio paesaggistico/ambien­ tale/storico culturale, il consumo di suolo e la produzione di ampie aree di habitat informale, anche in contesti di interesse ambientale e storico, la perdita di identità urbana e territoriale.  6LVHJQDODDVVLHPHDOVLJQL¿FDWR¿QTXLXWLOL]]DWRGHO termine transizione, come condizione di passaggio delle economie collettivistiche verso quelle di mercato, come lo stesso termine sia oggi utilizzato da quanti oggi lavorano e operano a favore della riconversione/transizione in VHQVRHFRORJLFRGHOOHFLWWjVLYHGDDOULJXDUGRKWWS en.wikipedia.org/wiki/Transition_Towns . (17) Tra questi, la recente Biennale di Arte contempo­ ranea di Tirana, dedicata quest’anno anche a stimolare un dibattito sullo sviluppo urbano e le sue conseguenze. Come afferma Edi Muka, direttore dell’edizione 2010: “Una novità di questa edizione della TICAB è inoltre che non si occupa solo di arte concettuale ma anche di archi­ tettura e di sviluppo urbano. E’ interessante per aprire un dibattito sulla tensione che scaturisce dallo scontro tra ODSURSULHWjSULYDWDHTXHOODSXEEOLFD+DDFKHIDUHFRQ lo sfrenato sviluppo urbanistico dell’Albania e degli altri paesi balcanici mentre si affacciano al sistema neolibe­ ULVWDHDOFDSLWDOLVPRQHOOHVXHIRUPHSLVHOYDJJH1RQ vogliamo solo esporre delle opere, ma stimolare una ricerca critica su questi aspetti.”(disponibile alla pagina: http://www.balcanicaucaso.org/ita/aree/Albania/Quando­ la­biennale­e­a­Tirana ). Si tratta allora di provare a declinare assieme a questi temi le nuove 323 domande di governo urbano e territoriale15 , interpretando i cam­ biamenti in corso e favorendo nuove prospettive di riconversione e transizione delle città16. E rispetto a ciò, è evidente che sia proprio il caso delle città costiere e transfrontaliere a mostrarsi ­ anche rispetto alla gestione del patrimonio delle risorse culturali e ambientali – come quello di maggiore interesse. Piuttosto, occorre considerare come TXHVWRJHQHUHGLWHPDVSHFL¿FRSRVVDHVVHUHULFRQRVFLXWRFRPH rilevante all’interno dei temi ora elencati, che ancora oggi caratteriz­ zano la transizione di queste città nelle nuove relazioni economiche nazionali e internazionali. Si tratta insomma di valutare quanto la tutela e la valorizzazione del patrimonio culturale e ambientale assu­ ma una valenza strategica all’interno dei temi del governo delle città, dell’urbanistica e dell’architettura della transizione. Molte conferme attestano infatti di un sostanziale disinteresse dei portatori di interes­ se locale e dei decisori politici verso questo tema, solo timidi segnali sembrano annunciare un inversione di tendenza verso il generale stato di abbandono e di indifferenza che ancora caratterizza il senso e il valore attribuito all’universo delle memorie e al loro possibile uso e VLJQL¿FDWRFROOHWWLYR17. 6. Un’ipotesi di ricerca: dare senso attivo, condiviso e progressivo, alle memorie urbane. /¶LQVLHPHGHOOHULÀHVVLRQLTXLULDVVXQWHqDOODEDVHGLXQSURJHWWRLQ corso di costruzione, che vede coinvolte diverse università adriati­ che, assieme ad enti di tutela e amministrazioni locali18, che prova a sviluppare una modalità di utilizzo delle memorie urbane in senso attivo, condiviso e progressivo. In altri termini, il progetto, intende spe­ ULPHQWDUHO¶XWLOLWjGHOO¶DQDOLVLVWRULRJUD¿FDHGHOOHSHUPDQHQ]H¿VLFKH multidisciplinare e integrata, come enzima della progettazione urbana HGLXQDFRUUHWWDSLDQL¿FD]LRQHHJHVWLRQHXUEDQDHWHUULWRULDOHDWWHQWD alla sostenibilità delle opzioni di sviluppo sia in senso ambientale che culturale. Ciò avviene attraverso un’azione combinata di azioni ­ attività di ricerca (best practices), attività di ricerca d’archivio (nazio­ nali e locali), attività di formazione (attività all’estero e on job training), realizzazione di un portale webHGLVLWLGHGLFDWL¿QRDOODUHDOL]]D]LRQH sperimentale di un modello di “museo/casa della città” minimo, anche sotto forma di assistenza/avviamento/addestramento di gruppi di operatori locali – rivolte principalmente ai decisori pubblici, ma anche all’insieme degli stake holder (portatori di interesse locale) protagonisti del cambiamento e della trasformazione urbana. L’idea, in estrema sintesi, è quella di costruire, in ogni città coinvolta dal programma, un nucleo fondativo, anche in termini gestionali, di una nuova idea di “Museo di città”, nella forma di una vera e propria “Casa della Città”, come sovrapposizione ed integrazione tra l’origi­ naria idea di tradizione ottocentesca di “Museo di storia urbana”, e TXHOODSLUHFHQWHGLWUDGL]LRQHDQJORVDVVRQHGL8UEDQ&HQWHU19. In questo senso, il progetto, attraverso lo stumento del “museo/casa della città”, sia in versione virtuale (sito web), sia, in forma sperimen­ tale, in versione reale, intende contribuire alla promozione di un senso diffuso di appartenenza al territorio: a un processo di riappropriazio­ ne culturale capace di produrre senso e orientamento, di suscitare SURFHVVLGLLGHQWL¿FD]LRQHPDDQFKHGLDSHUWXUDDOFDPELDPHQWRH 324 (18) Il progetto, promosso in occasione del bando IPA 2010, vede tra i partner l’Università di Bologna, Parma, &KLHWLH3HVFDUDLO)RUXPGHOOH&LWWjGHOO¶$GULDWLFR HGHOOR,RQLRHWUDLVRJJHWWLEHQH¿FLDULOH8QLYHUVLWj GL'XUUHV6NKRGHU $OEDQLD %HOJUDGR 6HUELD L FRPXQLGL'XUUHV6KNRGHU%XGYD 0RQWHQHJUR H LO&(175$/7(&+1,&$/$5&+,9(6)25&21­ STRUCTION, Ministry of Public Works, Transport and Telecommunication, Republic of Albania. (19) Molto utile e interessante, al riguardo, il sito: http:// www.urban­center.org/online/ , espressione dell’Os­ servatorio di ricerca sugli urban center, promosso tra gli altri, dall’Università la Sapienza di Roma: “Mis­ sioni principali dell’Osservatorio sono: monitorare il panorama degli Urban Center nazionali, ricostruendo una mappa dinamica per modelli culturali e favorendo lo scambio di esperienze attraverso un contatto “real WLPH´FRQOHSLFRQVROLGDWHVWUXWWXUHLQ(XURSDHQHO 1RUG$PHULFDDWWLYDUHHVYLOXSSDUHXQD³8UEDQ&HQWHU $JRUj´GLULÀHVVLRQHHFRQIURQWRFULWLFRXQOXRJRG¶LQ­ contro aperto a tutti, che inviti a contribuire direttamen­ te al dibattito, approfondendo le ricche sfaccettature GHOIHQRPHQRPHWWHUHDIXRFRFULWLFLWjHRSSRUWXQLWjGL evoluzione degli Urban Center in rapporto alle strategie inclusive e al management dei punti di vista dialettici degli attori a vario titolo impegnati nella costruzione GHOOHSROLWLFKHGLWUDVIRUPD]LRQHGHOODFLWWjVRVWHQHUH e incentivare l’innovazione di stili, mission, attività e forme di gestione, accompagnando start up, evoluzione e consolidamento delle strutture verso una dimensione stabile e matura.” In alto: Bogotà, Museo di Storia Urbana, novembre 2010. ,QEDVVR0XVHRGLIIXVRGL$QFRQDLOORJRGHOSURJHWWR³6HQWLHULHEUDLFL´ )RQWHKWWSZZZFRPXQHDQFRQDLWWXULVPRLWQHZVPXVHRBGLIIXVRKWPO 325 DOODWUDVIRUPD]LRQHLGHQWLWDULDDQFKHDO¿QHGLSUHGLVSRUUHDWWHJJLD­ PHQWLGLIIXVLSLUHVSRQVDELOLYHUVROHGLQDPLFKHGHOOHWUDQVL]LRQH ,QTXHVWRVHQVRHVVRSXzDQFKHGLYHQWDUHVWUXPHQWRGHOODSLDQL¿­ cazione urbana, elemento ausiliario dotato di ruolo informativo e di ricerca ma anche propositivo, risorsa e riferimento essenziale per WXWWLJOLDWWRULGHOODSLDQL¿FD]LRQHXUEDQDFXVWRGHHGHODERUDWRUH della memoria storica della città. La metodologia proposta prevede un’azione combinata di azioni (ricerca, elaborazione, divulgazione) LOFXL¿QHJHQHUDOHqODPHVVDVRWWRRVVHUYD]LRQHGHOOHPXWD]LRQLGL assetto complessivo della città e delle sue parti, attraverso la lettura delle variazioni morfologiche e funzionali, intercorse nel corso del tempo, anche attraverso un’analisi multidisciplinare e integrata, che SUHYHGHDQFKHLOFRQIURQWRWUDOHFDUWRJUD¿HOHLPPDJLQLDHUHH HIRWRJUD¿FKHHOHQDUUD]LRQLGHOODFLWWjFRHYH JXLGHUDFFRQWLGL viaggio, resoconti di piano e studi) disponibili a diverse date, con una particolare attenzione alle trasformazioni urbane operate nelle città dagli architetti e dagli urbanisti dalla prima metà del Novecento, e in SDUWLFRODUHDTXHOOHSLUHFHQWLGHJOLDQQLGHOODWUDQVL]LRQHDOO¶HFR­ nomia di mercato. L’idea di fondo è di pensare ad un’azione di ricostruzione urbana (a una rete di ricostruzioni urbane) ­ culturale, prima ancora che materiale ­ fondate sulla storia urbana e sulla consapevolezza delle trasformazioni urbane passate e recenti nelle città dello sviluppo urbano impetuoso e, appunto, inconsapevole, della transizione. Una ricostruzione culturale che insegue la trasformazione in corso, pro­ vando a fecondarla con elementi di conoscenza condivisa, basata sulle molte storie e sulle tracce materiali e immateriali che tali storie hanno sedimentato nell’esperienza di tali città, e che rischiano, an­ cora, di andare perdute, oltre che ignorate dai decisori e dagli stake holder attuali, protagonisti dello sviluppo. 23 novembre 2010 Nella pagina a destra e seguente: Stoccolma, Museo dell’Architettura, presso il Moderna Museet. 326 %LEOLRJUDÀDPLQLPDSHUXQLQTXDGUDPHQWRGHOODVWRULDXUEDQDGHOODFLWWj Minimum Bibliography for a framework of urban history of the city of Durres /+HX]H\+'DXPHWMission Archeologique de Macedoine, Paris 1902, Ugo Ometti, L’Albania, Casa Editrice Nazionale Roux e Viarengo, Torino 1914, A. Italo Sulliotti, In Albania sei mesi di Regno)UDWHOOL7DYHV(GLWRUL0LODQR 1925, L. Rey, “Le Remparts de Durazzo”, in Albania, I, pp. 33 ­ 49. 9,,,*XVWDYR7UDJOLDL’Albania di Re Zog, Edizioni Tiber, Roma 1937, Antonio Baldacci , Studi speciali albanesi, Istituto per l’Europa Orientale, Roma 1939, Antonio Baldacci, L’Albania, Istituto per l’Europa Orientale, Roma 1940, CTI, Ministero degli Esteri, Albania, Guida d’Italia della Consociazione turistica italiana, 6RWWRVHJUHWDULDWRGL6WDWRSHUJOL$IIDUL$OEDQHVL8QLRQH7LSRJUD¿FD0LODQR 1941, Luciano Magrini, Le isole, l’Albania e l’Epiro (Maggio 1912 ­ Giugno 1913) Ristampa delle corrispondenze inviate al “Secolo”, Società editoriale italiana,Milano. $4717LUDQD8I¿FLR&HQWUDOHSHUO¶(GLOL]LDHO¶8UEDQLVWLFDPiano Regolatore di Durazzo. Relazione. 6' (UPDQQR$UPDR/RFDOLWjFKLHVH¿XPLPRQWLHWRSRQLPLYDULGLXQ¶DQWLFDFDUWDGHOO¶$OEDQLD6HWWHQWULRQDOH, Istituto per l’Europa Orientale, Roma 1969, A. Mambriani, Sull’architettura moderna nei paesi balcanici, Cappelli, Bologna. 1978, Enrico Guidoni, /D&LWWj(XURSHD±)RUPD]LRQHHVLJQL¿FDWRGDO,9DOO¶;,VHFROR, Electa Editrice, Milano. 1983, A. Meksi, Arkitektura mesjetare ne Shqiperi (shek. VII­XV)$UFKLWHWWXUDPHGLHYDOHLQ$OEDQLD VHFROL9,,;9 7LUDQD 0QLU&HUDVL,OVLVWHPDXUEDQRGLIIXVRODUHWHXUEDQDDQDWRPLFREDOFDQLFDQHLVHFROL;9,,,±;,;LQStoria urbana, IX, n. 30. 1985, Ludovico Micara, Architettura e Spazi dell’Islam, Carucci Editore, Roma. 1988, Münir Cerasi, La città del Levante. Civiltà urbana e architettura sotto gli Ottomani nei secoli XVIII e XIX, Jaca Book editore, Milano. 0.LHOOttoman Architecture in Albania 1385 – 19125HVHDUFK&HQWUHIRU,VODPLF+LVWRU\$UWDQG&XOWXUH,VWDPEXO 6ORERGDQûXUþLü$UFKLWHFWXUHLQWKHDJHRILQVHFXULW\$QLQWURGXFWLRQWRVHFXODUDUFKLWHFWXUHLQWKH%DONDQV± LQ6ûXUþLü(+DGMLWU\SKRQRV HGLWHGE\ Secular medieval architecture in the Balkans and its preservation, 1300 – 1500, AIMOS, Thessaloniki. 2000, P. Rovigatti (a cura di), “Un piano per Durazzo”, Quaderni di Piano Progetto Città, supplemento al n. 17 della rivista PPC GHO'LSDUWLPHQWRGL$UFKLWHWWXUDH8UEDQLVWLFD8PEHUWR6DOD(GLWRUH3HVFDUD 2000, L. Micara, L’eredita del passato, in: P. Rovigatti (a cura di), op. cit., pp. 10 – 17. 2000, A. Staffa, La città archeologica, in: P. Rovigatti (a cura di), op. cit., pp. 18 – 29. 2000, U. Crescenti, N. Sciarra, L’ambiente geologico, in: P. Rovigatti (a cura di), op. cit., pp. 30 – 35. 2000, T. Cetrano, Ambiente e paesaggio, in: P. Rovigatti (a cura di), op. cit., pp. 36 – 45. 2000, R. Pavia, La portualità, in: P. Rovigatti (a cura di), op. cit., pp. 58 ­ 67. 2000, P. Rovigatti, Albania, Durazzo, quattro anni dopo, in: P. Rovigatti (a cura di), op. cit., pp. 188 – 197. 2002, Cyril Mango, Architettura Bizantina, Electa Editrice, Milano. -RKQ'+RDJArchitettura Islamica, Electa Editrice, Milano. 0LFKHOH)DVRORLa Via EgnatiaYRO'D$SROORQLDH'\UUDFKLXPDG+HUDNOHLD/\QNHVWLGRV,VWLWXWR*UD¿FR(GLWRULDOH Romano – Roma. 2003, Maurizio Buora e Sara Santoro (a cura di) Progetto Durres – L’indagine sui beni culturali albanesi dell’Antichità e del Medioevo: tradizioni di studio a confronto, Antichità Altoadriatiche – LIII, Editreg Srl , Trieste. 2003, Sara Santoro, Lo stato degli studi sull’urbanistica di Epidamnos – Dyrrachium, in: 2003, Maurizio Buora e Sara Santoro (a cura di), op. cit., pp. 149 – 209. 2004, Maurizio Buora e Sara Santoro (a cura di) 3URJHWWR'XUUHV$WWLGHOVHFRQGRHGHOWHU]RLQFRQWURVFLHQWL¿FR, Antichità $OWRDGULDWLFKH±/9,,,(GLWUHJ6UO7ULHVWH 329 2004, Alberto Monti, Archeologia ambientale e GIS per una Carta Archeologica: capire, tutelare e valorizzare la storia di un territorio, in: 2004, Maurizio Buora e Sara Santoro (a cura di) op. cit., pp. 61 – 83. 2004, Sara Santoro, Il Progetto Pilota “Progettazione e realizzazione del Parco Archeologico Urbano di Durres (Albania)”, in: 2004, Maurizio Buora e Sara Santoro (a cura di) op. cit., pp. 429 ­ 439. 2004, Alberto Monti, Sara Santoro, Carta del rischio archeologico della città di Durres, metodologia di realizzazione ed istru­ zioni per l’uso in: 2004, Maurizio Buora e Sara Santoro (a cura di) op. cit., pp. 525 ­ 554. 50DQFLQL/¶$OEDQLDGHJOL,WDOLDQL0LWRSURSDJDQGDGHPDJRJLDGDOOD¿QHGHOO¶2WWRFHQWRDOIDVFLVPRLQPortolano Adriatico, rivista di storia e cultura balcanica, I, n. 1. 2005, Adriana Sarro, La Multiculturalità nella Città del Mediterraneo*UD¿OO(GLWRUH3DOHUPR 6DUD6DQWRUR$IULP+RWL%DUEDUD6DVVL DFXUDGL /¶DQ¿WHDWURURPDQRGL'XUD]]R6WXGLHVFDYL±LQ Annuario della Scuola Archeologica di Atene e delle missioni italiane in Oriente9ROXPH/;;;,,,6HULH,,,±7RPR,, 2006, Renato Novelli (a cura di), La Porta d’Oriente. Sbarcare, viaggiare, conoscere la regione di Durazzo, Il Lavoro Editoria­ le, Ancona. 2006, Renato Novelli (editor), Gateway to the East. Disembarking, travelling around and discovering the region of Durres, Il Lavoro Editoriale, Ancona. 2006, Maria Adriana Giusti, Albania Architettura e Città, 1925 – 19430DVFKLHWWR(GLWRUH)LUHQ]H 2006, Maria Adriana Giusti, “Per lo Sviluppo Edilizio Albanese”: i piani regolatori di Durazzo, Elbasan e di altri centri albanesi, in: 2006, Maria Adriana Giusti, op. cit., pp. 11 ­ 17. 0DULD$GULDQD*LXVWL³/DFLWWjYHFFKLDULQQRYDWDHLOVXRDPSOLDPHQWR´LSLDQLUHJRODWRULGL'XUD]]R(OEDVDQHGLDOWUL centri albanesi, in: 2006, Maria Adriana Giusti, op. cit., pp. 67 – 90. 6LWRJUDÀD http://www.iliriasquarecompetition.org http://www.durres.gov.al/ http://www.progettodurres.unipr.it/ http://www.unich.it/dart/eventi/2009/2009_01_30_durazzo_revitali.pdf 330 331