Leket : Yidishe shtudyes haynt. Jiddistik heute. Yiddish Studies Today

Efrat Gal-Ed

The journal Der Yid was the first Yiddish periodical officially tied to a Zionist body. This article follows the shared genealogy of early Zionism and diasporic nationalism as expressed in Der Yid, and offers a revision to common notions on Yiddish cultural and political revival around the turn of the twentieth century. In contrast with a tendency to highlight a sharp divide between these movements, this article emphasizes the points of intimacy and convergence between the ostensibly opposing ideological and lingual choices of Hebraism-Zionism and Yiddishism-diasporism. More specifically, it analyses a controversy between Yiddishists and Hebraists, particularly Ahad Ha`am, generated by the very title of the journal during its first year of publication: Who is Der Yid – the Jew? Who is the ultimate imagined national readership and national collective of a Yiddish-language journal? By probing the populist, sentimentalist discourse that the journal produced, this article argues for a renewed evaluation of the presumably dichotomous constructions of Hebrew versus Yiddish, or Zionism versus diasporic nationalism.

An introduction from the editors of the special issue of In geveb on Religious Thought in Yiddish. Note: This special issue is being released in two segments. Not all of the pieces mentioned in this introduction have yet been published.

Course Overview: At the turn of the 20 th century millions of Yiddish-speaking East European Jews arrived in America. Through study of the Yiddish literature and culture they produced, this course will give students insight into these immigrants' experience and their efforts to find a comfortable perch in the American landscape. The course will be subdivided into four sections covering different aspects of these Yiddish-speaking immigrants' experience and efforts: The immigration process and arrival in America; immigrant entry into the workplace; encounter with urban modernity and America's racial and ethnic diversity; the tension between assimilatory pressures and the desire for a transnational identity. Although turn-of-the-century Jewish immigrants produced an unprecedented Yiddish cultural blossoming worthy of concentrated study, this course, which fulfills the Undergraduate Studies Ethnic Studies General Education Requirement, strives to employ this rich culture as a jumping-off point to help you achieve greater understanding and appreciation of the experience of contemporary ethnic/racial minorities with origins abroad who have become a growing element of American society since the expansion of immigration to the United States in the 1960s. Learning Goals: 1) Students will achieve greater understanding and appreciation of diversity and thereby help improve campus climate and better prepare themselves for life and careers in an increasingly multicultural U. S. environment. 2) Through study of American Yiddish culture students will attain knowledge of the immigration process and the challenges faced by ethnically and racially divergent immigrant groups as they work to find their desired place in America. 3) Students will achieve grounding in American Yiddish Culture through encounter with works created by fifteen of its leading authors, poets, and directors. 4) Students will learn strategies for analyzing literary, filmic, and poetic texts intended to improve their critical thinking.

‫לקט‬ ‫ייִ דישע שטודיעס הנט‬ Jiddistik heute Yiddish Studies Today ‫ייִ דיש‬ Jiddistik Edition & Forschung Yiddish Editions & Research ‫ארשונג‬ ָ ‫אויסגאבעס און‬ ַ Der vorliegende Sammelband ‫לקט‬ eröffnet eine neue Reihe wissenschaftlicher Studien zur Jiddistik sowie philologischer Editionen und Studienausgaben jiddischer Literatur. Jiddisch, Englisch und Deutsch stehen als Publikationssprachen gleichberechtigt nebeneinander. Leket erscheint anlässlich des . Symposiums für Jiddische Studien in Deutschland, ein im Jahre  von Erika Timm und Marion Aptroot als für das in Deutschland noch junge Fach Jiddistik und dessen interdisziplinären Umfeld ins Leben gerufenes Forum. Die im Band versammelten  Essays zur jiddischen Literatur-, Sprach- und Kulturwissenschaft von Autoren aus Europa, den , Kanada und Israel vermitteln ein Bild von der Lebendigkeit und Vielfalt jiddistischer Forschung heute. ISBN 978-3-943460-09-4 9 783943 460094 ‫אויסגאבעס און ָארשונג‬ ַ ‫ייִ דיש‬ Jiddistik Edition & Forschung Yiddish Editions & Research Herausgegeben von Marion Aptroot, Efrat Gal-Ed, Roland Gruschka und Simon Neuberg Band 1 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Jiddistik heute Yiddish Studies Today Herausgegeben von Marion Aptroot, Efrat Gal-Ed, Roland Gruschka und Simon Neuberg Yidish : oysgabes un forshung Jiddistik : Edition & Forschung Yiddish : Editions & Research Herausgegeben von Marion Aptroot, Efrat Gal-Ed, Roland Gruschka und Simon Neuberg Band 1 Leket : yidishe shtudyes haynt Leket : Jiddistik heute Leket : Yiddish Studies Today Bibliograĳische Information Der Deutschen Nationalbibliothek Die Deutsche Nationalbibliothek verzeichnet diese Publikation in der Deutschen Nationalbibliograĳie ; detaillierte bibliograĳische Daten sind im Internet über http://dnb.d-nb.de abrufbar. © düsseldorf university press, Düsseldorf 2012 Alle Rechte vorbehalten. Das Werk einschließlich aller seiner Teile ist urheberrechtlich geschützt. Jede Verwertung ist ohne Zustimmung des Verlags unzulässig. Das gilt insbesondere für Vervielfältigungen, Übersetzungen, Mikroverĳilmungen und die Einspeicherung in elektronische Systeme. Typograĳie, Satz, Umschlag : Efrat Gal-Ed Druck und Bindung : Druckerei C. H. Beck, Nördlingen Hauptschriften : Brill, Hadassah EF Papier : 100 g / m 2 Geese-Spezial-Offset ISBN 978-3-943460-09-4 ISSN 2194-8879 URN urn:nbn:de:hbz:061-20120814-125211-1 Printed in Germany Inhalt Table of Contents Vorwort Foreword 7 11 1. In pardes fun moderner yidisher literatur Lesarten moderner Literatur Readings in Modern Literature Lawrence Rosenwald On Itzik Manger ’ s “ Khave un der eplboym ” Efrat Gal-Ed Spur und Differenz : Zu Kadya Molodowskys SulamithGedichten Barbara E. Mann Of Madonnas and Magdalenes : Reading Mary in Modernist Hebrew and Yiddish Women ’ s Poetry Kathryn Hellerstein Against “ Girl Songs ” : Gender and Sex in a Yiddish Modernist Journal Jordan Finkin The Consolation of Sadness : The Curious Exile of Dovid Hofshteyn ’ s Troyer Heather Valencia From Der tsirk to Erev mayn farbrenung : The Transformation of Experience in Two Poems by Avrom Sutzkever Jeffrey A. Grossman The Invention of Love ? Or How Moyshe Leyb Halpern Read Heinrich Heine Harriet Murav Marking Time : Bergelson and Bergson Ken Frieden Yiddish in Abramovitsh ’ s Literary Revival of Hebrew Jan Schwarz “ Nothing But a Bundle of Paper ” : Isaac Bashevis Singer ’ s Literary Career in America Sabine Koller Mentshelekh un stsenes : Rahel Szalit-Marcus illustriert Sholem Aleichem Alyssa Quint Avrom Goldfaden ’ s Sheygets Theater Nathan Cohen Sherlock Holmes in the Pale of Settlement : Yiddish Crime Stories 1860 – 1914 17 31 49 69 91 109 129 153 173 189 207 233 253 2. Eltere tekstn Älteres Jiddisch Early Yiddish Erika Timm Abraham ibn Ezra und das Maiśebuch Wulf-Otto Dreessen Dovid und Wolfdietrich Diana Matut What Happened in Hamburg… A Yiddish Document about Polish Jews in Germany during the Early Modern Period Simon Neuberg Die Sprache des Meliz-jȯšer 281 309 321 357 6 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ 3. Lingvistik Sprachwissenschaft Linguistics Roland Gruschka Von Petach Tikwa über Jaffa nach Meknès : Eine jiddische Postkarte aus dem Jahre 1902 als sprachgeschichtliche Quelle Ewa Geller Die vielfach verkannte Jiddische Grammatik des Ludwik Zamenhof Jürg Fleischer und Lea Schäfer Der Kasus nach Präposition in westjiddischen Quellen des ( langen ) 19. Jahrhunderts Alexander Beider Eastern Yiddish Toponyms of German Origin Moshe Taube On the Relative Marker Vos and Yiddish Post-Modiĳiers Steffen Krogh How Satmarish is Haredi Satmar Yiddish ? 369 393 415 437 467 483 4. Kultur un politik Kultur und Politik Culture and Politics Gennady Estraikh Zalman Wendroff : The Forverts Man in Moscow Rebecca Margolis Holocaust and Post-Holocaust Yiddish Theater in Montreal : A Canadian Response to Catastrophe Tamar Lewinsky Un az in Treblinke bin ikh yo geven iz vos ? H. Leyvik und die Sheyres-hapleyte Barry Trachtenberg Bridging the “ Great and Tragic Mekhitse ” : Prewar European Yiddish Serials and the Transition to Post-Khurbn America Rachel Rojanski Yiddish Journals for Women in Israel : Immigrant Press and Gender Construction ( 1948 – 1952 ) Aya Elyada Deutsche Übersetzungen jiddischer Literatur : Fünf Jahrhunderte interkultureller Austausch und Kontakt Shlomo Berger Religion, Culture, Literature : On Yehoyesh ’ s Preface to His Yiddish Bible Translation Aleksandra Geller Auseinandersetzung über die jiddische Orthographie in der Kulturzeitschrift Literarishe bleter Asya Vaisman “ A is for the Almighty ” : Transmitting Values through Contemporary Hasidic Children ’ s Literature 509 Transliteration des Hebräischen Hebrew Transliteration Danksagung Acknowledgements Autoren und Herausgeber Authors and Editors 661 662 663 529 545 565 585 603 619 635 651 Vorwort Der vorliegende Sammelband ‫ לקט‬erscheint anlässlich des xv. Symposiums für Jiddische Studien in Deutschland, ein im Jahre 1998 von Erika Timm und Marion Aptroot für das in Deutschland noch junge Fach Jiddistik und deren interdisziplinäres Umfeld ins Leben gerufenes Forum. Seitdem wird das Symposium von den beiden jiddistischen Lehrstühlen an der Universität Trier und der Heinrich-Heine-Universität Düsseldorf veranstaltet. Mittlerweile hat die jiddistische Forschung in Deutschland einen bedeutenden Aufschwung genommen. An judaistischen, germanistischen, slawistischen, anglistischen und kulturwissenschaftlichen Instituten ist eine wachsende Beschäftigung mit der jiddischen Sprache und Literatur zu verzeichnen. Darüber hinaus hat der Lehrstuhl für Jüdische Literaturen an der Hochschule für Jüdische Studien Heidelberg seit 2010 ein neues jiddistisches Proĳil. Mit dem Band ‫ לקט‬wird eine neue Reihe wissenschaftlicher Studien zur Jiddistik sowie philologischer Editionen und Studienausgaben jiddischer Literatur eröffnet. Jiddisch, Englisch und Deutsch stehen als Publikationssprachen gleichberechtigt nebeneinander. Veröffentlichungen zur Jiddistik sind seit ihren Anfängen nicht nur auf Jiddisch, sondern ebenfalls in den Sprachen der jeweiligen Mehrheitskulturen ihrer Forscher erschienen, in den letzten Jahrzehnten jedoch überwiegend auf Englisch, Hebräisch, Deutsch, Französisch, Polnisch und Russisch, kaum noch auf Jiddisch. Dies führte zu einer nahezu ausschließlichen Reproduktion jiddischer Textstellen in Transkription ( ausgenommen hebräische Veröffentlichungen ). Im Gegensatz dazu bietet die hier vorgestellte Reihe jiddische Texte in hebräischer Schrift – auch als Zitat in deutschen und englischen Texten – und akzentuiert damit das selbstverständliche Schriftbild des Jiddischen. Zitate aus ostjiddischen Quellen ab 1800 werden in der Regel in yivoOrthographie gesetzt. Wo erforderlich, wird modernes Ostjiddisch nach dem yivo-System transkribiert, älteres Jiddisch dagegen nach dem Trierer System. Hebräisch wird transliteriert (s. Tabelle im Anhang). enthält Beiträge zur jiddischen Literatur, Sprache und Kultur, die ein Schlaglicht auf den internationalen Diskurs und die thematische und methodologische Vielfalt jiddistischer Forschung der Gegenwart werfen. Der Sammelband ist in vier Bereiche gegliedert : ‫לקט‬ 8 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Lesarten moderner jiddischer Literatur Exemplarische Lesarten moderner jiddischer Literatur eröffnen den Band. In den in dieser Sektion versammelten Beiträgen sind modernistische jiddische Dichterinnen und Dichter ebenso als Thema vertreten wie gefeierte Gründergestalten der Epoche der › jiddischen Klassiker ‹, Buchillustratoren und die namenlosen Leser jiddischer Unterhaltungsliteratur. Lawrence Rosenwald (Wellesley College) bietet ein › close reading ‹ eines der » Bibel-Gedichte « von Itzik Manger, Khave un der eplboym. Efrat Gal-Ed ( Heinrich-Heine-Universität Düsseldorf ) untersucht Kadya Molodowskys poetisches Verfahren anhand ihres Umgangs mit der biblischen und rabbinischen Figur der Sulamith. Barbara E. Mann ( The Jewish Theological Seminary of America ) vergleicht das jiddische Werk Anna Margolins mit dem hebräischen von Leah Goldberg im Hinblick auf die Rolle der Gestalt der Maria. Kathryn Hellerstein ( University of Pennsylvania ) analysiert die Konstruktion von Geschlechteridentität in den Veröffentlichungen der New Yorker Dichtervereinigung Di yunge. Den literarischen Verschränkungen von Dovid Hofshteyns Zyklus Troyer mit der russischen Ovid-Rezeption und dem biblischen Buch Hiob geht Jordan Finkin ( Harvard University ) nach. Heather Valencia ( University of Stirling ) beschreibt Avrom Sutzkevers literarische Verarbeitung einer traumatischen Erfahrung im Wilnaer Ghetto von 1941. Jeffrey A. Grossman ( University of Virginia ) diskutiert Heinrich Heines Einfluss auf Moyshe Leyb Halpern im Rahmen der jiddischsprachigen Heine-Rezeption. Harriet Murav ( University of Illinois at Urbana-Champaign ) deckt Verbindungen zwischen Dovid Bergelsons Erzählprosa und Henri Bergsons Zeitbegriff auf. Jan Schwarz ( Universität Lund ) beschreibt Isaac Bashevis Singers Weg der Selbstübersetzung als ein literarisches Erfolgsmodell in den usa der Nachkriegszeit. Ken Frieden ( Syracuse University ) weist in den hebräischen Übersetzungen bzw. Neubearbeitungen der Werke des Klassikers Sholem-Yankev Abramovitsh ( bekannt als Mendele Moykher-Sforim ) den unterschwelligen Einfluss des Jiddischen nach und erweitert unser Wissen um dessen Rolle bei der Entstehung der modernen hebräischen Literatur. Die Bilder der Künstlerin Rahel Szalit-Marcus und die darin ausgedrückte Interpretation der Figuren aus Sholem Aleichems Fortsetzungsroman Motl Peysi dem khazns stehen im Zentrum des Beitrags von Sabine Koller ( Universität Regensburg ). Alyssa Pia Quint ( Columbia University ) charakterisiert die Anfänge des modernen jiddischen Theaters unter Avrom Goldfaden und seinen Konkurrenten als Weg Vorwort 9 zwischen Außenseitertum und Konversion. Nathan Cohen ( Bar-IlanUniversität ) gibt einen Überblick über Kriminalliteratur in jiddischer Übersetzung vor dem Ersten Weltkrieg. Älteres Jiddisch Die Ältere Jiddistik hatte von Beginn an einen festen Platz im Programm des Symposiums und ist im vorliegenden Band sowohl mit literaturwissenschaftlichen als auch philologischen Arbeiten vertreten. Erika Timm ( Universität Trier ) untersucht einen als Gegengeschichte zu Ritualmordlegenden entstandenen Erzähltyp sefardischen Ursprungs, der schon früh auch auf Jiddisch überliefert ist. Wulf-Otto Dreessen ( Universität Stuttgart ) rekonstruiert die Anfänge des Shmuel-bukhs im Umfeld der deutschen Heldenepik. Diana Matut ( Martin-Luther-Universität Halle-Wittenberg ) ediert ein frühneuzeitliches jiddisches Lied, das die Sicht der westlichen auf die östlichen Aschkenasim illustriert. Simon Neuberg ( Universität Trier ) kontrastiert die Sprache der Tsenerene und des Meylits yoysher, der beiden viel gelesenen Werke des Yankev ben Yitskhok Ashkenazi aus dem 17. Jahrhundert. Sprachwissenschaft Die sprachwissenschaftliche Sektion enthält Arbeiten zu diachronischen wie synchronischen Fragestellungen, die stets auch die kulturgeschichtliche Dimension des Sprachgebrauchs fassbar werden lassen. Roland Gruschka ( Hochschule für Jüdische Studien Heidelberg ) untersucht eine Postkarte eines der Gründerväter der Stadt Petach Tikwa aus dem Jahre 1902 und legt deren historische und sprachgeschichtliche Zusammenhänge frei. Ewa Geller ( Universität Warschau ) widmet sich der weitgehend unbekannten Jiddischen Grammatik des Schöpfers der › Universalsprache ‹ Esperanto, Ludwik Zamenhof. Jürg Fleischer und Lea Schäfer ( Philipps-Universität Marburg ) analysieren den Kasusgebrauch nach Präpositionen in westjiddischen Quellen des 19. Jahrhunderts und stellen eine Tendenz zum einheitlichen Objektkasus fest. Alexander Beider ( Paris ) geht der Etymologie und Geschichte ostjiddischer Ortsnamen nach. Moshe Taube ( Hebräische Universität Jerusalem ) beschreibt speziĳische Konstruktionen mit dem Relativpronomen vos, die in Grammatiken bisher nicht verzeichnet wurden. Steffen Krogh ( Universität Aarhus ) sucht nach den dialektalen Wurzeln des heute bei den Satmarer Chassidim gesprochenen Jiddisch. 10 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Kultur und Politik Das Engagement jiddischsprachiger Aktivistinnen und Aktivisten in den verschiedensten Bereichen von Kultur und Politik steht im Mittelpunkt der abschließenden Sektion. Gennady Estraikh ( New York University ) rekonstruiert die paradoxe Situation des aus dem sowjetischen Moskau berichtenden Korrespondenten der nicht-kommunistischen New Yorker Zeitung Forverts, Zalman Wendroff. Rebecca Margolis ( University of Ottawa ) zeichnet die Geschichte des jiddischen Theaters in Montreal während und nach dem Zweiten Weltkrieg nach. Tamar Lewinsky ( Universität Basel ) thematisiert das Verhältnis des amerikanischen Dichters H. Leyvik zu den Shoah-Überlebenden in den deutschen dp-Lagern. Barry Trachtenberg ( University at Albany, suny ) stellt vergleichende Betrachtungen über das Schicksal der beiden jiddischsprachigen Publikationsprojekte yivo-bleter und Di algemeyne entsiklopedye von deren Anfängen im Europa der 1920er Jahre bis hin zu ihrer Einstellung in den usa in der Zeit des Kalten Krieges an. Gegenstand des Beitrags von Rachel Rojanski ( Brown University ) ist die Geschichte der jiddischsprachigen Frauenpresse in Israel. Aya Elyada ( Hebräische Universität Jerusalem ) geht den sich wandelnden Voraussetzungen deutscher Übersetzung aus dem Jiddischen durch die Jahrhunderte nach. Shlomo Berger ( Universität Amsterdam ) kontextualisiert die moderne jiddische Bibelübersetzung des Dichters Yehoyesh vor dem Hintergrund der konkurrierenden kulturellen Ideologien. Aleksandra Geller ( Universität Warschau ) rekonstruiert die Debatte über die Romanisierung und Orthographie des Jiddischen in der Kulturzeitschrift Literarishe bleter. Asya Vaisman ( Hampshire College ) stellt eine Typologie der neuesten jiddischsprachigen Kinderliteratur der Chassidim vor. Die Herausgeber verbinden mit dem vorliegenden Sammelband den Wunsch, durch die neue Reihe zukünftigen jiddistischen Arbeiten eine publizistische Plattform bieten und so zur Weiterentwicklung der Jiddistik als internationaler akademischer Disziplin einen Beitrag leisten zu können. Düsseldorf, Trier, Heidelberg 2012 / 5772 Die Herausgeber Foreword The present collection of articles, titled ‫לקט‬, is being published on the occasion of the 15th Symposium for Yiddish Studies in Germany; the Symposium was established by Erika Timm and Marion Aptroot in 1998 as a forum for work in that ĳield, then a new ĳield in Germany, and in the ĳield’s interdisciplinary contexts. Since that time the Symposium has been organized by both of Germany ’ s Yiddish Studies programs, one at the University of Trier and the other at Heinrich Heine University in Düsseldorf. In the intervening time, Yiddish scholarship in Germany has experienced a signiĳicant upsurge. In diverse institutes, focused variously on Jewish, Germanic, Slavic, anglophone, historical, and cultural studies research, the engagement with Yiddish language and culture has been growing. Since 2010, moreover, the Chair in Jewish Literatures at the College of Jewish Studies in Heidelberg has taken on a newly Yiddishoriented character. The present volume is the beginning of a new series of scholarly studies on Yiddish material, and also of philological and student editions of that material. Yiddish, English, and German are the three languages in which studies will be published, all on an equal footing. Publications in Yiddish Studies have been since their beginnings published not only in Yiddish, but also in the languages of the various majority cultures of those working in the ĳield; in the last decades, however, they have appeared mostly in English, Hebrew, German, French, Polish, and Russian, and hardly at all in Yiddish. This trend has had as its consequence an almost universal tendency to present Yiddish texts in transcription ( except of course in Hebrew publications ). The series introduced by the present volume, on the other hand, offers Yiddish texts in Hebrew letters, even where these texts are being cited in German and English articles; it thereby lays emphasis on presenting Yiddish in its authentic written form. Citations from Eastern European Yiddish texts after 1800 are as a rule presented in yivo orthography. Where necessary, modern eastern European Yiddish is transcribed according to the yivo system, Early Yiddish according to the Trier system; Hebrew is transliterated. ( See the Table in the Appendix.) ‫ לקט‬contains contributions on Yiddish literature, language, and culture, which together highlight the international character and the thematic and methodological variety of present-day Yiddish scholarship. The collection is divided into four areas : 12 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Readings of Modern Yiddish Literature The volume opens with some representative readings of modern Yiddish literature. The contributions gathered here focus on modernist Yiddish poets, both men and women, and also on long-celebrated foundational ĳigures from the period of the “ Yiddish classics , ” on book-illustrators, and on the anonymous readers of Yiddish popular literature. Lawrence Rosenwald ( Wellesley College ) offers a close reading of one of Itzik Manger ’ s Bible-poems, Khave un der eplboym. Efrat Gal-Ed ( Heinrich Heine University, Düsseldorf ) investigates Kadya Molodowsky’s poetics in relation to her engagement with the biblical and rabbinic ĳigure of Shulamit. Barbara E. Mann ( Jewish Theological Seminary ) compares the Yiddish work of Anna Margolin with the Hebrew work of Leah Goldberg with regard to the ĳigure of Mary. Kathryn Hellerstein ( University of Pennsylvania ) analyzes the construction of gender identity in the publications of the New York group of Yiddish poets called Di yunge. Jordan Finkin ( Harvard University ) investigates the links between Dovid Hofshteyn’s poem-cycle Troyer and the Russian reception of Ovid and the biblical book of Job. Heather Valencia ( Stirling University ) describes Avrom Sutzkever’s literary processing of a traumatic experience undergone in the Vilna ghetto in 1941. Jeffrey A. Grossman ( University of Virginia ) discusses Heinrich Heine ’ s influence on Moyshe Leyb Halpern, in the context of the reception of Heine in Yiddish generally. Harriet Murav ( University of Illinois at Champaign-Urbana ) reveals connections between Dovid Bergelson’s narrative prose and Henri Bergson’s concept of time. Jan Schwarz ( Lund University ) describes Isaac Bashevis Singer ’ s mode of self-translation as a model of literary success in the United States after the war. Ken Frieden ( Syracuse University ) demonstrates in the Hebrew translations or adaptations of the works of the classic Yiddish writer Sholem-Yankev Abramovitsh ( known as Mendele Moykher-Sforim ) the subliminal influence of Yiddish, and thereby expands our understanding of Yiddish’s role in the genesis of modern Hebrew literature. Sabine Koller ( University of Regensburg ) focuses her contribution on the illustrations of the artist Rahel Szalit-Marcus and on the interpretation expressed by them of the characters in Sholem Aleichem ’ s serialized novel Motl Peysi dem khazns. Alyssa Pia Quint ( Columbia University ) characterizes the beginning of modern Yiddish theater under Avrom Goldfaden and his rivals as a path between outsider status and conversion. Nathan Cohen ( Bar-Ilan University ) surveys criminal literature in Yiddish translations before World War i. Foreword 13 Early Yiddish Studies of Early Yiddish had a solid place in the Symposium programs from the beginning on, and are represented in the present volume by both literary articles and philological ones. Erika Timm ( Trier University ) investigates a narrative type of Sephardic origin, beginning as a response to legends of ritual murder, and attested in Yiddish at a quite early date. Wulf-Otto Dreessen ( Stuttgart University ) reconstructs the beginnings of the Shmuel-bukh in the context of German heroic epic. Diana Matut ( Martin Luther University, Halle-Wittenberg ) provides an edition of an early modern Yiddish song that illustrates the views of western Ashkenazi Jews concerning eastern ones. Simon Neuberg ( Trier University ) contrasts the language of the Tsene-Rene with that of the Meylits yoysher, the two widely read works of Yankev ben Yitskhok Ashkenazi from the 17th century. Linguistics The linguistics sections includes studies devoted both to diachronic and to synchronic questions, studies that also help us to grasp the cultural and historical dimensions of linguistic usage. Roland Gruschka ( College of Jewish Studies, Heidelberg ) investigates a postcard sent by one of the founders of the city of Petach Tikva in 1902, and uncovers its historical and linguistic contexts. Eva Geller ( Warsaw University ) devotes her study to the largely unknown Yiddish grammar of Ludwig Zamenhof, founder of the “universal language” Esperanto. Jürg Fleischer and Lea Schäfer ( Philipps University, Marburg ) analyze the pattern of case-endings after prepositions in Western Yiddish sources in the 19th century, discerning a tendency towards a uniĳied object case. Alexander Beider ( Paris ) investigates the etymology and history of Eastern Yiddish place names. Moshe Taube ( The Hebrew University of Jerusalem ) describes some particular constructions involving the relative pronoun vos that have not been noted in the extant grammars. Steffen Krogh ( Aarhus University ) traces the dialectal roots of the Yiddish spoken today by the Satmar Hasidim. Culture and Politics At the center of the concluding section is the engagement of Yiddishspeaking activists, both men and women, in broadly diverse areas of 14 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ culture and politics. Gennady Estraikh ( New York University ) reconstructs the paradoxical situation of Zalman Vendroff, reporting from Soviet Moscow for the non-communist New York newspaper Forverts. Rebecca Margolis ( University of Ottawa ) retraces the history of Yiddish theater in Montreal during and after World War ii. Tamar Lewinsky ( University of Basel ) takes as her theme the relationship of the American poet H. Leyvik with the Shoah-survivors in the German displaced-persons camps. Barry Trachtenberg ( University at Albany, suny ) compares the fate of two large Yiddish-language publication projects, yivo-bleter and Di algemeyne entsiklopedye, from their beginnings in Europe in the 20s until their establishment in the United States during the time of the Cold War. Rachel Rojanski ( Brown University ) takes as her subject the history of the Yiddish-language women ’ s press in Israel. Aya Elyada ( The Hebrew University of Jerusalem ) investigates the changing presumptions underlying German translations of Yiddish texts across several centuries. Shlomo Berger ( University of Amsterdam ) contextualizes the poet Yehoyesh’s Yiddish Bible translation within the competing cultural ideologies of its time. Aleksandra Geller ( Warsaw University ) reconstructs the debate over Yiddish romanization and orthography conducted in the cultural review Literarishe bleter. Asya Vaisman ( Hampshire College ) presents a typology of the most recent Hasidic Yiddish-language children’s literature. The editors offer the present collection with the wish that this new series will offer future work in Yiddish Studies a public platform, and thus will contribute to the full development of Yiddish Studies as an international academic discipline. Düsseldorf, Trier, Heidelberg 2012 / 5772 The editors Translated by Lawrence Rosenwald ‫מאדערנער‬ ָ ‫ אין פּרדס ון‬ ‫ליטעראטור‬ ַ ‫ייִ דישער‬ Lesarten moderner Literatur Readings in Modern Literature Lawrence Rosenwald On Itzik Manger ’ s “ Khave un der eplboym ” The following essay is meant both as tribute and as experiment. The tribute offered is to a poem of Itzik Manger ’ s called ‫חוה און דער עפּלבוים‬ ( “ Eve and the Apple Tree ” ) ; it was ĳirst published in Manger ’ s ‫וואלקנס‬ ָ ‫דאך‬ ַ ‫ ( איבערן‬Clouds over the Roof ) in 1942, and in that collection is dated “ London, 1941. ” Manger was forty-one when he wrote the poem, in gloomy exile from Nazi-infested Eastern Europe. The experiment has to do with the mode of analysis : what the American critic Reuben Brower called “ reading in slow motion, ” and what is more often called New Criticism.1 “ Reading in slow motion ” is meant to yield extended, complex accounts of particular literary works and parts of works. The works are at the center, full of meaning, alive, sometimes almost self-contained. The accounts are not for the most part extensively footnoted. They are not rooted in, or at least not bound by, historical or biographical or even literary context ; rather they are derived, in Brower ’ s phrase, from “ words and their arrangement. ” 2 When New Critics are at their best – for example, William Empson in Seven Types of Ambiguity – they are dazzlingly illuminating ; we see the work being described more clearly and more richly than we have ever seen it before. ( For readers schooled in Jewish tradition, reading such critics can feel like reading biblical commentators, from Rashi through Aviva Zornberg ; both the critics and the commentators see signiĳicance in every aspect of the text, refuse to subordinate part to whole, and seek maximum illumination rather than maximum coherence. ) By and large, Yiddish literary critics have not been drawn to New Critical methods, and few Yiddish poems have been the subject of New Critical analyses. Why this is the case is not clear. What is clear is that Manger ’ s poem is just the sort of work New Critics liked to write about : My heartfelt thanks to Efrat Gal-Ed for her learned and generous help with this essay ; it simply could not have been written without her. Thanks also to Richard Fein, for a discriminating reading of an earlier draft. 1 Though I treat them as similar, Brower and some of the more prominent New Critics had their differences. For Brower ’ s position, see Brower 1962 : 7 – 22. For good secondary accounts, see Jancovich 2000 : 200 – 218 and Wood 2000 : 219 – 234. 2 Brower 1962 : vii. 18 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ ironic, witty, mysterious, unobtrusively complex, its form and meaning indissoluble, every word the right word and in the right place. Trying to bring out some of those qualities by New Critical means is, therefore, an experiment worth undertaking. First, however, a crucial bibliographical clariĳication is necessary. In Khone Shmeruk ’ s magisterial 1984 edition of Manger ’ s poems, “ Eve and the Apple Tree ” is the ĳirst of the ‫חומש ־ לידער‬.3 It makes a wonderful beginning. If it were Manger ’ s beginning, we would need to read it as such, deriving our sense of its meaning at least in part from its position. But it is not Manger ’ s beginning. Manger published the Khumeshlider as a separate volume in 1935. The apple tree poem does not appear there. ( In Volkns ibern dakh the poem is simply one poem among many, not ĳirst, not last, not even one of the poems that Manger singles out in the introduction for dedication to various friends and relatives. ) It is legitimate to consider it on its own ; the other Khumesh-lider are relevant as a ĳield of comparison, but not as an organic structure of which the poem is, above all, the beginning. Here is the poem, in Yiddish and in ( my ) strictly lexical English translation : ‫חוה און דער עפּלבוים‬ .‫ארן עפּלבוים‬ ַ ‫חוה שטייט‬ ,‫רגאנג איז רויט‬ ַ ‫זונא‬ ַ ‫דער‬ ,‫זאג‬ ָ ,‫ מוטער חוה‬,‫וואס ווייסטו‬ ָ ? ‫וואס ווייסטו וועגן טויט‬ ָ Eve and the Apple Tree Eve stands before the apple tree, the sunset is red, what do you know, mother Eve, say, what do you know of death ? ‫דאס איז דער עפּלבוים‬ ָ ‫דער טויט‬ .‫צווײגן מיד‬ ַ ‫וואס בייגט די‬ ָ ‫דער ָאוונט ־ ויגל אוין בוים‬ .‫זײן ָאוונטליד‬ ַ ‫וואס זינגט‬ ָ Death, that is the apple tree that wearily bends its branches. The evening-bird on the tree that sings its evening-song. ‫טאג‬ ָ ‫אר‬ ַ ‫ָאדם איז ַאוועק‬ .‫וואלד ַאליין‬ ַ ‫אין ווילדן‬ ‫וואלד איז ווילד‬ ַ ‫ „ דער‬: ‫זאגט‬ ָ ‫ָאדם‬ .“ ‫ ווילד ‘ איז שיין‬, ‫און יעדער‬ Adam has gone before daybreak into the wild wood alone. Adam says, “ the wood is wild and every ‘ wild ’ is beautiful. ” 3 Khumesh-lider are lider, poems or songs, on motifs of the khumesh, the ĳive books of Moses. Manger is not the ĳirst Yiddish poet to write such poems ; he is, however, the ĳirst to devise a name for them. See on this, Gal-Ed 2012 ( forthcoming ). Shmeruk ’ s edition ( Manger 1984 ) begins with Manger ’ s dedication of and prose prologue to the work, written for its publication in 1935. Then comes “ Akeydes Itsik ” ( “ Itsik ’ s Binding ” ), ĳirst published in 1937 ; then Manger ’ s original verse prologue ; then “ Eve and the Apple Tree ” ; and only then the ĳirst poem in the 1935 collection. Lawrence Rosenwald : On Itzik Manger’s “ Khave un der eplboym ” 19 .‫וואלד‬ ַ ‫ארן‬ ַ ‫האט מורא‬ ָ ‫נאר זי‬ ָ .‫זי ציט צום עפּלבוים‬ ,‫און קומט זי נישט צו אים צו גיין‬ .‫קומט ער צו איר אין טרוים‬ .‫ער רוישט און בייגט זיך איבער איר‬ .“ ‫באשערט‬ ַ „ ‫ווארט‬ ָ ‫דאס‬ ָ ‫זי הערט‬ ,“ ‫וואס „ ער “ דער גרויסער „ דער‬ ָ ‫ארגעס‬ ַ .‫ארווערט‬ ַ ‫האט דיר‬ ָ ‫וואס ער‬ ָ ‫רײסט ַאן עפּל ָאפּ‬ ַ ‫און חוה‬ ,‫מאדנע גרינג‬ ָ ‫און ילט זיך‬ ,‫ארליבט ַארום דעם בוים‬ ַ ‫קרײזט‬ ַ ‫זי‬ .‫ווי ַא גרויסער שמעטערלינג‬ ,‫ארווערט‬ ַ ‫האט דעם בוים‬ ָ ‫וואס‬ ָ ,“ ‫און „ ער‬ ,“ ‫ „ס ‘ איז שיין‬: ‫זאגט ַאליין‬ ָ ‫ער‬ ‫נאך אויף ַא רגע אויף‬ ָ ‫האלט‬ ַ ‫און‬ .‫זונארגיין‬ ַ ‫דאס גרויסע‬ ָ But she is afraid of the wood, she prefers the apple tree. And if she doesn ’ t go to him, he comes to her in dream. He rustles and bends over her. She hears the word “bashert.” 4 Forget what “ he, ” the great “ he, ” 5 what he forbade you. And Eve breaks off an apple and feels strangely light, she circles lovingly around the tree, like a great butterfly. And “ he ” who forbade the tree, he himself says, “ it ’ s beautiful, ” and holds the great sunset back for a moment. ,‫נאכט‬ ַ ‫דאס איז דער חלום יעדע‬ ָ ? ‫וואר‬ ָ ‫וואס זשע איז די‬ ָ ‫טא‬ ָ ‫און חוה ילט ווי ס ’ טרערט דער בוים‬ .‫האר‬ ָ ‫ראפּ אין אירע‬ ָ ‫ַא‬ That is the dream every night, but what is the truth ? And Eve feels how the tree weeps down into her hair. ,‫ שיינער עפּלבוים‬,‫„ וויין נישט‬ ‫דו רוישסט און זינגסט אין מיר‬ ,‫ווארט‬ ָ ‫שטארקער ונעם‬ ַ ‫און דו ביסט‬ .“ ‫אר דיר‬ ַ ‫ווארנט מיך‬ ָ ‫וואס‬ ָ “ Don ’ t cry, lovely appletree, you rustle and sing in me and you are stronger than the word that is warning me about you. ” ‫און חוה נעמט דעם עפּלבוים‬ ,‫מיט ביידע הענט ַארום‬ ‫און איבער דער קרוין ון עפּלבוים‬ … ‫ציטערן די שטערן רום‬ And Eve takes hold of the apple tree with both hands around, and over the top of the apple tree tremble the pious stars … 4 Meaning “ fated ” – but one can speak of one ’ s beloved as being “ bashert, ” as we might say, “ you were the only one for me. ” 5 “ Der groyser ‘ der,’ ” the great “ der ” . “ Der ” is the masculine form of the Yiddish deĳinite article. So one might say, “ the great he-guy. ” 20 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ The poem ’ s ĳirst stanza seems almost neutral, clinically descriptive, structurally predictable. Eve stands by the apple tree. No background, no motivation, we begin in medias res. No placement in large-scale time, in relation to the creation ; only a placement in time in relation to the day : the sun is setting. The sunset is red, we learn. Most sunsets are, in life and still more in literature ; is this too a neutral notation ? Or is there perhaps something ominous in the explicit redness of this particular sunset, an ominousness suggested in the Yiddish by the rhyme between royt and toyt, “ red ” and “ death ” ? Someone ( we are not told who ) asks Eve a question, and with that question the inner drama of the poem begins. That is partly because there are no quotation marks surrounding it. Later in the poem there are quotation marks in abundance. They enclose a statement by Adam and a word heard by Eve. They function as scare quotes, ironic enclosing terms referring to God the Forbidder – as we might write, “ Don ’ t believe what ‘ the man ’ tells you. ” They enclose a statement made by God and a speech made by Eve. All of these uses feel familiar. But there are no quotation marks here to set off this ĳirst and crucial utterance, and their absence is signiĳicant.6 Quotation marks externalize ; they establish a distance between the quoter and the words quoted.7 The effect of the absence of the quotation marks here, especially in relation to the abundant and diversely functioning quotation marks later, is to annihilate that distance. The dialogue between Eve and her unmarked interlocutor seems to be taking place inside a single mind. The narrator in the ĳirst line calls Eve by her Yiddish name, Khave. Elsewhere in the Khumesh-lider Adam calls her by her German one, Eva ; he is being characterized as pretentiously genteel. The interlocutor does as the narrator does, but prefaces Khave with the Germanic word muter ( “ mother ” ), preferring it to the Yiddish one, mame. Probably the formal term is chosen to evoke the biblical account of Eve ’ s name : 6 I have not looked at the manuscript, and thus cannot say for sure that the pattern constituted by the presence and absence of quotation marks is Manger ’ s. To me as a reader it seems likely to be, not only because it creates compelling poetic meanings, but also, and more importantly, because it is so unusual. Empson ’ s Seven Types of Ambiguity began as a reflection on punctuation ; Empson ’ s teacher I. A. Richards tells the story as follows : “ At about his third visit he brought up the games of interpretation which Laura Riding and Robert Graves had been playing with the unpunctuated form of ‘ The expense of spirit in a waste of shame. ’ Taking the sonnet as a conjuror takes his hat, he produced an endless swarm of lively rabbits from it and ended by ‘ You could do that with any poetry, couldn ’ t you ? ’ ” ( Haffenden 2005 : 207 ). 7 Meir Sternberg ’ s excellent account of literary quotation ( 1982 ), disappointingly does not include an account of punctuational practices. Lawrence Rosenwald : On Itzik Manger’s “ Khave un der eplboym ” 21 “ And the man called his wife ’ s name Eve ; because she was the mother of all living ” ( ‫) וַ יִּ ְק ָרא ָה ָא ָדם ֵשׁם ִא ְשׁתּוֹ ַחוָּ ה ִכּי ִהוא ] ִהיא [ ֵאם ָכּל ־ ָחי‬.8 Hardly worth commenting on, were it not for the fact that the Khumesh-lider are so seldom read as biblical commentary ; critics have rather laid emphasis on Manger ’ s transplantation of the biblical stories, from their biblical origins to the largely Eastern European settings Manger so vividly suggests.9 Manger himself lays emphasis on this aspect of his work, saying in the prologue to the Khumesh-lider that “ the knowing reader will understand that the landscape in which the biblical ĳigures move is not a Canaanite landscape but rather a Slavic one ; I was thinking of East Galicia. ” 10 Manger and the critics have a point ; the transplantation and its attendant anachronisms are brilliant and provocative – for example, the transformation of the three angels who visit Abraham into three Turks with red beards, or the transplantation of Abraham ’ s trysts with Hagar to the side of a railroad. But the emphasis on transplantation obscures the presence of commentary. This is true of the Khumesh-lider generally, but has special importance for this poem in particular, in which no transplantation has been effected, no traces of Eastern Europe are to be found, there are no anachronisms in sight, and the encounter with the biblical text is front and center. That encounter begins here, with the allusion made by muter. The interlocutor ’ s question to Mother Eve is sudden, tempting, and, in its repetitions, urgent. Eve has been told, as we know from the biblical account, not to eat of the tree, lest she die. She knows what the tree is. But how can she know what death is ? Being made to realize her ignorance by the question, she will ĳind the commandment undercut, made ambiguous. The biblical serpent tempts Eve by putting in doubt the certainty of her death : “ you shall not die, ” he says ( ‫) לֹא ־ מוֹת ְתּ ֻמתוּן‬. Milton ’ s Satan as serpent, tempting Eve, refers in Paradise Lost to “ the pain / of death denounced ( whatever thing death be ) ” ( 9 : 695 ). To ask what “ thing death be ” undermines the commandment that threatens death as punishment. 8 Gen 3 : 20. Richard Fein suggests that an additional effect of muter is to make Eve ’ s motherhood universal rather than tribal ( personal communication ). 9 E.g., Roskies ( 1995 : 258 ) : “ No need to tread lightly across the biblical story : [ Manger ] and his father and mother were the biblical story. No need to reimagine the ancient Near Eastern setting : eastern Galicia was the biblical setting. No need to study Scripture and midrashic commentary because Yiddish language and folk-lore were the sacred texts. ” There is much truth in what Roskies writes, but some of what Manger accomplishes in the present poem is getting lost. 10 Manger 1984 : 3 ( my translation ). 22 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Who, then, is this intimate, tempting interlocutor ? It cannot be the serpent ; there is no serpent in the poem ( nor in any of the Eden poems in the Khumesh-lider ). It cannot be the apple tree, though later in the poem the tree offers his own tempting words to Eve ; in Eve ’ s response to the question the tree is spoken of in the third person. It must be the poet. But the poet is as intimate with Eve as the apple tree will become, and the question as fatally tempting as that which the serpent would have asked. Poet as serpent, poet as tree. We note in this ĳirst stanza, not for the last time in the poem, the counterpoint between simplicity of structure and complexity of person. Two lines set the scene, two lines ask a question. The ĳirst two lines are neatly bifurcated : Eve and the apple tree in the ĳirst, the red sunset in the second. The second two are also : the ĳirst begins the question, the second ĳinishes it. All familiar symmetries, against which emerges the unnamed, unquoted, speaking, tempting questioner. The second stanza offers us what we presume is Eve ’ s answer. This too is printed without quotation marks, part of the dialogue more inward than dialogue. She answers as best she can ; she has no experience of death, and says what she “ knows ” of it by means of two images, one of weariness, one of evening. No Romantic poet could have chosen better, but in the context the answer is ominously casual. Death as she understands it is the law of gravity acting on the tree, the law of nature leading the evening bird to sing his evening song, the regular recurrence of sunset and sunrise. The ending of life is a long way from being envisionable, the threat of death a long way from being efĳicacious.11 Like the ĳirst stanza, the third has two lines of narrative followed by two lines of discourse – this time, for the ĳirst time, discourse in quotation marks. The similarity of structure between the two stanzas invites a comparison of meaning. Eve in the ĳirst stanza is associated with the apple tree and sunset and evening, and in the second stanza becomes a commentator on both. Adam in the third stanza is an early riser, associated with morning and the wood, the “ wild ” wood as the narrator says, and Adam echoes the narrator.12 In fact, he goes further than the 11 There is just a hint of autumn in Eve ’ s speech, in that one possible reason for the branch to be wearily bending down is its being weighed down by the ripe apples hanging from it. An admittedly speculative reading, but it reminds us of other poets – John Keats in “ To Autumn, ” Robert Frost in “ Come In !, ” more proximately Rainer Maria von Rilke in Herbsttag, which Manger knew – whose images of autumn, and for that matter of the evening songs of birds, connote death. Autumn was Manger ’ s best-loved poetic season, and his images of it are often ominous. See, on all of this, Gal-Ed 2011. 12 The vald ( “ the wood ” ), sounds in Yiddish similar to the vild ( “ the wild ” ). Lawrence Rosenwald : On Itzik Manger’s “ Khave un der eplboym ” 23 narrator ; he is the explicit advocate and theorist of wildness, claiming an association between wildness and beauty.13 What are we to make of Adam ’ s views ? In the non-Jewish literature of the west, associating wildness and beauty is commonplace. “ I am the lover of uncontained and immortal beauty, ” writes Ralph Waldo Emerson in Nature ; and still more boldly, “ in the wilderness, I ĳind something more dear and connate than in streets or villages. ” In Jewish traditions, such associations are less common ; we remember Sholem Aleichem ’ s Tevye being almost traumatized when temporarily lost in the woods, and imagine him puzzled or repelled by Emerson ’ s claims. More speciĳically pertinent here is that the biblical passage Manger is drawing on locates beauty elsewhere than in the wild, locates it in fact just where Eve locates it, in the apple tree. We read in Gen 2 : 9 that the tree is “ ‫ “ ( „ ֶנ ְח ָמד ְל ַמ ְר ֶאה‬pleasant to the sight ” ), and in Gen 3 : 6 ( just before Eve tastes the apple ) that it is “ ‫ [ ָל ֵע ַיניִ ם‬. . . ] ‫ “ ( „ ַת ֲאוָ ה‬a delight to the eyes ” ). These are the only instances of the relevant Hebrew words in the scene. Whatever beauty there is in the Garden is located by the text in the tree, and Adam ’ s aesthetic preference for the woods makes him an outlier both geographically and textually. ( A daring outlier, perhaps worth investigating, but Manger chooses not to investigate ; this is Adam ’ s last appearance in the poem. ) Eve ’ s aesthetic preference is more in accord with the biblical diction and scheme of values. Whatever sins she may commit later, she begins as what we might call an obedient reader of the biblical text. Manger as poet was no systematic feminist ; he did not, as modern feminists do, seek out the Bible ’ s marginalized women characters, Dinah or Tamar or Potiphar ’ s wife ; he wrote no poems that help us to imagine Sarah ’ s anguish or rage at the Binding of the Isaac, and the last poem of the Khumesh-lider is all about men, Jacob and his sons rehearsing the purimshpil. But he was too good a poet not to explore women ’ s sensibilities when the biblical stories offered an evident opportunity, from Eve to Esther and Ruth, and too sharp-minded a satirist not to direct his satire even against the Patriarchs and Adam Firstman. The sympathy and the satire often work together to put him on the women ’ s side, as they do here. At this point – surprisingly, breathtakingly even, in mid-stanza – the nature of the story changes : “ And if she does not go to him [ the 13 The Yiddish phrase, yeder “ vild, ” is difĳicult. “ Vild ” is apparently a nominalized adjective or a rare noun, and its effect is as odd, and as fruitfully ambiguous, as “ every ‘ wild ’ ” in English. ( The Yiddish poet Malke Heifetz Tussman published a collection of poems called Mild mayn vild [ “ Mild My Wild ” ].) 24 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ apple tree, boym, being a masculine noun in Yiddish ], he comes to her in dream. ” The apple tree becomes a character, gendered, capable of movement and speech. The narrative moves from the real world to the world of dreams, the world of the Dreamlord who, as Sholem Aleichem writes, “ does not hold back on colors, freely dispensing fantasies never seen on land or sea. ” 14 The narrative stays in that world until stanza eight, where a summarizing gesture is made to indicate that the dream is over. What happens during the stanzas in between ? New Critics love to explore the difference between what readers think they know and the knowledge that poems actually provide ; one name for that difference is “ ambiguity, ” a crucial New Critical term of praise, and there is a signiĳicant ambiguity to be dealt with here, just as the dream begins. We think we know that this is Eve ’ s dream. Whose else could it be ? But the poem does not assign the dream to a dreamer – kumt er tsu ir in troym ( “ he comes to her in dream ” ) is all it says. More than the absence of a possessive pronoun authorizes the reader ’ s uncertainty. The apple tree has a gender and a capacity for motion ; in the dream he has a capacity for speech ; after the dream is over he weeps and is addressed in the second person, and as a second person, by Eve. He has the capacities that being the dreamer would require. The two lines introducing the dream are perfectly symmetrical, suggesting that Eve and the tree are ontologically alike rather than different. If she does not go to him, he comes to her : two beings, two pronouns, two verbs of motion. Common sense tells us that Eve is the dreamer. Common sense is probably correct. The goal in raising the question, in denying or at least delaying the obvious answer, is not to win the apple tree ’ s case ; it is to tease out the ambiguities lurking in the apparently clear narrative structure. The uneasy, half-imperceptible uncertainty described earlier, about who is making the opening speech, the absence from that speech of boundary-establishing quotation marks, are reinforced here by Manger ’ s choice not to name the dreamer. In someone ’ s dream, the apple tree comes to Eve ; that is all we know. The observed details of the dreamscape are more precise. The tree is in motion, and its motion is audible. The word chosen to describe that motion echoes Eve ’ s earlier characterization of the tree, in particular her use of the verb beygt ( “ bends ” ). But earlier that word suggests passivity, an inanimate object ’ s obedience to the law of gravity. Here it suggests activity, as if in the dream the tree had become one of Tolkien ’ s Ents. Moreover, the tree can now speak – which capacity, in 14 Sholem Aleichem 1924 : 130 ( my translation ). Lawrence Rosenwald : On Itzik Manger’s “ Khave un der eplboym ” 25 a poem, is as fundamental an ability as can be. ( Even that, if we seek to hold ourselves strictly to the facts of the poem, is going too far. Eve hears the word bashert – in quotation marks, separate. We presume the apple tree is the speaker. But Manger does not say so. ) Whoever its speaker may be, the word is doubly evocative. Bashert as “ fated ” belongs here, in this story that moves inexorably towards its fated, biblically established ending. But so does bashert as “ beloved, ” the second sense making explicit the implicit erotic charge of the scene : the abandoned wife beneath the attentive, sinuous, swaying tree, attending her in dreams as she attends him when awake. Again, in this ĳirst stanza of the dream two lines of narrative are followed by two lines of utterance : He rustles and bends over her. She hears the word “ bashert. ” Forget what “ he, ” the great “ he, ” what he forbade you. Again, the lines of utterance are printed without quotation marks ; again, the effect is one of intimacy, as if the tree were inside Eve ’ s mind, or Eve in the tree ’ s ; in neither case is there need of speech to communicate. The tree ’ s commandment – if it is indeed the tree ’ s commandment – is to “ forget ” the divine prohibition ; a disturbing message in a culture so focused on remembering ! “ You remember all the forgotten things, ” says the ‫ונתנה תוקף‬, paying tribute to the majesty of God. Disturbing, in particular, because the thing to be forgotten is a divine prohibition stated in the biblical text. In the poem, however, all we know of the Forbidder is his gender. He is not qualiĳied as “ divine ” or named as “ God. ” He is a creature made of pronouns and deĳinite articles, all of them masculine.15 His masculinity is excessive. Manger foregrounds an aspect of the biblical story that feminists would call attention to : that a male has imposed a prohibition on a female. But he sets that insight in a conventional context ; given the tree ’ s already established grammatical and erotic masculinity, the lines in question evoke classic seduction scenes, the sort in which a male lover encourages a female beloved to ignore a husband ’ s or father ’ s commands. 15 Martin Buber and Franz Rosenzweig chose to translate the Tetragrammaton with the pronouns er, ihn, ihm, and sein, all in small capital letters reserved for this purpose, which when read have something of the effect of Manger ’ s language here, though without his irony. For Rosenzweig ’ s justiĳication of the practice, see his “ A Letter to Martin Goldner ” in Buber and Rosenzweig 1994. 26 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ The dream concludes with the poem ’ s strangest image, nearly grotesque. Eve breaks off an apple. She “ feels strangely light. ” She is in love, we know this, and in her love circles around the tree, in an erotic dance with her lover. But why like a butterfly ? That the comparison should be with a flying creature is plausible. Whether flying in dreams is really a symbol of sexual intercourse or not, it was so understood in 1941 by anyone who had read Freud or been influenced by him, and Manger was certainly one of those.16 That it should be with a butterfly is at ĳirst more enigmatic. But butterflies turn up elsewhere in the Khumesh-lider and are consistently associated with sexuality. A butterfly flutters around the lamp of Lot ’ s daughters as they prepare to seduce him. Isaac sees a butterfly on a flower, sees it fly away, imagines it as a husband deserting his wife. The image of Eve as a butterfly is more daring than these passages, but generally in accord with them. The deeper enigma here is a perspectival one. Eve circles around the tree “ like a great butterfly. ” Who is making the comparison ? The perspective has shifted ; we are not watching the events of the dream, but having them made the subject of similes. In her dream, Eve breaks off an apple, feels strangely light, circles in love around the tree. But she is not creating the simile ; the creator of that exemplary poetic ĳigure must be the elusive poet, making an unannounced entrance here, as at the beginning. The dream concludes on what seems at ĳirst a happy note. The unnamed male who has forbidden Eve to eat of the tree says in the dream that “ it is beautiful ” – “ it, ” not “ he ” or “ she, ” not Eve or the apple tree, rather the scene as a whole. The sunset itself delays its movement for a moment, presumably to gild the scene with its light as long as possible. Idyllic ; but here, as before, troubling, in the always present if often latent biblical context. Previously beauty is a focus of unease in the poem because Adam mislocates it, seeks it where it is not. Here the unease is more general and theological. The biblical God expresses positive judgments in moral terms : “ and God saw that it was good. ” Beauty is occasionally noted in the biblical text, but has no power, no exculpatory force. When God makes the sun stand still for Joshua, God ’ s goal is not the preservation of beauty, but the successful pursuit of war. Beauty at this point in Manger ’ s poem is not being mislocated by a creature ; it is being misapplied by the Creator, as if the whole moral framework of the biblical passage were being distorted. 16 Gal-Ed ( personal communication ). Lawrence Rosenwald : On Itzik Manger’s “ Khave un der eplboym ” 27 But of course all this is taking place in the dream, not in the Garden of Eden, and now the dream seems to end, an ending marked by its being named here as at its beginning : “ That is the dream every night. ” A marker of order, like a punctuation mark. But it is followed by a puzzling question : “ so what ’ s the truth ? ” Nothing provokes this unnecessary and therefore signiĳicant question. Sometimes, we may well think, Eve goes to the apple tree when awake ; sometimes she dreams of the apple tree when asleep, or the apple tree dreams of her. Nothing in that schematic account would motivate a question ; we would move from the account of the dream to an account of whatever the next event might be in the world. “ That is the dream, every night. / But when the morning comes … ” Manger might write. But the question is asked, suggesting that the schematic account is insufĳicient, that there is trouble at the borders. That suggestion is strengthened by the narrated action that follows : “ and Eve feels how the tree weeps / down into her hair. ” “ Weeps ” may refer metaphorically to the dripping of gathered moisture down from the tree at dawn or dusk, but that is not all it is doing ; it also suggests that the tree is here again animate, even outside the dream, and weeps as a lover might weep in a romantic poem. That ambiguity supports another ambiguity, the one previously proposed by the question, namely, that between the dream and the truth ; if the tree is weeping in the Garden, then dream and truth are intermingling. “ So what ’ s the truth ? ” is an all too reasonable question. Whether in dream or in truth Eve responds, this time in quotation marks. The marks suggest a greater distance and formality of speech ; Eve is becoming oratorical. She tells the tree – the “ beautiful ” tree, since Eve, like the Forbidder and like Adam, is all too occupied with beauty – not to weep. She at least does not consider the tree ’ s weeping only a metaphor for a natural process ; she reads it psychologically, implying that the tree is weeping at the sad thought that the Forbidder ’ s commandment will separate him from Eve. For this thought she has a remedy, namely an assurance to the sounding, singing tree : “ you are stronger than the word / that warns me against you. ” Not stronger than the Forbidder, than the big He ; stronger than the word. In a Christian context, “ the word ” would be “ the Word ” spoken of in the Gospel of John, “ in the beginning was the Word. ” Not here, probably, even given Manger ’ s interest in the ĳigure of Christ, since his interest in that ĳigure was not a theological one.17 But in any poem, whatever its religious context, to be stronger than “ the word ” is to be very strong indeed – 17 See, yet again, Gal-Ed ( 2010, 2011 ). 28 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ the poem itself being strong precisely in virtue of the strength of the words it brings together. The tree, the almost non-verbal tree ( its one utterance, “ bashert, ” is identiĳied only as heard, not as spoken ), with its musical, sonorous power, is stronger than the word of warning.18 In the ĳinal stanza we seem to be once more in the world of lucid narrative. Eve takes hold of the apple tree with both hands, takes hold of it arum ( “ around ” ). But the word evokes her circling of the tree in the dream, arum dem boym ; here too, it turns out, the dream and the truth are in accord. With that, the earthly action ends ; Eve does not in this apparently real world pluck an individual apple, still less eat one, still less tempt Adam to eat one ; her embracing of the apple tree is as far as Manger will allow the narrative to proceed, as if he, like the Forbidder, wanted to hold off the world-historical sunset for a moment more, the ĳinal moment of the poem being the moment before the commission of the world-transforming sin. He also shifts his gaze away from the scene where the sin will take place ; the poem ends not where it has been situated for most of its length, with Eve and the apple tree in the Garden, but above : “ above the crown of the apple tree / the stars are trembling piously. ” These are not the only admonitory stars in the Khumesh-lider ; in Manger ’ s poem about the Binding of Isaac, a “ pious blue star ” shines overhead. Whatever Manger ’ s habits of imagery, though, the scene is easy enough to read. Eve is about to transgress, to behave in a way the very opposite of frum, and what else would frume shtern do but tremble ? But tremble is all they can do ; no God intervenes or witnesses, and the drama ends with the remote scintillations of the stars, scintillations made still more remote and ineffectual by the indecisiveness of the ellipsis with which the poem ends. One negative goal of New Criticism is to avoid the imposition of synthesizing interpretations when such interpretations risk, as they often do, excluding from consideration important aspects of a work, or forcing those aspects into a false congruence with other aspects of it. In a sense, therefore, a New Critical explication should have no conclusion of the usual sort. The conclusion offered here is therefore of a different and humbler sort, a simple assessment and classiĳication of the observations made in the body of the essay. Some of these bear on vivid, precise aspects of Manger ’ s account of the biblical story. They note the foregrounding of death, beauty, gender, sexuality, domesticity, Eve, the tree ; they note the backgrounding ( sometimes the deleting ) of Adam, morality, sin, wildness, piety, the serpent, God, the divine. These obser18 The Yiddish vort ( “ word ” ) and vornt ( “ warns ” ) are similar in sound, as if to suggest that warning is what words do, not contingently but intrinsically. Lawrence Rosenwald : On Itzik Manger’s “ Khave un der eplboym ” 29 vations are relatively straightforward, and just such as one might expect to offer about a poem juxtaposing traditional Jewish material to a modern poetic sensibility ; such observations would sufĳice to describe other modernist rewritings of biblical stories, even such adroit and challenging ones as Kafka ’ s “ The City Coat of Arms ” or Rilke ’ s “ Esther. ” Less straightforward are observations about what one might call voice and person : who is speaking and when, where the poet can be found or is hiding, what distinctions and fusions there are between one character and another, between serpent and Eve and poet and tree and Forbidder, between one world and another, between dream and truth, even sometimes between one word and another, vild and vald or vornt and vort. The blurring of boundaries produces a quite different effect from that brought about by the poem ’ s lucid if challenging precision : vision and mystery come together beautifully. The poem is sometimes sharply in focus and sometimes obscure, sometimes brilliantly legible and sometimes suggestively indecipherable. The counterpoint between these two aspects of the poem is its profoundest excellence.19 Manger in 1941 was very much alone ; he had no public and no literary ĳield in which to operate, and the Nazis were destroying his people and his linguistic and cultural community. In a few years, after the 1948 publication of ‫מאנגער זינגט‬ ַ ‫שנײדער ־ געזעלן נטע‬ ַ ‫דער‬, and with the destruction of his people and community tragically complete, he would largely stop writing poetry. But in his 1941 state of exile, perhaps in response to that state of exile, he wrote this wonderfully haunting and troubling poem. Bibliography Brower, Reuben, 1962 : “ Reading in Slow Motion. ” In : Reuben Brower and Richard Poirier, eds., In Defense of Reading. New York : Dutton, 7 – 22. Buber, Martin and Rosenzweig, Franz, 1994 : “ Letter to Martin Goldner. ” In : Lawrence Rosenwald, trans. ( with Everett Fox ), Scripture and Translation. Bloomington : University of Indiana Press, 189 – 192. Gal-Ed, Efrat, 2010 : “ Between Jesus and the Besht. ” In : European Journal of Jewish Studies 4 ( 1 ) : 115 – 136. – 2011 : “ The Local and the European : Itzik Manger and his Autumn Landscape. ” In : Prooftexts 31 ( 1 – 2 ) : 31 – 59. 19 The effect is oddly similar to that of the poem ’ s great and monumental counterpart, Thomas Mann ’ s Joseph and His Brothers, the ĳinal volume of which appeared in 1943 – Mann was working on it in 1941 – and which, on a far grander scale, balances these same two essential literary qualities of clarity and mystery. 30 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ – 2012 : “ Itzik Manger and his Purimshpil. ” Forthcoming in : Zutot. Haffenden, John, 2005 : William Empson : Among the Mandarins. Oxford : Oxford University Press. Jankovich, Mark, 2000 : “ The Southern New Critics. ” In : A. Walton Litz, Louis Menand, and Lawrence Rainey, eds., The Cambridge History of Literary Criticism 7 : Modernism and the New Criticism. Cambridge : Cambridge University Press, 200 – 218. Manger, Itzik, 1942 : Volkns ibern dakh. London : Aleynenyu. – 1984 : Medresh Itsik, ed. Khone Shmeruk. Jerusalem : The Magnes Press. Roskies, David, 1995 : A Bridge of Longing : The Lost Art of Yiddish Storytelling. Cambridge, ma : Harvard University Press. Sholem Aleichem, 1924 : “ Dos porfolk. ” In : Ale verk fun Sholem Aleykhem, vol. 8. New York : Folksfond, 127 – 153. Sternberg, Meir, 1982 : “ Proteus in Quotation-Land : Mimesis and the Forms of Reported Discourse. ” In : Poetics Today 3 ( 2 ) : 107 – 156. Wood, Michael, 2000 : “ William Empson. ” In : A. Walton Litz, Louis Menand, and Lawrence Rainey, eds., The Cambridge History of Literary Criticism 7 : Modernism and the New Criticism. Cambridge : Cambridge University Press, 219 – 234. Efrat Gal-Ed Spur und Differenz Zu Kadya Molodowskys Sulamith-Gedichten Biblische Stoffe und Motive werden häuĳig in mehreren Texten gestaltet : im kanonischen und identitätsstiftenden Prätext und zugleich in einzelnen oder mehreren paraphrasierenden, kommentierenden und dabei erweiternden Erzählungen.1 Eine derart gewachsene Stoffgestalt verkörpert die Vielfalt der narrativen Vorlagen und bildet einen vielstimmigen Erzählkomplex. Welche narrative und psychologische Kraft geht von dieser Polytextualität aus ? 2 Was fasziniert moderne jiddische Dichter an biblischen Motiven und Stoffen – hat deren Polytextualität ein größeres › kulturelles Kapital ‹ ? Liegt in der polyphonen Erzähltradition, ihrem stilistischen und strukturellen Repertoire und ihren dialogisch angelegten Textverfahren der Reiz zu weiteren auch in anderen Genres wirksamen Aneignungen ? 3 Die › sprachbildende Kraft ‹ biblischer und rabbinischer Traditionen ist in der Poesie jiddischer Dichter, die sich als Teil einer modernen jiddisch weltlichen Kultur verstanden haben, mehrfach überliefert : Am bekanntesten sind wohl Itzik Mangers ( 1901 – 1969 ) 1935 in Warschau erschienene ‫ ( חומש ־ לידער‬Fünfbuch-Lieder ). Mit dem Begriff ‫חומש ־ ליד‬ schuf er aus seiner Werkgruppe ein neues Genre – das Bibelgedicht, in dem die Anwesenheit des biblischen Texts, bereits inhaltlich transponiert, greifbar bleibt.4 Bibelgedichte schrieben auch viele andere Für anregende Gespräche während der Arbeit an diesem Artikel, für Hinweise und Kritik danke ich Marion Aptroot, Ben Zion Fischler, Annelen Kranefuss, Tamara Ralis, Lawrence Rosenwald, Erika Timm, Akiñcano M. Weber und Gisela Wilkending. 1 Zum Begriff des oben angesprochenen aggadischen Midrasch s. Heinemann 1974 : 7 – 15 ; Frenkel 1991 : 320 ; Frenkel 1996 ( i ) : 20 – 25, 33 ; Maier 2001 : 60, 287 – 289 und Levinson 2005 : 6 – 11. 2 Als polytextuell bezeichne ich literarische Stoffe, deren Gestalt multiple textuelle Zugehörigkeit aufweist und im kollektiven Gedächtnis als Gewebe ungleicher narrativer Fäden erscheint. 3 Zum intertextuellen Lesen des Midrasch s. Boyarin 1994 ( passim ) und Levinson 2005 : 60 –101, zur strukturellen und narratologischen Analyse des literarischen Verfahrens s. Levinson 2005 : 102 – 149, 150 – 191, zum dialogischen Lesen des Midrasch s. ibid.: 192 – 238. 4 Manger setzt damit eine lange Tradition von Dichtung fort, die auf biblische Motive zurückgreift, doch erst unter seinem prägenden Titel » Bibelgedicht « wird aus diesem Verfahren eine eigenständige literarische Gattung. Zu Mangers literarischem Verfahren s. Gal-Ed 32 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ jiddische Dichter, unter ihnen Yehoash ( 1870 – 1927 ),5 Avrom Liessin ( 1872 – 1938 ),6 H. Leivick ( 1888 – 1962 ),7 Yankev Glatstein ( 1896 – 1971 ),8 Kadya Molodowsky ( 1894 – 1975 ) und Rokhl Korn ( 1898 – 1982 ).9 Zu den frühen Konzepten der modernen jiddischen Literatur gehört die 1908 von Yitskhok Leybush Peretz auf der Czernowitzer Sprachkonferenz verkündete Forderung, auf das Repositorium jüdischer Traditionen – religiöser und volkstümlicher – als Quelle der entstehenden jiddischen Literatur zurückzugreifen.10 Die Aufwertung, die das Speziĳisch-Jiddische gegenüber den vorherrschenden Kulturen durch dieses Konzept erfuhr, stellte die Weichen für das Selbstverständnis jiddischer Moderne als Verschränkung gleichwertiger Komponenten : des Jiddisch-Partikularen und der Ideen und Modelle der europäischen Moderne.11 In diesem Kontext brachte der Rückgriff auf biblische Motive und Stoffe das Partikulare und das Universelle gleichermaßen zum Aus2012, zur Rezeption dieser Werkgruppe s. Sadan 1984 und das Unterkapitel » Fünfbuch-Lieder « in : Gal-Ed, Niemandssprache ( in Vorbereitung ). 5 1910 veröffentlichte Yehoash unter dem Titel ‫ ( ון ביבל און תּלמוד‬Aus Bibel und Talmud ) 19 Gedichte ( ‫געזאמלטע לידער‬ ַ [ Gesammelte Gedichte ], New York : Verlag Oyfgang ) und im 1. Band seiner ebenfalls 1910 erschienenen ‫נײע שריטן‬ ַ ( Neue Schriften ) ( New York : Verlag Yehoyesh ) 8 Gedichte unter dem Titel ‫ ( ון ַאלטן ברונעם‬Aus dem alten Brunnen ). Weitere Gedichte dieser Art ĳinden sich auch in anderen Gedichtgruppen. 6 1938 veröffentlichte Liessin in New York seine dreibändige Ausgabe ‫פּאעמען‬ ָ ‫לידער און‬ ( Gedichte und Poeme ). Darin ĳindet sich eine Vielzahl von Bibelgedichten, in denen er mit biblischen Motiven und Stoffen unterschiedlich verfährt : beispielsweise die Gedichtzyklen ‫ ( אליהו‬Elia ) (Bd. i : 178 – 187 ), ‫ ( איבער די תּהומות‬Über den Abgründen ) ( Bd. iii : 189 – 210 ) und ‫געשטאלטן‬ ַ ‫ ( ביבלישע‬Biblische Gestalten ) ( Bd. iii : 213 – 232 ) sowie zahlreiche in unterschiedlichen Zyklen zerstreute Gedichte wie ‫טאל צלמות‬ ָ ‫ ( אין‬Im Tal des Todesschattens ), ‫איו" אין די‬ ‫ ( קעטסקילס‬Job in den Catskills ) oder ‫ ( סדום‬Sodom ) ( Bd. ii : 155 f, 217 – 219, 304 f ). 7 Zum Beispiel ‫ ( קין און ה"ל‬Kain und Abel ), ‫ ( ממעמקים‬Aus den Tiefen ), ‫פּאסטעך שאול‬ ַ ( Der Hirte Saul ), ‫ ( יוסף און די ברידער‬Joseph und die Brüder ) in : ‫ ( ַאלע ווערק‬Alle Werke ), Bd. i, New York 1940 : 472, 550, 558, 581 ; ‫ ( עקדה‬Fesselung [ Isaaks ] ) in : ‫ ( אין טרעבלינקע בין איך ניט געווען‬In Treblinka war ich nicht ), New York 1945 : 6 – 8 und ‫ ( עקדה‬Fesselung [ Isaaks ] ) in : ‫בלאט אויף‬ ַ ‫ַא‬ ‫ ( ַאן עפּלבוים‬Ein Blatt auf einem Apfelbaum ), Buenos Aires 1955 : 98. 8 Zum Beispiel ‫ ( א"ישג‬Abisag ) in : ‫רײע ערזן‬ ַ ( Freie Verse ), New York 1926 : 50 sowie ‫ ( שמשון‬Samson ), ‫ ( עשׂו‬Esau ), ‫ ( דער נ"יא יחזקאל‬Der Prophet Ezekiel ) in : ‫שאטן‬ ָ ‫טאטנס‬ ַ ‫דעם‬ ( Vaters Schatten ) New York 1953 : 59, 118 f, 145 – 149. 9 Zum Beispiel ‫ ( רחל‬Rachel ) in : ‫היימלאזיקייט‬ ָ ‫ ( היים און‬Heim und Obdachlosigkeit ) Buenos Aires 1948 : 217 f ; ‫ ( חוה‬Eva ), ‫ ( רחל‬Rachel ), ‫טאכטער‬ ָ ‫ ( שאולס‬Sauls Tochter ) in : ‫באשערטקייט‬ ַ ( Vorherbestimmung ), Montreal 1949 : 99, 100 f, 102 – 104 ; "‫ ( איו‬Job ) und ‫בײ שלמה המלכס‬ ַ ַ ‫ ( ון יענער‬Von der anderen Seite ‫ ( קופּער ־ מינעס‬In König Salomos Kupfer-Mienen ) in : ‫זײט ליד‬ des Lieds ), Tel Aviv 1962 : 67 – 70, 120 f. 10 S. yivo 1931 : 76 f, vgl. Fishman 2005 : 102, Moss 2001 : 154 – 157. 11 In jiddischen Manifesten und manifestartigen Texten trifft man auf heterogene, teils konfligierende Vorstellungen einer jiddischen Moderne ( vgl. u. a. Bergelson 2007 [ 1919 ], [ Grinberg ] 1922, Ravitch 1922 und Manger 1929 ). Gemeinsam ist die Suche nach einer den neuen Bedürfnissen adäquaten poetischen Sprache, auffallend die Verortung des » obdachlos «, » fremdländisch « umherirrenden Dichters in einer diasporischen jiddischen » Exterritorialität « ( Grinberg ) und die proklamierte Intention, moderne jiddische Literatur, Theater und Kunst » an ihrer Zugehörigkeit zur Welt « zu messen ( Manger ). Efrat Gal-Ed : Spur und Differenz 33 druck, war doch der biblische Prätext für die jiddisch kulturelle Identität prägend und transkulturelles Gut zugleich.12 Überdies entsprach der freie künstlerische Umgang mit dem biblischen Material und seine Transposition in einen säkularen Sprachraum der Vision einer › jiddisch weltlichen Kultur ‹,13 deren Leserschaft mit der biblischen Tradition in ihrer polytextuellen Gestalt noch vertraut war.14 Mit der biblischen Welt war auch Kadya Molodowsky seit ihrer Kindheit im weißrussichen Shtetl Bereza Kartuska vertraut.15 Als Tochter eines melamed hatte sie das Privileg, am Unterricht im ausschließlich für Knaben vorgesehenen kheyder teilzunehmen. Dort las sie die Bibel auf Hebräisch und lernte Talmud. Ihre Großmutter brachte ihr Jiddischlesen bei. Auf diese Weise wurde sie vom biblischen Text sowohl in der Vater- als auch in der Muttersprache geprägt und mit seiner geläuĳigen polytextuellen Vermittlung bekannt. Darüber hinaus ließ ihr Vater sie privat in Russisch, Geschichte, Geographie und Philosophie unterrichten. 18-jährig absolvierte sie das Lehrerseminar und ließ sich 1913–1914 bei Yekhiel Halperin in Warschau als Lehrerin für Hebräisch weiterbilden. 1917 kam sie in Kiev mit der modernistischen Gruppe um Dovid Bergelson zusammen, der 1920 ihre ersten Gedichte in ‫ ( אייגנס‬Eigenes ) publizierte. 1921 heiratete sie Simkhe Lev. Das Paar zog nach Warschau, wo Kadya Molodowsky als Hebräischlehrerin arbeitete und Anschluss an den Kreis der jiddischen Modernisten fand. Zu ihren Freunden zählten die Begründer der Dichtergruppe ‫ליאסטרע‬ ַ ‫כא‬ ַ ( Bande ) Yisroel Yehoyshue Singer und Melekh Ravitch sowie der Herausgeber der ‫ליטערארישע‬ ַ ‫ ( בלעטער‬Literarische Blätter ), Nakhmen Mayzel. In diesem von Männern geprägten literarischen Feld ist sie in den 1920ern eine außergewöhnliche Erscheinung. Sie ist im jiddischen Schriftstellerverband aktiv, engagiert sich in kulturpolitischen Debat12 Dabei führten Schaffensprozesse weder unbedingt noch gradlinig zur poetischen Gestaltung biblischen Materials. Wie ich an anderer Stelle zeige, fand Itzik Manger erst 1927 zu seinem Bibelgedicht, nach langjähriger poetischer Umkreisung der Jesus-Gestalt und aufgrund intensiver Beschäftigung mit R. M. Rilke. In Mangers transversalem Schaffensprozess zeigten Gedichte wie Rilkes » Abisag «, » David singt vor Saul «, » Klage um Jonatan «, » Tröstung des Elia « und » Absaloms Abfall «, dass sich aus biblischen Stoffen moderne Gedichte machen lassen ( s. Gal-Ed 2010 und 2011 ). Zu seiner Bezeichnung ‫ חומש ־ ליד‬fand Manger erst in den 1930er Jahren. Zur Rolle der Aneignung der Jesus-Gestalt in der jiddischen Moderne s. Hoffman 2007 ( passim ). 13 Zum jüdischen Selbstverständnis säkularer Jiddischisten s. Fishman 2005 : 98 – 113. 14 Alfred Döblin zitierend spricht Albrecht Schöne vom » Zwangscharakter « und von der » Produktivkraft « der biblischen Sprache, welche » die Möglichkeit ihrer Einwirkung auf den poetischen Text « begründen, » auf ihnen beruht die sprach-bildende Kraft der Säkularisation « ( Schöne 1968 [ 1958 ] : 34 ). 15 Zur Biographie Molodowskys s. Ravitch 1945, Hellerstein 1999, Braun 2007 und die angeführte Literatur. 34 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ten, wird geschätzt und bekämpft.16 Noch bevor ihr erster Gedichtband 1927 erscheint, ist sie mit Gedichten und Essays auf den angesehenen jiddisch literarischen Bühnen präsent.17 Ihre intellektuellen Fähigkeiten scheinen ihre männlichen Kollegen zu verblüffen : ‫כאטש מיר ווייסן‬ ָ ‫ און‬,‫קאדיע איז ַא געבילדעטע‬ ַ ,‫נײ‬ ַ ’ ‫מאל אויף ס‬ ָ ‫איבערראשט עס אונדז ַאלע‬ ַ ,‫עס‬ ‫ און נישט ווייניקער‬,‫ַא סך ַאלגעמיינע בילדונג‬ ‫רצײטישע‬ ַ ‫א‬ ַ ‫ייִ דישע און לשון ־ קודש ווי ַא‬ ."‫בת ־ הר‬ Kadya ist eine Belesene, und obwohl wir dies wissen, überrascht uns das immer wieder aufs Neue, eine Menge allgemeine Bildung und nicht weniger jiddische und hebräische, wie eine Rabbinerstochter aus früheren Zeiten.18 Topoi aus der Erinnerungslandschaft des jüdischen Bücherschranks sind in Kadya Molodowskys Poesie von ihrem Früh- bis zu ihrem Spätwerk gegenwärtig : 19 Bibelworte, Stilĳiguren und Bilder aus dem religiösen Sprachbereich, Anspielungen auf biblische Szenen, zitierte oder paraphrasierte Midraschmotive wirken im jiddischen Vers oft als beiläuĳige Reminiszenz, im neuen Kontext jedoch als Bruchstifter. Was genau wird erinnert, womit gebrochen ? In Molodowskys letztem Gedichtband ‫דארנבוים‬ ָ ‫ ( ליכט ון‬Licht des Dornbuschs ), 1965 in Buenos Aires erschienen, ĳinden sich zahlreiche Bibelgedichte, in zwei von ihnen wird der Sulamith-Stoff gestaltet : ‫ ( שולמית‬Sulamith ) und ‫ ( צום מלך שלמה קומט די הערלעכע שולמית‬Zum König Salomo kommt die herrliche Sulamith ).20 Die Gedichte sind Ende der 1950er Jahre in New York entstanden, wo die Dichterin seit 1935 lebte, und können ihrem lyrischen Spätwerk zugerechnet werden.21 Die zweifache Gestaltung desselben Stoffs macht Molodowskys poetisches Verfahren deutlich. Welche Konstellationen der polytextuellen Sulamith-Gestalt werden als Spur gelegt ? Wie bringt der in Texten der Überlieferung verankerte und darin begrenzte narrative Raum einen anderen Text und Differenz hervor ? 16 Zu ihrer Stellung im Warschauer jiddisch-literarischen Umfeld s. Cohen 2008. 17 ‫ ( רינגען‬Ringe ) 1921, 2 : 85 – 89,‫ פּערעץ ] ! [י‬.‫ ל‬.‫ ( י‬Y. L. Peretz [ -Anthologie ] ) Minsk 1922 : 39 f, ‫נאך‬ ַ ‫למא‬ ַ ‫ווארשעווער ַא‬ ַ ( Warschauer Almanach ) 1923 : 1 – 7, ‫ווארשעווער שריטן‬ ַ ( Warschauer Schriften ) 1926 – 1927 : 1 – 4 und seit 1925 regelmäßig in den ‫ליטערארישע בלעטער‬ ַ ( Literarische Blätter ), darunter auch ihre Gedichte für Kinder. 18 Ravitch 1945 : 123. 19 Zur Figur des Gebets in frühen Gedichten s. Hellerstein 1989 : 212 – 221, zu Hebraismen als Metaphern in Molodowskys ‫ ( רויען ־ לידער‬Frauen-Lieder / -Gedichte ) s. Hellerstein 1990. 20 Molodowsky 1965 : 130 und 135. 21 Nur das erste Gedicht ist datiert ( 1959 ), aber aufgrund der gemeinsamen poetologischen Perspektive auf den Stoff vermute ich, dass beide in zeitlicher Nähe entstanden sind. Kadya Molodowsky und ihr Mann zogen 1948 nach Israel, kehrten jedoch 1952 nach New York zurück, wo Simkhe Lev 1974 und Kadya Molodowsky 1975 starb. Efrat Gal-Ed : Spur und Differenz 35 ‫שולמית‬ Sulamith ,‫ נידעריק‬,‫די העכסטע בערג זענען נידעריק‬ .‫בארג איז הויך‬ ַ ‫דער קלענסטער‬ ‫געזאגט חכמים זיבעציק‬ ָ ‫האבן‬ ָ ‫ַאזוי‬ .‫און איך הקטנה אויך‬ Die höchsten Berge sind niedrig, niedrig, der kleinste Berg ist hoch. Also sagten der Weisen siebzig und ich, die Geringe, auch. ,‫ נידעריק‬,‫די העכסטע בערג זענען נידעריק‬ .‫שפּאן זיי ַאריבער מיט מ)ן בליק‬ ַ ‫איך‬ ‫געזאגט חכמים זיבעציק‬ ָ ‫האבן‬ ָ ‫ַאזוי‬ .‫יאר צוריק‬ ָ ‫מיט טויזנט‬ Die höchsten Berge sind niedrig, niedrig, ich überspringe sie mit meinem Blick. Also sagten der Weisen siebzig es ist tausend Jahre her. ,‫גאר ָאן ַא סוף‬ ָ ‫בארג איז הויך‬ ַ ‫דער קלענסטער‬ .‫גאר ָאן ַא שיעור‬ ָ ‫הויך און העכער‬ ‫שאף‬ ָ ‫שפּאצירט שולמית מיט איר‬ ַ ‫דארט‬ ָ ‫האט‬ ָ ’‫ס‬ .‫נאך איר‬ ָ ‫און זיבעציק חכמים‬ Der kleinste Berg ist hoch, ganz ohne Ende, hoch und höher, ganz ohne Maß. Dort ging Sulamith mit ihren Schafen spazieren und siebzig Weise ihr nach. .‫אויסגעטראכט‬ ַ ‫אר איר די חכמה‬ ַ ‫האבן‬ ָ ‫זיי‬ .‫ראסט‬ ַ ‫א‬ ַ ‫דאס ליד ון לידער‬ ָ ,‫געמאכט‬ ַ ‫בארג ַאזוי הויך‬ ַ ‫האט דעם קליינעם‬ ָ ‫זי‬ .‫געפּאסט‬ ַ ‫האט‬ ָ ‫אר איר‬ ַ ‫ווי‬ Sie haben für sie die Weisheit erdacht. Das Lied der Lieder verfaßt. Sie hat den kleinen Berg hoch gemacht, wie es ihr gerade gepaßt.22 ,‫איך בין ַאזוי מקנא איר‬ .‫ארגייט נישט און בליט‬ ַ ‫איר שיינקייט‬ ‫וואס חכמים זיבעציק‬ ָ ,‫דאס‬ ָ ‫טאקע‬ ַ ‫און‬ .‫כגעגאנגען אירע טריט‬ ַ ‫נא‬ ָ ‫זענען‬ Ich bin auf sie so neidisch, ihre Schönheit vergeht nicht und blüht. Und auch, dass der Weisen siebzig ihr folgten auf Schritt und Tritt.23 1959 ‫צום מלך שלמה קומט די הערלעכע שולמית‬ — ‫צום מלך שלמה קומט די הערלעכע שולמית‬ .‫באצירן‬ ַ ‫ַא רויז ון שרון אירע צעפּ‬ — : ‫זאגט דער מלך צו דער הערלעכער שולמית‬ ָ ? ‫ווי קומסט דו ַאהער ון שיר ־ השירים‬ ,‫מיט טרערן וויינט די הערלעכע שולמית‬ — : ‫קאלירן‬ ָ ‫בײטן זיך אין פּנים די‬ ַ ‫פון טרויער‬ ,‫דא ַאהער‬ ָ ‫ נעם מיך‬,‫גרויסער מלך‬ .‫דארט אין שיר ־ השירים‬ ָ ‫איך קען נישט אייביק זיצן‬ Zum König Salomo kommt die herrliche Sulamith Zum König Salomo kommt die herrliche Sulamith – eine Rose von Sharon ihre Zöpfe zieren. Sagt der König zur herrlichen Sulamith : – Wie kommst du hierher aus dem Lied der Lieder ? Tränen vergießt die herrliche Sulamith, vor Trauer wechselt ihr Gesicht die Farbe : – Großer König, nimm mich da heraus, ich kann nicht ewig sitzen dort im Lied der Lieder. 22 Alternativ : » wie es für sie passte «. 23 Beide Gedichte von mir übersetzt. 36 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ,‫דא‬ ָ ‫נאר ַא ידל‬ ָ ‫באזונגען וווּ ס ’ איז‬ ַ ‫האט מיך שוין‬ ָ ‫מען‬ ,‫בײ ַאלע ברעגן‬ ַ ‫טײכן און‬ ַ ‫בײ ַאלע‬ ַ ‫ש"א‬ ָ ‫און צו דיר קומט שטילערהייט די מלכּה‬ .‫און טוט דיך אירע טריה רעטענישן רעגן‬ Man besingt mich schon, seit es eine Fiedel gibt an allen Flüssen und an allen Ufern, und zu dir kommt heimlich die Königin von Saba und stellt ihre unreinen Rätselfragen. ‫ איך וויל‬,‫ — הערלעכע‬: ‫לאכט דער מלך שלמה‬ ַ ,‫ארירן‬ ַ ‫דיך נישט‬ ,‫טאלן‬ ָ ‫דו ביסט די שענסטע יטערין אויף בערג און‬ .‫זײן אין שיר ־ השירים‬ ַ ‫און אייביק מוזסטו‬ ‫אר‬ ַ ‫דארסט‬ ַ ‫וואס‬ ָ ‫פּרײז‬ ַ ‫דאס איז דער‬ ָ .‫צאלן‬ ָ ‫שיינקייט‬ Lacht der König Salomo : – Herrliche, ich will Dich nicht verführen, du bist die schönste Hirtin auf Berg und Tal, und auf ewig mußt du bleiben im Lied der Lieder. Das ist der Preis, den musst du für die Schönheit zahlen. Im Hohenlied wird Sulamith als die Geliebte erinnert, doch ihr Name wird dort in nur einem einzigen Vers genannt ( 7 : 1 ) : 24 ‫מּית‬2‫שּׁוּ‬ ִ ‫שׁוּבי ַה‬ ִ ‫שׁוּבי‬ ִ ‫נ ֱחזֶ ה ־ ָבּך‬8 ֶ ‫שׁוּבי‬ ִ ‫שׁוּבי‬ ִ ‫מּית‬2‫שׁוּ‬ ִ ‫ַמה ־ ֶתּ ֱחזוּ ַבּ‬ : ‫ת ַה ַמּ ֲח ָניִ ם‬2ֹ‫ִכּ ְמח‬ Kehr ’ um, kehr ’ um, o Schulammit, Kehr ’ um, kehr ’ um, daß wir dich anschauen. Was schaut ihr an Schulammit ? Wie den Tanz von Doppelreihen ! Darauf folgt eine Beschreibung der Tänzerin von Fuß bis Kopf ( 7 : 2 – 7 ) : 25 ‫ַמה ־ יָּ פוּ ְפ ָע ַמיִ ְ ַבּ ְנּ ָע>ים‬ ‫ַבּת ־ ָנִיב‬ ‫אים‬D ִ ‫ֵכיִ ְ ְכּמוֹ ֲח‬G ַ ‫ַחמּוֵּי‬ : ‫ֵי ָא ָמּן‬G ‫ַמ ֲע ֵשׂה‬ ‫ָשְְֵׁ ַא ַגּן ַה ַסּ ַהר‬ ‫ַאל ־ יֶ ְח ַסר ַה ָמּזֵ ג‬ ‫ֵמת ִח ִטּים‬ ַ ‫ִבּ ְט ֵנְ ֲע‬ : ‫שּׁוֹשׁ ִנּים‬ ַ ‫סוּגה ַבּ‬ ָ ‫ְשׁ ֵני ָשַׁיִ ך ִכּ ְשׁ ֵני ֳע ָפ ִרים‬ : ‫ביָּ ה‬Q ִ ‫ָתּ ֳא ֵמי‬ ‫ְ ְכּ ִמ ְג ַדּל ַה ֵשּׁן‬S‫וָּ א‬T Wie schön sind deine Tritte in Schuhen, Fürstentochter ! deiner Hüften Wölbung wie Geschmeide, das Werk von Künstlerhand. Dein Nabel eine runde Schale, nicht fehlt darin der Wein ; dein Leib eine Weizengarbe, umhängt von Rosen. Deine zwei Brüste wie zwei junge Rehe, Zwillinge der Hindin. Dein Hals wie ein Turm von Elfenbein, 24 Nach Ibn Esra weist der Name auf die Stadt šālēm, Jerusalem hin ( Gen 14 : 18 ; Ps 76 : 3 ). In den Wurzelkonsonanten des Namens ‫ שׁלמ‬klingt die Bedeutung › ganz ‹, › befriedet ‹, › vollkommen ‹ mit : Sulamith als Verkörperung der Makellosen ( zur Namensdeutung s. Keel 1986 : 210 – 212 ; Zakovitch 2004 : 242 f ). Alle Zitate aus der hebräischen Bibel in der Übersetzung von Leopold Zunz. 25 » Dies ist der einzige Fall, wo ein Beschreibungslied ( vgl. 4 : 1 – 7 ) nicht mit dem Kopf beginnt, sondern mit den Füßen, was sich bei einer tanzenden Figur ganz natürlich ergibt. Diese Schilderung hat eine verblüffende Parallele in einem Liebeslied des Philodemos, das von den Füßen der Geliebten schrittweise hinaufsteigt bis zu den Augen, die den Sprecher verrückt machen « ( Zakovitch 2004 : 241 f ). Efrat Gal-Ed : Spur und Differenz 37 ‫יניִ ְ ְבֵּכוֹת ְבּ ֶח ְשׁבּוֹן‬ ַ ‫ֵע‬ ‫בּים‬U ִ ‫ַעל ־ ַשׁ ַער ַבּת ־‬ ‫ַא ֵפְּ ְכּ ִמ ְג ַדּל ַה ְלּ ָבנוֹן‬ : ‫ַמּ ֶשׂק‬ ָ ‫צוֹפה ְפּ ֵני‬ ֶ ‫ְמל‬ ֶ ‫ֹאשְׁ ָע ַליִ ְ ַכּ ַכּ‬ ֵ ‫ר‬ ‫ְגּ ָמן‬ ָ ‫ֹאשְׁ ָכּ ַא‬ ֵ ‫ַלּת ר‬ ַ ְ‫ו‬ : ‫ְה ִטים‬ ָ ‫ֶמ ֶלְ ָאסוּר ָבּ‬ ‫וּמה ־ ָנ ַע ְמ ְתּ‬ ַ ‫ַמה ־ יָּ ִפית‬ : ‫נוּגים‬ ִ ‫ַא ֲה ָבה ַבּ ַתּ ֲע‬ deine Augen Teiche von Cheschbon am Tore von Bat Rabbim, deine Nase wie ein Turm auf Lebanon, schauend nach Dammesek. Dein Haupt auf dir ist dem Karmel gleich, und die Locken deines Hauptes wie Purpur ; ein König gefesselt in den Netzen. Wie so schön, wie so lieblich bist du, Liebe, in Wonnen ! Das ist alles, was der biblische Text zu Sulamith liefert. Doch der eine Vers gab allen Geliebten dieser biblischen Liebesliedersammlung denselben Namen, machte Sulamith zur einzigen Protagonistin, zur Geliebten Salomos.26 So gelesen, verkörpert Sulamith nicht nur ein Schönheitsideal, ist nicht nur Tänzerin, sondern auch Hirtin und vor allem selbstbewußte Geliebte, die ihrem Geliebten erotisch und geistreich, neckend und herausfordernd begegnet. Zu dieser Sulamith gehört eine in Wach- und Nachtträumen ziselierte Innenwelt und die abwechslungsreiche Geographie, die sich von den Bergen Libanon, Hermon, Amana und Senir im Norden des Landes über den Karmel im Westen bis Gilead im Osten erstreckt, sowie die Landschaft Sharon, die Städte Jerusalem, Tirza und En-Gedi einschließt mit ihrer Flora und Fauna. Mehr noch – dieser Sulamith sind Stil und Strukturen gebundener Sprache nicht fremd : Sie beherrscht die Tonlage von Ernst, Humor und Ironie, den Monolog und das Scherzgespräch ; sie geht mit Gleichnissen und Metaphern erhellend und verdunkelnd um, weiß Parallelismen, Assonanz, Reim und Alliteration, Wiederholung, Wortspiel und Doppeldeutigkeit kunstvoll einzusetzen.27 26 Kritische Bibelforscher sehen im Hohenlied eine 27 Lieder und vier Fragmente umfassende Gedichtsammlung ( ibid.: 30, 67 ) : » Dem Hhld. in der vorliegenden Form scheinen wie dem Psalter oder dem Buch der Sprüche verschiedene kleinere Sammlungen von Gedichten vorausgegangen zu sein. « ( Keel : 1986 : 26 ) Yair Zakovitch vermutet in einigen der Lieder Frauen-Lyrik. Er führt andere biblische Stellen an, in denen die Gattung des Sieges-, Spott-, Trauer- und Hurenliedes frauenspeziĳisch sei und weist statistisch nach, dass der Anteil der Frau an den 127 Versen des Hohenlieds mit 52 , 6 % weitaus höher liegt als der des Mannes mit nur 28 , 6 %. Auch wirke die Gestalt der Frau » vielseitiger und plastischer «, die Geliebte sei » kühner als ihr männlicher Partner «, die Initiative zur Annäherung gehe von ihr aus, sie erweise sich durch ihre Spottrepliken als die Gewitztere. Ferner hält Zakovitch die zahlreichen Traumszenen für ausgesprochen weibliche Träume. Diese Beobachtungen sprächen dafür, » dass die Frau hier dem Mann nicht unter-, sondern eher überlegen ist « und ließen die Annahme berechtigt erscheinen, » dass zumindest ein erheblicher Anteil der Lieder von Hld von Frauen verfasst sein kann « ( ibid. : 46 ). 27 Zu den poetischen Gestaltungsmitteln des Hohenlieds s. Krinetzki 1964 : 46 – 82, Kugel 1981 : Index, Alter 2011 [ 1985 ] : 231 – 255, Keel 1986 : 31 – 39, Zakovitch 2004 : 74 – 84. 38 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Der weltliche Charakter des Buchs, das aufgrund der Zuschreibung an Salomo in die › biblische Sammlung ‹ aufgenommen wurde, erzeugte im sakralen Kontext eine Spannung, die nach Deutung verlangte und zum allegorisierenden Lesen des Buches führte : 28 Seit der Zerstörung des Zweiten Tempels wurde das Hohelied als allegorische Darstellung der Liebesbeziehung zwischen Gott und Israel seit dem Auszug aus Ägypten gelesen.29 Nun war Sulamith keine individuelle Person mehr, sondern eine Kollektivgestalt, ‫כנסת ישראל‬, » die zur Person erhobene Ekklesia oder Gemeinde Israel «, » die personhaft gefaßte Ganzheit des Volkes als religiöse Gestalt «, welche » in unendlich vielen Äußerungen der Rabbinen im Talmud und Midrasch als handelnde und sprechende Figur [ … ], als spiritueller Typus, als Wirklichkeit in der sakralen Sphäre und Geschichte « auftritt.30 Was haben die Rabbinen mit dem Hohenlied gemacht ? Haben sie es gedeutet, aus alten Vorlagen abgeschrieben oder gar übersetzt ? Nach ’Āwōt de-rabbī nātān waren die drei Salomo zugeschriebenen Weisheitsbücher Sprüche, Hohelied und Prediger ‫ ( גנוזים‬zurückgestellt) 31 bis ‫ ( אנשי כנסת הגדולה‬Männer der großen Versammlung ) diese deuteten bzw. übersetzten.32 Mit der Vorstellung von den Weisen als Übersetzer wurde die Salomonische Autorschaft um jene der Rabbinen erweitert. 28 Menahem Haran argumentiert gegen die verbreitete Ansicht, dass erst die Allegorisierung des Texts zu seiner Kanonisierung führte ( Haran 1996 : 70 – 78 ). Zakovitch hingegen sieht erste Ansätze zur Allegorisierung des Hohenlieds noch vor der Endredaktion des Werks, welche er auf das 3. Jahrhundert v. d. Z. datiert ( Zakovitch 2004 : 96 f, 66 ). 29 Vgl. Ohly 1958, Urbach 2002, Boyarin 1994 : 105 – 116, Zakovitch 2004 : 97 – 101. Die Denkĳigur dieser Allegorie stellt keine Innovation dar, sondern greift auf Vorbilder aus den Büchern der Propheten zurück : » So spricht der Ewige : Ich gedenke dir deine jugendliche Huld, deine bräutliche Liebe, wie du mir gefolgt durch die Wüste, durch unbesäetes Land « ( Jer 2 : 2 ) ; » – ja mit ewiger Liebe liebt ’ ich dich, darum zog ich dir nach mit Huld. Wiederum werde ich dich bauen, daß du gebaut bleibest, Jungfrau Jisraël, wiederum sollst du anlegen deine Pauken und ausziehen im Reigen der Fröhlichen « ( Jer 31 : 3 – 4 ) u. a. Boyarin hebt die Sicht der Rabbinen hervor, dass die Salomonischen Bücher ‫ – משלים‬sprich midraschähnliche, die Torah interpretierende Schriften sind und sieht in Salomo, dem Autor des Hohenlieds, » the very prototype of the rabbinic reader « ( Boyarin 1994 : 105 ). 30 Scholem 1977 : 140 – 141. Aus dieser allegorischen Lesart entwickelt Paul Celan in seiner » Todesfuge « die Kollektivgestalten Sulamith und Margarete als Gegenbilder : Sulamith, die ehemals ( » aschenes Haar « ) Schönste aller Frauen ( » Lilie unter den Dornen «, Hld 2 : 2 ) und Braut Gottes, im Gegensatz zu Margarete, der › Perle ‹ ( Altgriech. › margarites ‹ ), › Knospe ‹ und › Blütenkranz ‹ ( Sanskrit › mañjarī ‹ ), dem gegenwärtigen ( › goldenes Haar ‹ ) Kleinod. 31 Hier: unveröffentlicht als Teil der heiligen Schrift. 32 ’Āwōt de-rabbī nātān, 1 , 4. In dieser Bārajtā’ werden als Handelnde einmal » die Männer Chiskijah ' s, Königs von Jehudah « ( Spr 25 : 1 ) und einmal » die Männer der großen Versammlung « genannt. Ihre Handlung wird mit ‫העתיקו‬, ‫ המתינו‬und ‫ פירשו‬wiedergegeben. ‫ העתיקו‬wird zunächst aufgrund der Nähe zu ‫ ( עתיק‬Dan 7 : 9 ) als sorgsames und lang andauerndes Überprüfen verstanden und nicht in der Bedeutung › von Ort zu Ort übertragen ‹ oder › von Schrift zu Schrift kopieren ‹ gelesen. Diese Lesart rückt ‫ העתיקו‬in die Nähe von ‫המתינו‬, das › gemäßigtes Vorgehen ‹ denotiert. Abba Shaul jedoch deutet ‫ העתיקו‬als ‫פירשו‬, Efrat Gal-Ed : Spur und Differenz 39 Die Rabbinen lasen also Sulamith als die Nation, in welcher der Friede des Ewigen einwohnt, die Nation, die Gott in ein Haus des Friedens setzen oder ihr den Frieden wie einen Strom zulenken wird.33 So gelesen, standen die schönen Schritte der Tänzerin für die Schritte der Jerusalem-Pilger, ihr Nabel stand für das Synedrion, ihr Bauch für die Lehre der Priester, die von Lilien umhängte Weizengarbe für die Sünden, die von den sanften Worten der Torah umsteckt werden … die Nase für den Tempel. Schön war Sulamith, weil sie die Gebote der Torah hielt, und lieblich aufgrund ihrer Großherzigkeit und Freigebigkeit.34 Die rabbinische Lesart blieb vorherrschend, war jedoch nicht die einzige. Im Mittelalter las beispielsweise Ibn Aknin ( um 1150 – um 1220 ) die Dialoge des Hohenlieds auch als Gespräche zwischen der Seele des Menschen und dem schöpferischen Logos, und im Sohar wurde die Sexualsymbolik im Hohenlied allegorisch auf Stadien der innergöttlichen Einigung bezogen : Sulamith als zehnte Seĳirah, Schechinah, das weibliche Prinzip in der Gottheit.35 Kadya Molodowsky entwirft zwei ungleiche, gar gegensätzliche Bilder der Sulamith. Setzt sie damit die Tradition fort oder stiftet sie eine neue ? Das Sulamith-Gedicht entwickelt sie aus der überlieferten Spannung zwischen dem erotischen Text und seinem sakralen Kontext, zu deren Entschärfung die Rabbinen ( Mit ) -Autoren des Hohenlieds wurden, und aus der im biblischen Vers verankerten Bewunderung für Sulamith. Die erste Strophe beginnt mit einer scheinbar sprichwörtlichen Äußerung, die im dritten Vers auf die Rabbinen zurückgeführt wird, und der sich im vierten Vers die erzählende Sprecherin anschließt. Dieser › rabbinische Spruch ‹,36 » Die höchsten Berge sind niedrig, niedrig, / der kleinste Berg ist hoch «, mutet aber seltsam an : Er besteht aus zwei paradoxen Aussagen, die von einem durch die Wiederholung des Wortes » niedrig « evoziert beruhigenden, beinah märchenhaften Ton getragen das › deuten ‹, und zugleich › übersetzen ‹, › von einer Sprache in eine andere übertragen ‹ bedeutet. S. hierzu Schechters Anmerkungen 19 und 20 im Apparat seiner Ausgabe. Ab dem Mittelalter las man ‫ העתיקו‬als › sie übersetzten ‹. S. Harans Analyse der Bārajtā’ ( Haran 1996 : 293 – 296 ). Haran argumentiert gegen die Lesart, dass erst die Weisen die Schriften aus der ‫ גניזה‬holten. Vielmehr sieht er die Weisen durch den weltlichen Inhalt der bereits öffentlich gewordenen und akzeptierten Bücher genötigt, diese zu kommentieren. 33 Nach 2. Sam 7 : 6, Jes 32 : 18 und 66 : 12. Nach Yosef Yitzchok Schneersohn schloss Sulamith Frieden zwischen Gott und seiner Schöpfung, da sie seine Torah angenommen hatte ( Tōrat měnaḥēm, 14. Kislev 1954 : 183 ). 34 S. Šīr ha-šīrīm rabbāh, 7 : 1 – 12. 35 S. Halkin 1964 : 5 – 9, vgl. Scholem 1977 : 178. 36 Zu ‫מימרת חכמה‬, dem rabbinischen Weisheitsspruch s. Frenkel 1996 ( ii ) : 490 – 500. 40 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ werden. Sie wirken wie ein statisches Gleichnis, dessen Anlage jedoch unaufgelöst bleibt, eine Art ‫ משל‬ohne ‫נמשל‬,37 der Zweifel an der rabbinischen Autorschaft dieses › Midrasch ‹ aufkommen lässt. Um die Glaubwürdigkeit der rabbinischen Quelle und damit des Zitats zu suggerieren, legt Molodowsky zwei sichtbare Spuren : » siebzig Weise «, Synekdoche für die Männer der Großen Versammlung, und das Gelehrten-Idiom » ich die Geringe «, das allerdings in der männlichen Form üblich ist.38 Damit gibt sich die Erzählerin als belesen zu erkennen, bezeugt ihre Fähigkeit, Texte zu zitieren und stellt sich auf die gleiche Stufe mit den Weisen, die sie zitiert. Allerdings lässt sich kein solcher Spruch in rabbinischen Schriften ĳinden. Er ist Fiktion. Verweisen » die höchsten Berge «, verweist » der kleinste Berg « auf jene, die im Hohenlied genannt werden ( Betar, Gilad, Libanon, Amana, Senir, Hermon, Karmel, Myrrhenberg, Balsamhügel und Balsamberge ) ? Das oxymoronische Doppelbild der Berge liest sich eher als Anspielung auf Jesaia 40 : 4 : » Jedes Tal erhebe sich, und jeder Berg und Hügel senke sich, und es werde die Krümmung zur Ebene, und die Höcker zum Tal «.39 Sowohl der biblische als auch der moderne Text bringt die Umkehrung der Höhenverhältnisse zum Ausdruck. Doch im Vergleich zum biblischen Vers wird deutlich, worin sich Molodowksys Spruch unterscheidet : Er hält eine bereits existierende Berglandschaft fest, keine endzeitliche Denkĳigur, kein Symbol eines Versprechens. Mehr noch – 37 Zum speziellen Charakter des rabbinischen māšāl s. ibid.: 409 – 427 ; zum māšāl als Intertext s. Boyarin 80 – 92. 38 Die in den Quellen genannte Zahl der » Männer der großen Versammlung « variiert ( b. Měgillāh 17 b gibt 120 an, j. Měgillāh 1 : 7 nur 85 ). Siebzig ( mit Vorsitzendem 71 ) waren die Mitglieder der Folgeinstitution ‫סנהדרין‬, des » großen Rats «. Siebzig zählten auch die Ältesten, die Mose beistanden ( Lev 11 : 16 ). In der Männerdomäne der Responsenliteratur ist das Phrasem ‫ ( אני הקטן‬ich der Geringe ) häuĳig belegt. Das Bild der an Gelehrsamkeit » kleinen « Sprecherin unter den Weisen läßt an biographische Parallelsituationen denken : Molodowsky als einziges Mädchen im männlich dominierten kheyder, später als junge Dichterin in männlichen Dichterkreisen. 39 Eine ähnliche Denkĳigur ĳindet sich in Psalm 75 : 7 – 8 : » Denn nicht vom Anfange und vom Niedergange, und nicht von der Wüste der Berge her ; / Sondern Gott ist Richter, diesen erniedrigt, jenen erhöht er. « Im vielfach zitierten Midrasch zu diesem Vers werden ‫הרים‬ ( Berge ) auch als ‫ ( רוממות‬Erhabenheit, Überheblichkeit, Dünkel ) gedeutet ( Bě-midbar rabbāh, maṭṭōt, 8 ; Tanḥūma’, maṭṭōt, 6 u. a. ). In mehreren Midraschim über die Erniedrigung der Stolzen und die Erhöhung der Demütigen werden die Berge Tabor und Karmel als dünkelhaft, der Berg Sinai hingegen als demütig dargestellt. Gott habe den Sinai wegen seiner Demut mit seiner göttlichen Gegenwart und der Gabe der Torah geehrt ( z. B. Pěsīqta’ rabbatī 7 ). Der biblische Text bietet eine abwechslungsreiche Bergbildlichkeit, um das Vergängliche an Macht und Würde zu veranschaulichen, beispielsweise » entzündet die Grundfesten der Berge « ( Num 32 : 22 ) ; » Berge zerflossen vor dem Anblicke des Ewigen « ( Ri 5 : 5 ) ; » Berge zerreißend und Felsen zertrümmernd « ( 1 Kön 19 : 11 ) ; » Berge zerschmelzen wie Wachs vor dem Ewigen « ( Ps 97 : 5 ). Mächtige Berge, die zermalmt werden, auf dass der Urgrund die Welt nicht überflute, ist eine weitere geläuĳige Denkĳigur ( Bě-rēšīt rabbāh, nōaḥ, 33 ). Efrat Gal-Ed : Spur und Differenz 41 der außerordentliche Zustand dieser Berge ist nicht von Gott gemacht, sondern geht auf die unübertreffliche Wirkkraft einer Frau zurück, doch das wird erst in der vierten Strophe eindeutig gesagt. Die zweite Strophe ist der ersten Spruchhälfte gewidmet : Der erste Vers wiederholt sie, und im zweiten Vers veranschaulicht die Erzählerin die Kleinheit der höchsten Berge, da sie diese mit ihrem Blick » überspringen « kann. Steht die Erzählerin in großer Distanz zu den Bergen, wenn sie diese mit ihrem Blick » überspringt « oder suggeriert die poetische Formulierung eher innere Distanz, da die Erzählerin die Berge mit ihrem Blick durchschaut ? Im dritten Vers wird die Autorschaft der siebzig Weisen wiederholt und im vierten kommt der Zeitanker » vor tausend Jahren « hinzu.40 Den uralten Spruch der Weisen erlebt die Erzählerin als immer noch gültig. Die dritte Strophe ist der zweiten Spruchhälfte gewidmet : sie wird hier nicht wiederholt, sondern erweiternd paraphrasiert ( 1. und 2. Vers ) : Der kleinste Berg ist nicht einfach » hoch «, sondern von endloser, unermeßlicher Höhe. Erst jetzt, im Zusammenhang mit dem gigantischen Berg, erscheint Sulamith ( 3. Vers ). Sie geht mit ihren Schafen » spazieren « – die Wortwahl deutet Gelassenheit an – und die siebzig Weisen gehen hinter ihr her ( 4. Vers ). Siebzig weise Männer folgen einer mit ihren Schafen lustwandelnden Hirtin auf einem riesigen Berg. Die Folgen dieser Begegnung werden in den ersten Versen der vierten Strophe genannt : Die Weisen haben Sulamith die Weisheit zugedacht und das Hohelied verfasst. Mit dieser Schilderung verschiebt Molodowsky die Zuschreibung der Weisheitsbücher von Salomo an die Weisen und transponiert den narrativen Strang.41 Der als Geliebter abwesende Salomo wird um seinen Anteil an der Autorschaft gebracht. Das Hohelied geht nicht auf die Liebe von Salomo und Sulamith zurück, sondern auf die Faszination der siebzig Weisen für diese Frau, die den kleinen Berg so hoch zu machen vermochte, wie es ihr gerade recht 40 Die Zahl wirkt hier kaum historisch, eher suggestiv und entspricht dem angeschlagenen märchenhaften Ton. 41 Nach rabbinischer Deutung hat Salomo ( a ) die drei Weisheitsbücher verfasst ( b ) kraft göttlicher Inspiration ( c ) um die Torah zu ergründen und begreiflich zu machen ( d ) und dabei innovative Stilmittel wie měšālīm, Gleichnisse und Beispiele zum ersten Mal angewandt : » Eine andere Deutung : Lied der Lieder. Das sagt die Schrift ( Prediger 12 ) : › Und was mehr dartut, daß Kohelet ein Weiser war ‹. Hätte sie ein anderer Mensch gesprochen, hättest du deine Ohren beugen und diesen Worten horchen müssen ; um so mehr, da sie Salomo sprach. Und hätte er sie nach eigenem Gutdünken gesprochen, hättest du deine Ohren beugen und diesen Worten horchen müssen ; um so mehr, da er sie inspiriert vom Geist des Heiligen gesprochen hat. › Und was mehr dartut, daß Kohelet ein Weiser war, fortwährend lehrte er das Volk Erkenntnis und erwog und forschte, verfaßte viele Sprüche ‹ – er erwog die Worte der Torah, und erforschte die Worte der Torah, machte Griffe für die Worte der Torah. Und du ĳindest, daß bis Salomo da war, es kein Gleichnis ( Beispiel ) gab « Šīr ha-šīrīm rabbāh, 1 : 8 [ meine Übersetzung, Bibelzitat in Zunz ’ Übersetzung ]. 42 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ war ( 3. und 4. Vers ). Diese Aussage stellt den Bergspruch in ein neues Licht, hält unmißverständlich fest, dass Sulamith über Kräfte verfügt, die Berge zu transformieren vermögen. Außerordentliche Transformationen am Bergmotiv zu veranschaulichen, ist nicht neu : Nicht nur der biblische Text bietet für göttliche Omnipotenz zahlreiche Bergmetaphern, auch die Rabbinen prägten für höchste geistige Fähigkeiten eine eindrückliche Bergmetapher : » er entwurzelt Berge und zermalmt sie aneinander «, sagten sie von Resch Laqisch und von Rabbi Meir.42 Was nur Gott und den geistreichsten Männern vorbehalten war, dient Molodowsky zur Modellierung ihrer Kontrafaktur. Anstelle des männlichen setzt sie ein weibliches Subjekt, dessen transformative Kraft weder entwurzelt noch zermalmt, sondern Wachstum hervorbringt. Offen bleibt, wofür der Berg steht. Die superlative Höhe des Bergs stellt eine Parallele zur superlativischen Bedeutung des Ausdrucks šīr ha-šīrīm ( im Gedicht lid fun lider ) dar, das unermeßliche Lied oder in der Übersetzung Luthers » das Hohe Lied «. Sind die Lieder der Mächtigen klein und das Lied der Sulamith das höchste ? In der fünften und letzten Gedichtstrophe wechselt die Erzählerin unvermittelt von ihrer bis dahin distanzierten Haltung (erzählendes Ich) zur Selbstkundgabe (erlebendes Ich) und stellt mit einfachen Worten fest : » Ich bin auf sie so neidisch « ( 1. Vers ). Die Sprecherin beneidet Sulamith um deren unvergänglich blühende Schönheit ( 2. Vers ) und nicht minder um die Gefolgschaft der siebzig Weisen ( 3. und 4. Vers ). Dieser Wechsel von der extradiegetischen Perspektive zum persönlichen Sprechen, von der Außen- zur Innensicht öffnet den narrativen Raum auf eine poetische Selbstreflexion hin : Meine Gedichte sind endlich, ihre unendlich. Im poetologischen Raum zollt die Dichterin Kadya Molodowsky der Dichterin Sulamith Bewunderung für ihre kecke und freie Selbstbehauptung, neidet der Kunstgestalt die unvergängliche Schönheit des Idealen und die rabbinische Rezeption, die daraus das höchste Buch der Poesie machte. Molodowskys souveräne Gestaltungskraft steht jener Sulamiths nicht nach. Sie ĳindet zu einem Textverfahren, das ihr erlaubt, kunstvoll zu ĳingieren, eine traditionelle Figur scheinbar fortzuführen, tatsächlich aber eine neue narrative Tradition zu stiften. Molodowskys Gedicht interpretiert nicht Sulamiths polytextuelle Gestalt. Vielmehr entfaltet Molodowsky ihre poetologische Reflexion, indem sie sich ihrer Sulamith-Gestalt aussetzt. 42 ‫טוֹח ָנן זֶ ה ָבּזֶ ה‬ ֲ ְ‫עוֹקר ָה ִרים ו‬ ֵ bzw. ‫טוֹח ָנן זֶ ה ָבּזֶ ה‬ ֲ ְ‫עוֹקר ָה ֵרי ָה ִרים ו‬ ֵ ( b. Sanhedrīn 24 b ). Efrat Gal-Ed : Spur und Differenz 43 Beinahe als Gegenentwurf liest sich Molodowskys Zum König Salomo kommt die herrliche Sulamith, das als dramatischer Dialog gestaltet ist. ( 1 ) Es beginnt unmittelbar mit dem Erscheinen der schönen Sulamith vor dem König Salomo. Ihre Schönheit wird im 2. Vers durch das Bild ihrer Zöpfe betont, welche sie, die Rose von Sharon zieren.43 Das Zitat der bekannten Metapher aus dem Hohenlied verleiht der Szene den Anschein der alten Normalität, die jedoch durch Salomos Frage, wie sie denn aus dem Hohenlied hierher komme, oder anders ausgedrückt, was sie hier eigentlich mache, zerstört wird. Diese Frage setzt das Hohelied als Sulamiths natürlichen Lebensraum und ihr Erscheinen vor Salomo als Grenzüberschreitung voraus. Vielleicht verbirgt sie auch Bewunderung dafür, dass es Sulamith gelungen ist, den poetischen Raum zu verlassen und in den realen einzutreten. ( 2 ) Sulamith weint und die Trauer verändert ihre Gesichtsfarbe. Sie appelliert an den König, sie aus jenem Ort, aus dem Buch herauszuholen, da sie dort nicht ewig » sitzen « könne. Das Verb ruft die Assoziation an ein Gefängnis auf. Die Anrede » Großer König « betont die respektvolle Haltung der Bittstellerin und die Macht des Königs, ihr den Wunsch zu gewähren. Die innere Erschütterung ĳindet im gebrochenen Reim einen formalen Ausdruck. Die einzige Stelle im Gedicht, an der Molodowsky ihr Reimschema ( abab ) nicht einhält. ( 3 ) Den ersten Grund für ihre Bitte knüpft Sulamith an den Zeitaspekt : Sie kann nicht ewig dort bleiben, wo sie bereits seit unvordenklichen Zeiten ist. Seit es eine » Fiedel « gibt – solange man zurückdenken kann – besingt man sie, auch an allen Ufern des Exils. » Fiedel « ist hier eine bivalente Anspielung einerseits auf die » Buhlerin «, die spielend und singend durch die Stadt zog, andererseits auf die Verbannten, die ihre Musikinstrumente ins Exil mitnahmen.44 Diese mit einer oder vielen Fiedeln, an heimischen oder fremden Flüssen besungene Zeit verdichtet sich zu einem Raum, der Sulamith gefangen hält. Aus dieser verräumlichten Ewigkeit will sie ausbrechen. 43 Molodowsky folgt hier der gängigen jiddischen Übersetzung von ‫ֲא ִני ֲח ַב ֶצּ ֶלת ַה ָשּרוֹן‬ ( 2 : 1 ). Yehoyesh übersetzt : » Ikh bin a royz fun sharon, a lilye fun di toln «, Dunsky folgt ihm : » ikh bin di khavatselet, di royz, fun sharon « ( Dunsky 1973 : 152 ). Die deutsche Übersetzung von Leopold Zunz fällt anders aus : » Ich bin die Lilie Sharon ' s, die Rose der Täler «. Moderne Forscher identiĳizieren ḥavaẓẓelet als Strandkrokus oder Narzisse ( Zakovitch 2004 : 137 ). Auch über šōšannāh gehen die Meinungen auseinander. Zur Identiĳizierung der » berühmtesten Blume der Bibel « s. Erika Timms erheiternde tour de force ( Timm 2005 : 630 – 635 ). 44 » Nimm die Harfe, durchlaufe die Stadt, vergessene Buhlerin. Spiel schön, singe viel, auf daß man sich dein erinnere « ( Jes 23 : 16 ). »An den Strömen Babel ' s – dort saßen wir und weinten, da wir Zijon ' s gedachten. An den Weiden darin hingen wir unsere Harfen auf « ( Ps 137 : 1 – 2 ). S. Timms Kapitel » kinnor (‫ ) ִכּנּוֹר‬und nevel ( ‫) ֶנ ֶבל‬. Oder : der Lockruf der ĳidl « ( Timm 2005 : 580 – 582 ). ‫שׁוֹשׁ ַנּת ָה ֲע ָמ ִקים‬ ַ 44 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Der zweite Grund ist Neid auf eine Nebenbuhlerin, nicht auf irgendeine der vielen Frauen Salomos, sondern auf jene, die ihn mit ihrer Schönheit und Weisheit herausgefordert hatte, die Königin von Saba. Sulamith wirft Salomo die Fremde vor, die insgeheim kommt und ihn herausfordert.45 Ihre Rätsel bezeichnet Sulamith als » treyfe «, terminus technicus für ein Tier, das aufgrund eines organischen Makels rituell als unrein gilt und nicht verzehrt werden darf. Es versteht sich von selbst, dass die Unreinheit der Rätsel stellvertretend für die Frau steht.46 ( 4 ) Diese Argumentation quittiert der König mit Lachen und stellt klar : ( a ) er habe nicht vor, Sulamith zu verführen ( b ) sie sei die schönste Hirtin weit und breit ( c ) sie müsse im Hohenlied ewig bleiben ( d ) diesen Preis müsse sie für ihre Schönheit zahlen. Kadya Molodowsky übernimmt aus dem Hohenlied nur die dramatis personæ, jedoch nicht die Vorstellung vom höchsten Lied der Liebe. Das Wort Liebe taucht gar nicht erst auf. Hingegen wiederholt sie » Lied der Lieder « in drei von vier Strophen als Losungswort für höchste Poesie. Von der rabbinischen Deutung des Hohenlieds entlehnt sie das Konzept, dass Salomo der Autor der Schrift sei.47 Anders als in den Dialogen des Hohenlieds sprechen Salomo und Sulamith nicht als Liebende zueinander. Molodowskys Dialog ĳindet zwischen einer Figur und ihrem Autor statt. Das Gedicht besteht aus deren kurzem dramatischen Austausch ohne Zeit- oder Ortsangabe, in einem Raum ohne Eigenschaften. Alle Aufmerksamkeit ist auf die Dringlichkeit des Gesprächsinhalts gelenkt : Sulamith will die Kunstwelt verlassen, will ins Leben treten, um die Liebe zu verwirklichen, die im Gedicht nicht gelebt werden kann. Die Antwort des Autors trennt Liebe von Schönheit, das Schöne muß im Lied gefangen bleiben – als würde es verlieren, sollte es berührt werden. Nach Salomos Poetologie sind Dichtung und Leben unvereinbar. Wie im ersten Gedicht, in dem Molodowsky durch ihre Verschiebung geläuĳiger Idiome und Metaphern das Weibliche dem Männlichen gleichstellt, nimmt sie auch in diesem Gedicht eine pointiert weibliche Perspektive ein. In der Gegenüberstellung der poetischen Person mit ihrem Schöpfer erscheint das männliche Kunstideal, die Trennung zwi45 In den historischen Büchern hat die Gegenwart der Königin von Saba nichts Heimliches ( 1 Kön 10 und 2 Chr 9 ), vielmehr taucht in diesen Texten Sulamith nirgends auf. 46 Mit dieser Synchronizität ist Molodowsky nicht allein. Die Rabbinen fanden im Vers » Wer ist, die da heraufkommt von der Wüste, wie Rauchsäulen « ( 3 : 6 ) einen Hinweis auf die Königin von Saba, die Salomo Parfüms schenkte ( 1 Kön 10 : 10 ) ( vgl. Zakovitch 2004 : 170 – 172 ). 47 S. Anm. 41 und Šīr ha-šīrīm rabbāh, 1 : 10. Efrat Gal-Ed : Spur und Differenz 45 schen sinnlicher Welt ( Liebe ) und Poesie ( Reinheit, Wahrheit ) negativ. Mit Salomos Antwort stellt Molodowsky künstlerische Positionen infrage. Kann reine Kunst mehr über Liebe sagen, als das Leben verwirklichen lässt ? Sulamiths Grenzüberschreitung ist bereits Ausdruck eines weiblichen Gegenentwurfs. Kadya Molodowsky wird andere literarische Adaptionen des SulamithStoffs gekannt haben, beispielsweise Paul Heyses 1886 entstandenes Drama Die Weisheit Salomo ’ s, das S. L. Gordon unter dem Titel Sulamith oder Die Weisheit Salomos 1896 in hebräischer Übersetzung veröffentlichte. Sie hat sicherlich Alexander Kuprins 1908 entstandene idyllische Prosa Sulamith gelesen, von Avrom Goldfadens populärem Stück ‫ ( שולמית‬Shulames ), Y. L. Peretz ’ Erzählung ‫ ( ווענוס און שולמית‬Venus und Sulamith ), Sholem Aleichems Erzählung ‫ ( שיר השירים‬Das Lied der Lieder ) und den » Sulamith «-Gedichten S. S. Frugs, Morris Rosenfelds und Moyshe Broderzons ganz zu schweigen.48 Es ist anzunehmen, dass Molodowsky auch Else Lasker-Schülers frühes Gedicht » Sulamith « kannte, vielleicht sogar Das Peter-Hille-Buch, dem das Hohelied als Intertext dient.49 Vermutlich las man in jiddischen Dichterkreisen auch Wieland Herzfeldes ersten, 1917 erschienenen Gedichtband Sulamith. Ob Paul Celans Sulamith-Chiffre Molodowsky je erreicht hat, liegt im Dunkel.50 Kadya Molodowskys Textverfahren teilt Gemeinsamkeiten mit jenem von Else Lasker-Schüler : 51 Für beide ist Sulamith eine individuelle Gestalt. In Lasker-Schülers Fokus » winkt « das Leben der Liebenden,52 im Fokus der Molodowsky liegt jenes der Dichterin und der Gefangenen. In beiden Dichterinnen löst die Andere (in Gestalt der Sulamith) unterschiedliche Selbstreflexionen aus. Die daraus entstehenden Textverfahren bilden Sulamiths polytextuelle Gestalt nicht fort, wollen sie weder ergänzen noch demontieren und suchen im Prätext keinen Anker zur Selbstmythisierung ; vielmehr loten sie an der Anderen eigene Gebiete aus, erkunden in der Reibung am älteren poetischen Material die Konturen der eigenen Differenz. 48 Sol Liptzin bietet eine ausführliche, wenn auch unvollständige Übersicht der literarischen Sulamith-Adaptionen ( 1979 ). 49 Das Gedicht wurde 1901 in der Berliner jüdischen Kulturzeitschrift Ost und West erstveröffentlicht, 1902 in den ersten Gedichtband Styx und 1913 in die Hebräischen Balladen aufgenommen. Else Lasker-Schülers Poesie wurde von jiddischen Dichtern bewundert. Ihr Gedicht » Ruth « übersetzte in Rumänien der junge Itzik Manger ins Jiddische ( The National Library of Israel, arc. 4 ° 1357, 2 : 225 ). Das Peter-Hille-Buch, Lasker-Schülers erstes Prosawerk, erschien 1906. Zu seinem Textverfahren s. Bischoff 2002 : 97 – 208. 50 Eine jiddische Übersetzung der » Todesfuge « ist erst 1966 belegt ( Di goldene keyt 56 : 226 f ). 51 Ein detaillierter Vergleich beider Textverfahren würde den Rahmen dieser Arbeit übersteigen. 52 » O, wie Dein Leben mir winkt ! « ( Lasker-Schüler 1977 : 25 ). 46 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Zitierte Literatur Alter, Robert 2011 [ 1985 ] : The Art of Biblical Poetry. 2. Aufl. New York : Basic Books. Bergelson, Dovid, 2007 : » Belles-lettres and the Social Order ( 1919) « in : Joseph Sherman, David Bergelson : From Modernism to Socialist Realism. Oxford : Legenda, 337 – 345. Bischoff, Doerte, 2001 : Ausgesetzte Schöpfung : Figuren der Souveränität und Ethik der Differenz in der Prosa Else Lasker-Schülers. Tübingen : Niemeyer. Boyarin, Daniel 1994 : Intertextuality and the Reading of Midrash. Bloomington & Indianapolis : Indiana University Press. Braun, Alisa, 2007 : » Kadya Molodowsky. « In : Joseph Sherman, Writers in Yiddish. Detroit : Thomson Gale, 188 – 194. Cohen, Natan, 2008 : » Měqōmāh ū-fo ‘ olāh šel Qadyah Mōlōdōvsqī basěvivāh ha-sifrūtīt ha-yěhūdīt bě-Waršah. « In : Nāšīm bě-tarbūt yīdīš, 40 : 163 – 174. Dunsky, Shimshon, Hg., 1973 : Midrāš rabbāh : Šīr ha-šīrīm. Montreal : o. V. Fishman, David E., 2005 : The Rise of Modern Yiddish Culture. Pittsburgh : University of Pittsburgh Press. Frenkel, Yonah, 1991 : Darkhēy ha-’aggādāh wě-ha-midrāš. Givatayim: Massada. – 1996 : Midrāš wě-’aggādāh. Bd. i – iii, Tel-Aviv : The Open University of Israel. Gal-Ed, Efrat, 2010 : » Between Jesus and the Besht. « In : European Journal of Jewish Studies 4 ( 1 ) : 115 – 136. – 2011 : » The Local and the European: Itzik Manger and his Autumn Landscape. « In : Prooftexts 31 ( 1 – 2 ) : 31 – 59. – 2012 : » Itzik Manger and his Purimshpil « in : Zutot 9 : ( in Druck ). [ Grinberg, Uri Tsvi ] Anonym, 1922 : » Proklamirung. « In : Albatros 1 : 3. Halkin, Abraham S. ( Hg. ) 1964 : Hitgālūt ha-sōdōt wě-hōfa ‘ at ha-mě ’ ōrōt lě-r. Yōsēf b. Yěhūdah b. Ya ’ aqōv ibn ‘Aqnīn. Jerusalem : Mekitze nirdamim. Haran, Menahem, 1996 : Ha- ’ asuppāh ha-miqrā ’ it. Jerusalem : The Bialik Institute, The Magnes Press. Heinemann, Joseph, 1974 : ’Aggādōt wě-tōlědōtēyhen. Tel-Aviv. Hellerstein, Kathryn, 1989 : » Fear of Faith : The Subordination of Prayer to Narrative in Modern Yiddish Poems. « In : Clemens Thoma und Michael Wyschogrod, Hrsg., Parable and Story in Judaism and Christianity. New York : Paulist Press, 205 – 236. Efrat Gal-Ed : Spur und Differenz 47 – 1990 : » Hebraisms as Metaphor in Kadia Molodowsky ’ s Froyen-Lider, i. « In : Ellen Spolsky, Hg., The Uses of Adversity : Failure and Accomodation in Reader Response. Lewisburg : Bucknell University Press, 205 – 236. – 1999 : » Introduction « In : Dies., Hg., Paper Bridges : Selected Poems of Kadya Molodowsky. Detroit : Wayne State University Press, 17 – 60. Hoffman, Matthew, 2007 : From Rebel to Rabbi : Reclaiming Jesus and the Making of Modern Jewish Culture. Stanford : Stanford University Press. Keel, Otmar, 1986 : Das Hohelied. Zürich : Theologischer Verlag. Krinetzki, Leo, 1964 : Das Hohe Lied. Düsseldorf : Patmos-Verlag. Kugel, James, 1981 : The Idea of Biblical Poetry : Parallelism and Its History. Baltimore and London : The John Hopkins University Press. Lasker-Schüler, Else, 1977 : Sämtliche Gedichte. München : Kösel. Levinson, Joshua, 2005 : Ha-sippūr šě-lō ’ suppar: ’ ommānūt ha-sippūr hamiqrā ’ ī ha-murḥāv bě-midrěšēy ḥaza ” l. Jerusalem : The Hebrew University Magnes Press. Liptzin, Sol, 1979 : » Sulamith unallegorized. « In : Dōr lě-dōr, 8 ( 1 ) : 1 – 11. Maier, Johann, 2001 : Judentum von A bis Z : Glauben, Geschichte, Kultur. Freiburg u. a.: Herder Verlag. Manger, Itzik, 1929 : » Ershter briv tsu x. y. « In : Getseylte verter 1929 (1): 1 f. Molodowsky, Kadya, 1965 : Likht fun dornboym. Buenos Aires : Kiyem farlag. Moss, Kenneth, 2001 : » › Di Literarishe Monatsshriften ‹ and Its Critical Reception. « In : Jewish Social Studies 8 ( 1 ) : 153 – 198. Ohly, Friedrich, 1958 : Grundzüge einer Geschichte der Hoheliedauslegung des Abendlandes bis um 1200. Wiesbaden : Steiner. Ravitch, Melech, 1922 : » Di naye, di nakete dikhtung. « In : Albatros 2 : 15 f. – 1945 : Mayn leksikon, Bd. i. Montreal, 122 – 124. Sadan, Dov 1984 : » Pulmūs wě-šōvěrō. « In : Manger, Itzik, Medresh Itsik, Jerusalem : The Magnes Press. Scholem, Gershom, 1977 : Von der mystischen Gestalt der Gottheit. Frankfurt a. M.: Suhrkamp Verlag. Schöne, Albrecht, 1968 [ 1958 ] : Säkularisation als sprachbildende Kraft. 2. Aufl. Göttingen : Vandenhoeck & Ruprecht. Timm, Erika, 2005 : Historische jiddische Semantik. Tübingen : Niemeyer. Urbach, Ephraim E. 2002 : » Děrāšōt ḥaza” l ū-fērūšēy ’Origines lě-šīr hašīrīm wě-ha-wikkūaḥ ha-yěhūdī-nōẓěrī . « In Ders., Mē-‘ōlāmām šel ḥakhāmīm. Jerusalem : The Magnes Press, 514 – 536. ( Reprint des 1960 in Tarbiz 30 erschienenen Artikels ). yivo, Hg., 1931 : Di ershte yidishe shprakh-konferents. Wilna : Biblyotek fun yivo. Zakovitch, Yair, 2004 : Das Hohelied. Freiburg : Herder Verlag. Barbara Mann Of Madonnas and Magdalenes Reading Mary in Modernist Hebrew and Yiddish Women ’ s Poetry The human psyche is an awesome labyrinth. Thousands of beings dwell there. The inhabitants are the various facets of the individual ’ s present self on the one hand and fragments of his inherited self on the other.1 The inherited selves referred to by the writers of the ‫ אין זיך‬manifesto, a document describing both the general conditions of modernist poetry and the special circumstances of the Jewish poet, shaped the writing of lyric poetry and manifested themselves in various and often contradictory ways. These inherited selves refer to the cultural and historical touchstones which inform the poet ’ s artistic world ; the notion of fragments, of course, resonates strongly as a modernist trope, ĳiguring centrally in the closing of T. S. Eliot ’ s “ The Waste Land ” ( “ these fragments I shore against my ruins. ” ) Yet for the Jewish poet the notion of the fragment seems, in this instance at least, to a be a constitutional – rather than only a recuperative – act. That is, the essential gesture is one of production, of constituting the self in the present tense, out of various elements of one ’ s individual and collective past, and not an act of recovery per se, of reassembling some lost wholeness. The Yiddishist ’ s awesome labyrinth, then, more resembles the Freudian notion of the unconscious as an archaealogical site, which may be excavated in order to productively empower the self in the face of the present. This essay examines a speciĳic set of inherited selves in the work of Anna Margolin ( 1887 – 1952 ) and Leah Goldberg ( 1900 – 1970 ), contemporaries and key ĳigures in modern Yiddish and Hebrew poetry, respectively. I offer a comparative reading of work from their books ‫ ( לידער‬Poems, 1929 ) and ‫ ( טבעות עשן‬Smoke Rings, 1935 ), focusing on poems that incorporate female ĳigures connected to Christianity as a mode of poetic self-expression. The ĳigure of Jesus played an essential role for modernist Jewish artists – from the more well-known work of Marc Chagall to the ubiquitous ĳictional and poetic renderings of Jesus in both Hebrew and Yiddish writing.2 Indeed, what has been called “ the Jewish reclamation 1 2 Glatshteyn, Leyeles and Minkov 1986 : 775. See, for example, Stahl 2008. 50 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ of Jesus ” has surfaced in numerous circumstances.3 These modernists built on the groundwork laid by Moses Mendelsohn ’ s early invocation of Jesus as connected to Jewish teachings, as well as 19th-century distinctions between the historical Jesus, who was closely identiĳied as a Jew, and the theological Jesus, a Christian invention. However, in the poems by Goldberg and Margolin examined here, it is not Jesus who plays a leading role in the poetic rendering of the Christian-European landscape. Rather, this position is occupied, in polymorphous and evolving fashion, by the ĳigures of the Virgin Mary and Mary Magdalene. This variation on the Jesus theme may be understood not only as an exemplary instance of the modern Jewish ‘ reclamation ’ of Jesus, but also within the broader, emergent domain of women ’ s poetry in Hebrew and Yiddish.4 Looking at the Mary ĳigure in the work of two exemplary women poets, one of whom wrote in Hebrew and the other in Yiddish, offers an opportunity to explore how women poets negotiated the broader arena of Jewish literary production. It remains a matter of critical debate whether the same kind of “ politics of exclusion ” operated in the Yiddish sphere as has been located within Hebrew literary history.5 However, one may view the use of the ĳigure of Mary as a kind of symbolic intervention, denoting the presence of women poets within a maledominated ĳield, and within the normatively patriarchal parameters of traditional Jewish culture. The divergent poetic adoptions of Mary by Goldberg and Margolin may also be understood within modernism ’ s more general recovery of motifs from the classical world and the Judeo-Christian tradition.6 Indeed, we might compare this relatively infrequent turn to Mary to the more numerous references to biblical matriarchs such as Sarah or Rachel, or even to more ostensibly marginal ĳigures such as Hagar, Lot ’ s wife or Yiftach ’ s daughter. However, perhaps for obvious reasons, Mary is not as easily absorbed as a poetic 3 Hoffman 2007 : 1. 4 This essay therefore builds on the work of recent decades regarding the historical signiĳicance of modernist women ’ s poetry in Hebrew and Yiddish, as well as appreciations of individual poets and their work. See Hellerstein 1988a, Gluzman 1991, Miron 1991, Novershtern 1990 and 2008, Sokoloff, Lapidus Lerner and Norich 1992, Karton-Blum and Weissman 2000, Mann 2002, Zierler 2004, and Brenner 2010. 5 For arguments about women writers and Hebrew literary history see Miron 1991 and Gluzman 1991. For related discussions about Yiddish see Hellerstein 1988a and 1992 and Novershtern 2008. 6 Shocham 2000 provides a compelling account of the intertextual use of canonical or mythical women ĳigures in Leah Goldberg ’ s work, arguing that her poems critique the image of women in a patriarchal society from within, by building on and revising those very texts which have produced stereotypical images of women as weak or fragile. She also traces a delicate relation between the paradoxical fragility and strength of these ĳigures, and Goldberg ’ s own life and sense of self. Barbara Mann : Of Madonnas and Magdalenes 51 ĳigure as these more readily identiĳiable Jewish matriarchs. Indeed, the poems discussed below play upon the distinction between the historical ĳigure of Mary and her iconic depiction within the Church and its institutions. If Hebrew and Yiddish writing about Jesus often drew on the tropes of suffering, compassion and, especially, victimhood to characterize their visions of Christ, what parallel themes might these ( women ) writers have extracted from the life of Mary, and to what ends ? The experience of unrequited love as well as the dilemmas of sexuality and motherhood all appear in these poems, couched within a ĳigure called Mary and her iconic representation. The images of Mary point to large issues of cultural expression in both Goldberg ’ s and Margolin ’ s work, including the creation of a female poetic subject in modern Hebrew and Yiddish writing. Broadly speaking, I will argue that for Margolin, the Mary ĳigure seems connected to her idiosyncratic reading of Christianity ’ s penchant for “ the word as such, ” to the text as the forging link between the material conditions of the body and the transcendent claims of the spirit. For Goldberg, images of Mary refer to the poet ’ s cultural and psychological roots in the European landscape, and also – vicariously – to a devotional tradition suggesting a transcendent or sublime view of art. Hence, in Margolin ’ s work, we ĳind an imagining of a flesh-and-blood ĳigure named “ Marie, ” a Mary who speaks,7 while in Goldberg ’ s work, we ĳind iconic renderings or artistic representations of the Virgin Mary or Mary Magdalene, but not a flesh-and-blood Mary herself. The work of both poets may also be productively read within the tradition of the ‫תּחינות‬, Yiddish supplicatory prayers, spoken and even at times written by women, and addressed to the biblical matriarchs.8 While the connection between ‫ תּחינות‬and modern Yiddish poetic subjectivity has been compellingly drawn by Kathryn Hellerstein,9 the link between this pre-modern mode of female expression and modern Hebrew poetry remains to be explored. I am not concerned here with the question of influence per se between Goldberg and Margolin,10 nor do I assume a direct experience by these poets of the older literary forms of female self-expression. Rather I am 7 These poems have also been translated under the title “ Marie, ” and there is no critical consensus as to their engagement with Christian themes. I ’ve used “ Mary ” here to stress the thematics, but would also note the historically interchangeable quality of these names, especially in the Gospels. 8 See Weissler 1998. 9 See Hellerstein 1988 b. 10 That said, it doesn ’ t hurt to know that Margolin ’ s work was probably known in Tel Aviv during the 1930s : she herself had lived in Tel Aviv for a few years during her marriage to the writer Moshe Stavi / Stavski. We even have Reuven Ayzland ’ s record of a letter written to her by Ch. N. Bialik from the early 1930s, in response to his receiving her book. See discussion in Mann 2002. 52 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ interested in the broader domain of intertextuality within literary history, and also what Chana Kronfeld has called “ historical intertextual afĳiliations. ” Kronfeld uses the phrase to describe the afĳinity of Kafka ’ s work for intertextual models prevalent in early modern Hebrew and Yiddish literature. Similarly, by employing a more comparative, “ kaleidoscopic vision ” and imagining Goldberg ’ s and Margolin ’ s “ multiple literary afĳiliations, ” we gain a richer and more nuanced understanding of their work and its meaning for literary history.11 1. “ Being a Beggarwoman ” : Anna Margolin ’ s Mary The case of Anna Margolin is complicated. Her poetry was part of the enormous flowering of Yiddish verse in New York in the interwar period.12 In recent years she has come to serve, for better and for worse, as an exemplar of that perpetually productive but often fuzzily drawn category, “ woman ’ s writing, ” both for her work ’ s emotional power as well as for the often dramatic details of the life story in which it was embedded. Indeed, there is something about the work – despite its relatively meager size : just a single, slim volume – that demands attention. In part, there is the audacious opening lyric, which may or may not be a ‘ signature ’ poem ( see discussion below ). Beyond that, however, the dazzling range of the book ’ s stylistic achievements demands attention – is even hungry for it : is Margolin the Henry Roth of modern Yiddish poetry ? What does her subsequent treatment and reception tell us about the history of Yiddish poetry ? Of women ’ s writing ? Given the meager quantity of her work, and perhaps also because of what we know about the conditions of its production, we come up against an impasse of sorts that forces us to ask : what kind of circumstances lead to an “ Anna Margolin ” ? The ĳictiveness of the name only exacerbates the desire to know what historical and social conditions conspired to produce such work, both the poems themselves and their ongoing critical reception.13 For our purposes, we may note that Margolin was born in Brisk ( Brest-Litovsk ) and, like Goldberg, her family passed through Königsberg. Though not of the same socio-economic class, both girls were educated in secular, maskilic settings and afforded the opportunity to study Russian and, eventually, Hebrew. This cosmopolitan virtuosity is at the heart of Margolin ’ s verse. Her poem, ‫מאל‬ ָ ‫איך בין געווען ַא‬ ‫ “ ( ַא ייִ נגלינג‬I once was a youth ” ) opens her only published volume of poems, ‫ ( לידער‬New York, 1929 ) : 11 Kronfeld 1996 : 11 f. 12 For her stylistic afĳiliations with ‫ די יונגע‬and ‫אינזיכיסטן‬, see Novershtern 1990. 13 Novershtern 1991 provides essential archival material connected to Margolin, her work and her life. Barbara Mann : Of Madonnas and Magdalenes 53 ‫מאל ַא ייִ נגלינג‬ ָ ‫איך בין געווען ַא‬ ‫קראטן‬ ַ ‫סא‬ ָ ‫רטיקאס‬ ָ ‫פּא‬ ָ ‫געהערט אין‬ ,‫מײן ליבלינג‬ ַ ,‫פרײנד‬ ַ – ‫מײן בוזעם‬ ַ ‫האט‬ ָ ‫עס‬ .‫טארס אין ַאטען‬ ָ ‫געהאט דעם שענסטן‬ ַ I once was a youth, heard Socrates in the porticos, my bosom friend, my lover, in all Athens had the ĳinest torso.14 The poem contains some of the hallmarks of Margolin ’ s verse : a deliberate masking of the poetic self, in this case within a cross-gendered persona ; a focus on the aesthetic domain and the world of man-made objects ; a delight in unexpected rhymes, often drawing on Yiddish ’ s polyphonic resources as a fusion language ; and an iconoclastic but enduring relation to the realm of Jewish ritual and experience. The poem concludes with this multivalent ĳigure reveling in the late Roman empire, hearing rumors of Christianity ’ s impending rise : “ I heard the news/of the weakling from Nazareth / and wild stories about the Jews. ” From the margins, the poetic speaker marks his distance from Western culture ’ s historical foundations ( “ wild stories about the Jews ” ) as well as the equally preposterous ascension of Christ. The Judeo-Christian tradition is held, as it were, close, but at arm ’ s length, the better to both marvel over and critique it. Worship is a central theme in Margolin ’ s work. The imagery of private, often deĳiant worship in the face of an unresponsive divinity is threaded throughout her poems, and often coded in erotic terms. These scenes of worship combine elements of traditional Jewish life with a modernist sensitivity to the seductiveness and power of sculpted objects.15 The prose poem ‫ דו‬addressing a lover, offers a typically claustrophobic scene of love and devotion in a materially rich setting : 16 ‫דײנע אומע־‬ ַ ‫ אין‬.‫שטאט‬ ָ ‫באזיגטע‬ ַ ‫מײן‬ ַ ‫און ביסט‬ ‫האב איך ַאוועקגע־‬ ָ ‫טיקע וויסטע טעמפּלען‬ For you are my conquered city. In your sad and empty temples I placed my gods. .‫מײנע געטער‬ ַ ‫שטעלט‬ Within the seven poems of the Mary cycle we ĳind these realms – Jewish ritual, a modernist embrace of “ the thing itself ” and dramatic eroticism – embedded within another domain : Christianity and the ĳigure 14 Translations are taken from Margolin 2005, unless otherwise indicated ( here Margolin 2005 : 2 f ). Due to the relative accessability of the bilingual Kumove edition, I have used it as a reference for the poems. 15 Avrom Novershtern has written persuasively about the importance of statues and sculptural motifs in Margolin ’ s work ; the Mary poems both compliment and counter this essential trope. See Novershtern 1991 and Mann 2002. 16 Margolin 2005 : 30 f. 54 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ of the Virgin Mary. Unlike the poems by Goldberg, which, as we shall see below, unequivocally reference the historical and iconic depiction of the Virgin Mary, Margolin ’ s poems need not be read as directly referencing these themes.17 However, as a series, the Mary cycle seems to extract certain tropes of the historical depiction of Mary – her status as a mother, her humility, her appropriation by Church ideology – and combine them with a flesh-and-blood woman who exists within the social and material realia of the twentieth century. The ĳirst poem speaks directly to a ĳigure called Mary : ‫וואס ווילסטו‬ ָ ? ‫מארי‬ ַ ( “ What do you want, Mary ? ” ) presents a pair of stereotypically extreme choices in answer to its titular question : the presence of a child, marking the only bright spot in an otherwise loveless domestic life, or a dramatic, ecstatic union with the earth. Unlike the Goldberg poems below, this series does not seem to describe or evoke a speciĳic geographical or social setting ; rather, the constant trope is the ĳigure of Mary, who appears in almost Zelig-like fashion in a variety of scenes : alone in the desert, welcoming guests at a country wedding and ĳinally, approaching her death. ‫מארי וויל ַזײן ַא בעטלערין‬ ַ ( “ Mary wants to be a beggarwoman ” ) describes scenes of deliberate destitution and squandering of one ’ s riches, both material and emotional. I will focus here on two short poems – ‫ילה‬#‫מאריס תּ‬ ַ ( “ Mary ’ s prayer ” ) and ‫מארי און דער‬ ַ ‫ “ ( פּריסטער‬Mary and the priest ” ) – that offer a dense rendering of potential couplings, between Mary and a divine ĳigure, and Mary and a priest.18 .‫זײנען די וועגן‬ ַ ‫ הכננעהדיק און שטום‬,‫גאט‬ ָ ‫ון טרערן‬# ‫ון זינד און‬# ‫ײער‬# ַ ‫דורכן‬ .‫ירן צו דיר ַאלע וועגן‬# ‫ון ליבע געבויט דיר ַא נעסט‬# ‫האב‬ ָ ‫איך‬ .‫ון שטילקייט ַא טעמפּל‬# ‫און‬ ,‫ דינסט און געליבטע‬,‫דײן היטערין‬ ַ ‫איך בין‬ .‫מאל ניט געזען‬ ָ ‫האב איך קיין‬ ָ ‫דײן פּנים‬ ַ ‫און‬ God, meek and silent are the ways. Through the flames of sin and tears All roads lead to You. I built You a nest of love and from silence, a temple. I am Your guardian, servant and lover, yet I have never seen Your face. 17 We should critically consider the reluctance to reading Margolin ’ s Mary in this way. Perhaps Margolin herself resisted a more overt rendering of these themes ? Given her love of “ mash-up ” rhymes that motivate assonant chunks to denote cultural hybridity, may we also read the Mary poems as referring to some abbreviated, “ essential ” version of Margolin ? On the meaning of Margolin ’ s rhyme see Mann 2002. 18 Margolin 2005 : 188 f. Barbara Mann : Of Madonnas and Magdalenes 55 ,‫ון דער וועלט‬# ‫ראנד‬ ַ ‫ן‬#‫און איך ליג אוי‬ ,‫ון טויט‬# ‫ינסטער דורך מיר ווי די שעה‬# ‫און דו גייסט‬ .‫גייסט ווי ַא ברייטע בליצנדיקע שווערד‬ I lie at the edge of the world, while You pass through me darkly like the hour of death, You pass like a broad, flashing sword. The poem opens with a direct address to God and describes possible approaches to him – mute and silent, through sin and tears. The poem ’ s middle two couplets depict a more familiar relation between God and Mary, detailing what she has done to deserve his attention : the intimacy of the nest complimenting the rapt silence of the temple. Sacred space is often a supremely private affair in Margolin ’ s work, where devotion takes place within a congregation of two. The speaker ’ s relation to God is both normative – she is his servant – and unusual – she has protected him and been his lover. In none of these roles has she seen his face, an allusion to the biblical Moses, which further elevates the speaker ’ s status : this is no ordinary woman, and her relation to her God is commensurately privileged. The sudden shift in perspective in the poem ’ s ĳinal stanza – from the near-intimacy of the frustrated gaze to some distant spot at the world ’ s edge – is an attempt to describe a relation to a distant God, representing the Law and the Text, within a normatively patriarchal tradition where the female form is often ĳigured as a passive receptacle.19 In an article on the feminist politics of translation, Kathryn Hellerstein reads the poem ’ s conclusion as an attempt to imagine Mary ’ s psychological and emotional state as she encounters the divine. For Hellerstein, “ [ t ]he last stanza [ … ] describes the moment of divine conception – a moment thoroughly foreign to a Jewish sensibility, yet presented in these Yiddish lines in the most intimate of terms. ” 20 Hellerstein ’ s reading hinges on the term ‫ ( היטערין‬translated here as ‘ servant ’ ), a term she links with Yiddish liturgical practice. Indeed, the liturgical model standing in some fashion behind all Yiddish poetry by women, especially a poem framed as a prayer, is the ‫תּחינה‬, or prayer of supplication, a ĳirst-person singular petition of the biblical matriarchs for their blessing or aid with some instance of personal difĳiculty. The model of prayer suggests a speciĳic subject-object relation between God and the speaker, where the agency of the latter is predicated on the presence of the former. Margolin ’ s poems put pressure on this relationship, re-en19 The poem ’ s closing spatial image calls to mind the idea of “ circumference, ” an important term for Emily Dickinson, also used to signal a woman poet ’ s encounter with the divine and its limits within Western tradition. 20 See Hellerstein 2000. 56 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ visioning it to suggest a kind of divine power for the poet, who creates within the charged, yet ultimately secular, domain of the lyric. In the following poem in the series, ‫מארי און דער פּריסטער‬ ַ , Mary is ĳigured as the object through which the devotional act transpires : 21 ,‫ערווײן‬#‫פּ‬ ַ ‫ ביסט ַא בעכער מיט ָא‬,‫מארי‬ ַ ‫ווײן‬ ַ ‫אררונדיקטער בעכער מיט‬# ַ ‫צארט‬ ַ ‫ַא‬ .‫רווײסטן מזבח‬ ַ ‫א‬# ַ ‫אויף ַא‬ ‫ַא פּריסטער‬ ‫נגזאמע הענט‬ ַ ‫לא‬ ַ ‫שלאנקע‬ ַ ‫מיט‬ .‫קרישטאלענעם בעכער‬ ָ ‫הייבט אויף הויך דעם‬ ‫דײן לעבן און ברענט‬ ַ ‫און עס ציטערט‬ ‫זײנע הענט‬ ַ ‫ אין‬,‫זײנע אויגן‬ ַ ‫אין‬ ‫עקסטאטישן און שווערן‬ ַ ‫און וויל אין גליק‬ .‫צעשמעטערט ווערן‬ Mary, you are a goblet of the wine offering, a delicately rounded goblet of wine on a sacriĳicial altar. A priest with delicate, cautious hands, raises the crystal goblet high. Your life trembles and burns in his eyes, his hands, and wants to be crushed in profound ecstatic joy. Here the priest and Mary-the-goblet are lovers, whose mutual devotion potentially leads to Mary ’ s annihilation, just as the divine union augured the “ hour of death ” of ‫ילה‬#‫מאריס תּ‬ ַ . In a typically Margolian riff, the poem stresses the overlap of ostensibly competing religious traditions through its juxtaposition of Hebraic terms such as ‫ מזבח‬with the Germanic ‫פּריסטער‬. An even more ancient tradition is referenced in the poem ’ s concluding allusion to “ forgotten gods. ” The vitality of these ‫ארגעסענע געטער‬# ַ endures even as the Judeo-Christian ethic is forged. In both poems, the liturgical setting offers an opportunity to explore the freedom of the creative act, which is itself potentially self-destructive. The ĳigure of the sword in ‫ילה‬#‫מאריס תּ‬ ַ , both phallic and pen-like, appears in two other places in Margolin ’ s work. A brief discussion of these other references will shed light on the complex subject-object relations of the Mary series. The sequence ‫דײן שווערד‬ ַ ‫דײן רו און איך‬ ַ ‫ “ ( איך‬I your rest and I your sword ” ) details an often-stormy erotic relationship. The speaker looks down upon her sleeping lover, and offers an incantation : 22 ....‫ דרימל‬,‫ געליבטער‬,‫אײן‬ ַ ‫דרימל‬ .‫דײן שווערד‬ ַ ‫דײן רו און איך‬ ַ ‫איך‬ .‫וואך איצט איבער ערד און הימל‬ ַ ,‫יעדער שטערן שטוינט און הערט‬ .‫דײן דרימל‬ ַ ‫ליסטער אין‬# ‫וואס איך‬ ָ Drowse on, my beloved, drowse on…. I your peace and I your sword now watch over heaven and earth. Every star in amazement hears what I whisper in your sleep. 21 Margolin 2005 : 190 f. I have modiĳied the ĳirst line of the translation. 22 Ibid. : 35 f. Barbara Mann : Of Madonnas and Magdalenes 57 The speaker becomes the sword itself, poised from a heavenly perspective, the poem ’ s rhythm swelling like a powerful chant, whispered by the speaker who is both guard and lover. Signiĳicantly, the speaker is God-like and sword-like, no longer the passive object of another ’ s actions. The connection between this ĳigure of the sword and poetry is made more explicit in ‫ “ ( בלויז איין ליד‬Just one poem ” ), in which the progressive shaping and slicing of rhyme in the poem lead to the production of “ just one poem,” whose violent force resembles that of the divine, impregnating spirit at the end of ‫ילה‬#‫מאריס תּ‬ ַ . 23 — ‫האב בלויז איין ליד‬ ָ ‫איך‬ .‫שטאלץ‬ ָ ‫ון ייִ אוש און‬# ‫עס טונקלט און גליט‬ . . . .‫שטאל‬ ָ ‫בראנדז און‬ ָ ‫אין‬ ‫ווארט‬ ָ ‫דאס‬ ָ ‫ורעם‬# ‫איך‬ .‫מײן לעצטן ָאטעם‬ ַ ‫מיט‬ ,‫מיט זכרונות שווער‬ ‫ווידער און ווידער‬ ‫גיי איך ווי ַא שווערד‬ .‫דורך די לידער‬ I have but one poem – of despair and pride. It darkens and glows in bronze and steel…. I shape the word with my last breath. Again and again, with heavy memories, I go through the poems like a sword. Both of these short poems reverse the foundational subject-object relations of ‫ילה‬#‫מאריס תּ‬ ַ : instead of being the object of the sword ’ s ( or God ’ s ) actions, it is the poet herself who moves like a sword through her poems. Artistic creation and procreation are fused in these poems, with the poet assuming near-divine control ; poetry is the space in which this transĳiguration of spirit and body is possible – where the word, shaped by the breath, becomes an object, where the crude chord ( the poem ) becomes the sword, wielded by the poet. 2. “ Madonnas at the Crossroads ” : Leah Goldberg ’ s Native Landscape The elevation of “ forgotten gods ” points to Margolin ’ s general engagement with multiple cultural afĳiliations, spanning the European continent and the historical development of its cultural underpinnings. With this ĳigure of cultural complexity in mind, we may begin to approach 23 Margolin 2005 : 174 f. 58 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ the poems from Leah Goldberg ’ s ĳirst book, ‫ ( טבעות עשן‬Smoke Rings ), published in Tel Aviv in 1935, the same year the poet immigrated to Palestine. Goldberg was a leading ĳigure of the moderns, the ĳirst wave of Hebrew modernist poetry in Palestine, and also a proliĳic translator from Russian, German, French and Italian ; in addition to nine volumes of poetry, she published several novels, a number of plays, volumes of literary scholarship, journalistic essays and a series of classic books for children. The poems considered here largely depict the impoverished Lithuanian landscape of Eastern European Orthodoxy.24 Throughout, the poems draw on diverse bits of the New Testament related to female ĳigures, and we may track the evolution of these references to Mary and Mary Magdalene, to wooden madonnas, and ĳinally to nuns and a version of the poet herself in a sacriĳicial setting. The speaker in these poems is both drawn to and repelled by these ĳigures, using them to distinguish herself as a kind of local stranger, an ambivalence captured in Goldberg ’ s description of Lithuania as “ that abandoned homeland which does not mourn for me. ” 25 The poems represent an attempt to inhabit the world of the other, and to appropriate it for aesthetic purposes ; in this case, a twenty-something Jewish woman poet, whose ĳirst languages were Russian, then German, then Lithuanian, chooses to write in Hebrew from the relative center of European culture, and adopts Christianity – as funneled through its iconic female ĳigures – in order to become a poet. The ĳirst poem, “ Pietà, ” draws on two familiar cultural motifs : the Pietà, an artistic depiction, often in sculptural form, of the Virgin Mary cradling Christ ’ s dead body ; and the idea of autumn as a season of transition and paradox, marked by both abundance ( the harvest ) and decay ( the approach of winter ).26 ‫ַם ַשׁ ֶלּ ֶכת‬+ ...‫כים‬ִ ‫שׁוּב ְּד‬ .‫עי ָה ֲא ָד ָמה‬4 ֵ ‫ַעל ִפּ‬ ‫רוּמה ִנ ְמ ֶשׁ ֶכת‬ ָ ‫ילן ְגּ‬ ָ ‫יַ ד ִא‬ .‫סּוּמא‬ ָ ‫ֶאל ַה ַשּׁ ַחק ַה‬ ‫דּוֹמ ַעת‬ ַ ‫תּוּגת ָמרוֹם‬ ַ ‫שׁוּב‬ .‫ַעל ְגּוִ יַּ ת ַא ְד ַמת ַה ְסּ ָתו‬ ‫כּוֹר ַעת‬ ַ ‫דוֹנה ַה‬ ָ ‫ְכּ ָמ‬ .‫לב‬4 ָ ‫ַעל גּוּפוֹ ֶשׁל ַה ְנּ‬ Once again paths… the autumn ’ s blood On the earth ’ s wounds. A boney pine branch [ hand ] stretches Toward the blind sky. Once again the weeping sadness of heaven over the corpse of the autumn earth. Like a Madonna kneeling Over the body of the cruciĳied. 24 See Hirshfeld 2000 and Ticotsky 2006. 25 Goldberg 2007 : 12. 26 Goldberg 1986 ( i ) : 38. Barbara Mann : Of Madonnas and Magdalenes 59 ,‫לוֹחשׁ ַהיַּ ַער‬ ֵ - Pietà ,‫עוֹנה ַה ְסּ ָתו‬ ֶ - Pietà ‫פּוֹת ַחת ַשׁ ַער‬ ַ ‫וְּמ ָמה‬ ָ ‫ֶאל ַשׁ@וַ ת ַמ@כוּת ָה ָאב‬ Pietà – whispers the forest. Pietà – answers the autumn. And silence opens a gate To the calm of the Father ’ s Kingdom. - ‫רוּח ִמ ְתיַ ֵפּ ַח‬ ַ ‫ַרק ָה‬ ,‫בּוֹכה ַעל ֵח ְטא‬ ֶ ‫ה‬B‫יְ הוּ‬ ‫ֵע‬ ַ ‫ְמ ַנ ֵשּׁק ַר ְג ֵלי ָה‬ .‫יחת ַה ֵמּת‬ ַ ‫ְל ַב ֵקּשׁ ְס ִל‬ Only the wind howls – Judas weeping for his sin, Kissing the feet of his friend, Asking forgiveness from the dead. The measured trochaic rhythms and regular repeating rhyme scheme locate the poem within a European tradition of autumnal verse addressing the paradoxical beauty of a vibrant, yet decaying, landscape. Goldberg ’ s poem presents Mary in doubly-ĳigurative fashion : on one level, Mary is depicted in the Pietà, an iconic rendering of her care for Christ ; on a second level, the Pietà itself serves as an image for the autumn landscape. The substance of seasonal change is rendered in martyrological terms : the fall foliage ’ s sacriĳice is mourned by the heavens, whose “ weeping ” suggests the movement of rain and wind. The forest and the autumn collude in the poem ’ s brief, enigmatic dialogue in the ĳirst two lines of stanza 3, preĳiguring a silence – děmāmāh – that is itself a condition for opening the gates of the “ Father ’ s kingdom. ” We may understand this proactive meeting between silence ( here rendered as “ děmāmāh, ” grammatically gendered feminine in Hebrew, and also approximate to “ stillness ” ) and the masculine domain in semiotic terms, a female rendering of voice countering the masculine realm of the written Word, the Law. As in Margolin ’ s work, this valorization of muteness ( děmāmāh in Hebrew or shtumkayt in Yiddish ), evokes a special form of agency, and a poetics that connects their verse to the creation of a neo-romantic voice. For both Goldberg and Margolin, I would argue, the idea of silence as a potentially empowering state poses an essential question : what kind of voice can a woman poet create within a patriarchal tradition, especially within the fraught and gendered realm of Hebrew and Yiddish writing ? 27 In the ĳinal stanza, against the Pietà ’ s traditional silence there emerges the voice of a Jewish presence in the land – Judah weeping for his sin – a presence both meteorological and metaphorical – “ wandering ” like a wind, seeking redemption and forgiveness. The main formal device indicating an intimate connection between the season of both life and death, and the Christian narrative of resur27 See Mann 2002 : 517. 60 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ rection, is the repeated rhyme of sětāv and ẓělāv ( autumn and cross ), in this poem and in the poem immediately following, “ Madonnas at the Crossroads ” ( ‫) ָמדוֹנוֹת ַעל ָּפ ָר ַשׁת ְּד ָר ִכים‬. Whereas in “ Pietà, ” Mary is imagined at a remove – both in the iconic image of the Pietà, and as a metaphor for the landscape – this distance is diminished in “ Madonnas at the Crossroads, ” 28 as the ĳirst-person speaker expressly compares herself, forsaken in love, to a group of wooden icons at a frozen crossroad : ‫@חכּוֹת ַל ָשּׁוְ א‬ ַ ‫ֲא ִני ִה ְס ַכּ ְנ ִתּי‬ .‫כים‬-ֹ ִ ‫זְ כֹּר יָ ִמים ְמב‬G ‫י יָ גוֹן‬G‫וּב‬ ְ ‫כים‬ִ ‫שׁת ְּד‬ַ ‫ָמדוֹנוֹת ֵעץ ַעל ָּפ‬ .‫ֶרח אוֹר ַה ְּס ָתו‬ ַ ‫מוֹני ְּב‬ ִ ‫ווֹת ָכּ‬I‫ְשׁ‬ ‫דוֹממוֹת‬ ְ ְ‫ָמדוֹנוֹת ֵעץ ָבּלוֹת ו‬ ,‫ת ִחיָּ ה‬G ְ ‫א יָ קוּם עוֹד‬J ‫ הוּא‬: ‫יוְֹעוֹת‬ ‫דוּמיָּ ה‬ ִ ‫א יָ בוֹא ִל ְמחוֹת ִדּ ְמ ָעה ְּב‬J ‫הוּא‬ .‫שׁוֹממוֹת‬+ ֵ ‫ַעל ֵאם ְּד ָר ִכים ְפוּאוֹת‬ ,‫יו‬M‫@נ ֵשּׁק ֲהדוֹם ַר ְג‬ ַ ‫ינה‬ ָ ‫ֵהן לֹא ִתזְ ֶכּ‬ ? ‫ַה ֵהן ָשׁ ְמעוּ ֶאת ְצחוֹק ַהיֶּ ֶלד ִמ ַנּ ֶּצ ֶרת‬ ‫ב‬M‫וּמה ַגם ִאם ָראוּהוּ ַעל ַה ְּצ‬ ַ ? ‫ְאוּ ֶאת ְשׁ ָמהּ ֶשׁל ָה ַא ֶח ֶרת‬P ‫על ְשׂ ָפ ָתיו‬+ ַ ‫כים‬-ֹ ִ ‫זוֹכרוֹת יָ מיִ ם ְמב‬ ְ ‫ַאְ ֵהן‬ - ‫@צ ִפּיַּ ת ַה ָשּׁוְ א‬ ִ ‫וּמ ְס ִכּינוֹת‬ ַ ‫כים‬ִ ‫שׁת ְּד‬ַ ‫ ַעל ָפּ‬: ‫מוֹהן ֲא ִני‬ ֶ ‫ְּכ‬ .‫ח אוֹר ַה ְסּ ָתו‬Sֶ‫שׁוְֹטה ְּב‬ ָ ‫כֹה‬+ ‫ה‬-P I became accustomed to waiting in vain, And to remembering, without agony, blessed days. Wooden madonnas at the crossroads Are calm like me in the ice of autumn light. Worn and silent wooden madonnas Know : he will not rise and come to life, He won ’ t come to wipe away a tear in silence at the frozen wasted crossroads. They won ’ t get to kiss the blood on his feet, Did they hear the laughter of the boy from Nazareth ? And what if they saw him on the cross And on his lips they read another woman ’ s name ? But they remember blessed days And are accustomed to vain expectation – So too am I : at the crossroads Cold and so quiet in the ice of autumn light. The poem ’ s lonely congregation waits in vain, one for her beloved, the others for the resurrection. Their distance from redemption – they will neither kiss the blood on Christ ’ s feet nor hear his laughter – is absolute, and their devotion is further undercut at the end of the third stanza by the fact that he spoke the name of another woman : šěmāh šel hā-aḥeret. This line seems to draw on diverse accounts from the New Testament : the naming of “ hā-aḥeret ” could refer to the report of Christ speaking the name of Mary Magdalene after his resurrection, an act that surprised his disciples. According to the diverse accounts of the Gospels, Mary Magdalene was the ĳirst witness to Christ ’ s resurrection. Luke also mentions “ the other Mary ” who was present with Mary 28 Goldberg 1986 ( i ) : 39. Barbara Mann : Of Madonnas and Magdalenes 61 Magdalene at the resurrection, a reference to one of Lazarus ’ s sisters, also called Mary. In the Gospel of John, this Mary is referred to by the Greek “ Mariam, ” which is a translation used in the Septuagint of the Hebrew Miriam, Moses ’ s sister ; some scholars have noted the prophetic or visionary qualities shared by these two ĳigures.29 Goldberg seems less interested in the potential overlap between Judaic and Christian sources and more drawn to the mutability of Mary herself, her ability to be both passive and active, both silent and voiced. The working through of the multiple Marys engenders both empathy and an awareness of difference. “ Peasant Woman Praying ” ( ‫ ) ִא ָכּ ִרית ִמ ְת ַפּ ֶלּ ֶלת‬30 also offers a pastoral scene involving a woman praying to a divine female presence. ,‫ֻמּר‬ ָ ‫ח ְמ‬U‫עוֹנין ַעל ֵמ‬ ִ ‫ִמ ְט ַפּ ַחת ־ ִצ ְב‬ .‫אחז ַבּ ֶטּ ֶנא‬ ַ ֹ‫ ַכּ ָפּהּ ּת‬,‫ְח ָבה‬ ָ ‫יַ ד‬ ,‫ה ְשׂ ָפ ַתיִ ם ַו ָעמֹק וָ ָמר‬Xְ‫ִבּ‬ .‫ל ָנה‬B ֶ ‫ַמ ָבּט ֻמ ְשׁ ָפּל מוּל ֶפּ ֶסל ַמ ְגּ‬ ‫וּמ ֻנ ָמּר‬ ְ ‫מוּל ֶפּ ֶסל ֵעץ ָבּ ֶלה‬ : ‫ ִע ֶקּ ֶשׁת‬,‫ה‬B‫ ְּכ ֵב‬,‫ה‬-Zְ ‫ְתּ ִפ ָלּה‬ ‫וֹני ַה ַפּ ַעם יְ ֻכ ַפּר‬ ִ ‫” ִאם ֲע‬ — — . . .“ ‫ַד ֶשת‬ ֶּ ‫וּמ‬ ְ ‫ְדוֹשׁה‬ ָ ,ְ‫ְּכזֶ ה ֶשׁ ָלּ‬ ‫[חפוֹת‬ ֵ ‫ַאְ ְּב ַשׁ@וַ ת ַר ְג\יִ ם‬ .‫קוּמה ָלהּ‬ ָ ‫ִבּ ְטחוֹן ְתּ ִמימוּת ־ ַה ֵח ְטא ֶשׁ ֵאין ְתּ‬ ‫ ִמ ֶפּ ַשׁע ֵהן ַחפּוֹת‬: ‫מוּבן‬ ָ ‫כֹה‬+ ‫ְכּ ֵאלּוּ ַה ָּקמוֹת ַה ֲחשׂוּפוֹת‬ — ‫צוֹחק ָל ֶהן ִמ ְל ָמ ְע ָלה‬ ֵ ‫ֶשׁ ַשּׁ ַחק ַר‬ Colorful kerchief on wrinkled forehead, Broad hand, palm grasping a basket. A deep bitter line at lips ’ edge, Downcast gaze facing a statue of Mary Magdalene. Facing a worn and stained wooden statue A brief, heavy, stubborn prayer : “ If my sin is forgiven this time this will be yours, blessed and blessing one. ” But in the barefoot calm, a certainty of the sin ’ s naivete, which cannot be redeemed. And so very clear : they are innocent of sin Like the grain exposed To cold heaven ’ s laughter from above. Mary ’ s ĳigurative nature is complicated by actual speech : a peasant woman makes an offering to an icon of Mary Magdalene, thus transforming the name of the ‫ “ – אחרת‬the other woman ” – into a statue. Magdalene ’ s reputation as a penitent sinner makes her a logical site for the women ’ s confession. In the ĳinal line, the cold heavens merely laugh in response to her plea ; the efĳicacy of prayer, the whole idea of faith, is mocked, even upended. Yet there is something solid and invi29 There is thus some tension in Goldberg ’ s poems between the relatively proactive stance accorded to both Miriam in the Hebrew Bible and Mary Magdalene in the New Testament – who are characterized by their “ going out ” – and the prolonged and passive waiting of both speaker and icons in this poem. See Meyers 2005. 30 Goldberg 1986 ( i ) : 40. 62 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ ting about the landscape of peasant observance, a process tied to the seasons, and to a familiar landmark that has witnessed time ’ s passage. Moreover, though the poem concludes by dismissing the devotional act, the woman herself seems transformed and comforted. The “ bitter ” set of her lips, her downcast face and mumbled words of prayer are lightened by the poem ’ s end ; she may be barefoot, but she is also “ at peace. ” While the speaker distances herself from what is perceived as a blind or ignorant act of faith, there is also a grudging recognition of the ease with which the woman seems relieved of the burden of her sin. The cruelty of the poem ’ s ĳinal line recalls the impenetrability of the “ Father ’ s kingdom ” in “ Pietà ” but only from the point of view of the speaker, who stands outside the devotional act, with some amount of envy. Yes, the speaker may admire these icons, but she has no access to their comfort or power. We have followed these poems as they grapple with the ĳigure of Mary in all her diverse emanations, from a muted, metaphorical rendering in “ Pietà, ” to wooden icons of Mary, to actual prayer by an individual woman facing a statue of Mary Magdalene. These ĳigurations evolve one more time in the startling reversal ‫ ( ֲחלוֹם ַנ ֲע ַרה‬A young girl ’ s dream ),31 where the speaker imagines herself as Jesus, being served by Mary Magdalene. The gender reversal in “ A Young Girl ’ s Dream ” resembles Margolin ’ s audacious impersonation of a young Greek hedonist, whose time traveling ends at the margins of approaching Christendom. In both poems we ĳind an attempt to poetically inhabit the world of the other, to appropriate it for one ’ s own aesthetic purposes. ‫ֲחלוֹם ַנ ֲע ַרה‬ ‫ תמונה מאת קרלו ְקִי]לי‬- “ ‫” מגדלנה הקדושה‬ ‫ בברלין‬Kaiser Friedrich Museum ‫נמצאת ב ־‬ ,‫ ַא ָתּה‬- ‫\מ ִתּי ֶשׁ ֲא ִני‬ ְ ‫ֲא ִני ָח‬ ‫י‬G]‫_נה ֶשׁל ְקִי‬ ָ ‫וּמ ְג ָדּ‬ ַ ְ ַ‫ ז‬,‫רוֹת ַח‬ ֵ ‫ישה ַמ ְשֶׁה‬ ָ ‫י ַמ ִגּ‬G ,‫יע ־ ְבּד ַֹלח ְמ ֻצ ֶפּה זָ ָהב‬ ַ ‫ִבּ ְג ִב‬ — ְ‫@תּ ָלּהּ — ָנ ָחשׁ ִנ ְפ ַתּל וָ ַר‬ ַ ‫ת‬+ ַ ,‫_חיִ י‬ ְ ‫נוֹג ַע ְבּ‬ ֵ ,‫ִמ ֵדּי ָע ְב ָרהּ‬ .‫יח ֻט ֶּברוֹזָ ה‬ ַ ‫גּוּפי ִשׁכּוֹר ֵמ ֵר‬ ִ ‫כל‬+ ָ 31 Ibid. : 71. A Young Girl ’ s Dream “ Holy Madgalena ” – painting by Carlo Crivelli found in the Kaiser Friedrich Museum in Berlin I dreamed that I was – you, And Crivelli ’ s Magdalene served me a boiling-hot drink, pure In a gold-crusted crystal goblet, And her curls – a spiraling soft snake On each side – touch my cheeks, And my whole body is drunk with the scent of tuberoses. Barbara Mann : Of Madonnas and Magdalenes 63 .‫ ַא ָתּה‬- ‫ֲא ִני ָח ַל ְמ ִתּי ֶשׁ ֲא ִני‬ ‫ה ִחוֶּ ֶת‬-‫ְצוּפהּ ֶשׁל ַנ ֲע‬ ָ ‫וּפ‬ ַ ‫מים‬M‫@עוֹ‬ ִ ‫רוֹני‬ ִ ‫ִנ ְמ ָחה ִמּזִ ְכ‬ .‫@מ ְג ָדּ ֶל ָנה‬ ַ ‫מא‬Z ֵ ‫אנ ִֹכי‬+ ָ ,‫עת ־ ֲחלוֹם‬+ ַ ַ‫א ִמתּוְֹ ז‬Z‫א ָהיָ ה מוֹ‬J+ .‫_נה‬B ָ ‫ט ִמ ַמּ ְגּ‬M‫א ָהיָ ה ִמ ְפ‬J+ I dreamed that I was – you. And the face of a pale young girl Was forever wiped from my memory And I am thirsty for Magdalena. And there was no way out of the dream ’ s terror, And no escaping Magdalena. The poem marks a distinct thematic and formal departure : the setting has moved indoors, away from the pastoral landscape and into an interior space of contemplation ; furthermore, it is ekphrastic ; that is, it describes a painting, not an actual scene, though given the epigraph, we may imagine the speaker standing in front of this particular painting in a speciĳic location : the Italian Renaissance channeled through a museum in Berlin. The Hebrew term used is “ magdālenāh ” and not “ mariāh ha-migdālīt, ” the proper form of reference to the historical ĳigure. But this is precisely the point : Goldberg is less interested in the historical ĳigure, and more in her artistic representation as a Christian icon. The speaker ’ s thirst for the Magdalene destroys the memory of all else, including the “ other woman, ” “ hā-aḥeret, ” in this case the ĳigure of a pale young girl. “ No escaping Magdalena ” points to a kind of erotic servitude, a cyclical condition of waiting and substitution that characterizes the volume ’ s poems of frustrated love. Critics have largely viewed the Christian imagery of Goldberg ’ s early poems as a kind of immature and unripe stage ( ‫ – ) בסר‬what Dan Miron has called her “ diasporic modernism ” 32 – something the poet needed to get out of her system before addressing the proper Hebrew literary business of the day – that is, the national and social imperatives of the Zionist movement. Some have suggested that Goldberg ’ s depictions of women praying to statues, especially matriarchal ĳigures, are foreign to Jewish tradition.33 However, if we think about these poems within the context of Yiddish poetry and the ‫תּחינות‬, their scenes of female devotion do not seem so unusual. A female address to the matriarchs, especially in times of trouble, was a model for female liturgical experience in traditional Jewish life. Furthermore, the Madonna ’ s grief and joy are references to life-events that are key features of the ‫תּחינות‬. Finally, we should note that the idea of women treasuring idols, to the point of theft, in fact has a solid biblical precedent. The image of Rachel stealing the idols constitutes the metaphorical core of Wendy Zierler ’ s recent study of the emergence of modern Hebrew women ’ s writing, 32 Miron 1999 : 330. 33 Ibid. : 350. See also Karton-Blum 2006. 64 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ in which she argues that women writers refashioned the language of men to create their own distinct literary tradition.34 Goldberg ’ s country scenes of a female speaker worshiping a female aspect or incarnation of the divine is just such a scene ; her poems domesticate the sacred, rooting the divine in a speciĳic location – this is what idols generally do. In fact, modern Hebrew poetry also had its own internal example of a female address to a female deity – Saul Tchernichovki ’ s ‫עשתרתי‬ ‫ “ ( לי‬My Astarte ” ). Tchernichovski ’ s poem impersonates a female voice addressing a religious amulet, which itself represents a deity who is adamantly part of the pagan world. The most well-known modern Hebrew example of this general scene of addressing a statue may also be found in Tchernichovski ’ s work : ‫ “ ( לנוכח פסל אפולו‬Facing a statue of Apollo, ” 1899 ), where the poet declares an ambivalent aesthetic loyalty to Hellenic culture. That poem too reverberates within this later, different scene of worship : instead of lěnōkhaḥ pesel apōlō, mūl pesel magdalenāh. This connection becomes more easily apparent with the mediating example of Yiddish and the ‫תּחינות‬. Of course, it ’ s true that ‫תּחינות‬, or any kind of prayer, do not invoke actual statues ; but viewed as a model for modernist poetry, liturgical texts may evoke – in much the same way that Margolin viewed her poems, divinely shaped by her breath, as objects – with all the attendant seductiveness of other spiritual traditions, with their relative openness to icons and idols. Among modernist Hebrew poets, Goldberg ’ s work does not display an easily readable connection to Yiddish writing and culture ; and this essay does not wish to claim her as a kind of ‘ covert ’ Yiddishist. Her translations from the Yiddish were far fewer, for example, than those of her contemporary Avraham Shlonsky. Yet we do ĳind, in a late autobiographical statement by the poet, an enigmatic reference to her father as a “ Yiddishist, ” a term which perhaps had more of a political than a cultural connotation for the poet in this context.35 Furthermore, the Christian motifs in her early work, and their particular connection to Italian Renaissance painting, represented a spiritual example for the poet, a religious experience which was not a part of her early family life or childhood world. Goldberg ’ s poems do not highlight the foreign quality of the Christian Mary in order to shore up her own Jewishness ; if anything the poems seem to want to make her more familiar, to appropriate her in order to motivate a poetic utterance. It is not the strangeness of Mary that appeals, but her grudging proximity, her like34 Zierler 2004. 35 .‫ אבל לשון הדיבור בבית היתה רוסית‬,‫ אבי היה יידישסטאן לגבי השקפותיו‬Goldberg 2007 b. The document, dated 13th December 1968, was discovered in the Goldberg archives by Gideon Ticotsky. Barbara Mann : Of Madonnas and Magdalenes 65 ness to the poetic speaker and her situation, a strategy similar to that found generally in modernist Hebrew and Yiddish writing about Christian motifs. The proximity between the poetic speaker and Mary exists in situational terms that are emotional and affective, as well as, broadly speaking, cultural. Ariel Hirshfeld has argued that the early massive appeal of Goldberg ’ s poetry was due to the fact that it both recorded the psychic break engendered by leaving Europe and its landscapes behind, and intimated the approaching physical destruction of these landscapes.36 Indeed, the images of Mary in Goldberg ’ s poems are ultimately connected to the idea of home, both actually and mentally. Yet this ‘ home ’ is certainly not the social demography of the shtetl but perhaps that very same landscape, with few recognizably Jewish attributes. The native landscape is dotted with multiple Marys, who were all, historically speaking, Jewish. We also ĳind an expressly gentile ĳigure – the praying peasant, who turns out, through the mediating example of the tkhine, to resemble Jewish women, at least in some respects. 3. Hebrew and Yiddish Women Poets – A Room of Their Own ? This essay addresses the broad domain of Hebrew-Yiddish literary relations, and begins to consider the implications of thinking critically and comparatively about women poets within this wider sphere.37 I have already written about the possibility of a more “ visual ” poetics on the part of Hebrew and Yiddish women poets, given the less traditional cultural baggage brought by women poets to the production of a secular literary genre in languages linked to sacred texts.38 Here I have explored diverse renderings of a central ĳigure from the Western imagination, one which seems to have struck the fancy of two Jewish women writers living, liminally, at its center, in more or less the same cultural moment. “ Mary ” matters massively, of course, in narratives about Christian origins ; yet her meaning differs substantively from that of Jesus, who, as noted above, often appeared in Hebrew and Yiddish writing by male authors. Mary is both a creative agent of her own fate and a passive receptacle of God ’ s will, the dual quality of which we have noted in poems by both Margolin and Goldberg. Perhaps this ambiguity suited the aesthetic needs of these women poets operating within normatively patriarchal literary systems. 36 Hirshfeld 2000 : 137. 37 See Kronfeld 1996, Brenner 2010 and Schachter 2011. 38 Mann 2004. 66 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ An example from another tradition in which religious imagery ĳigures heavily offers an enlightening context for our purposes. Cynthia Scheinberg explores how Victorian Jewish women poets such as Amy Levy utilized religious tropes to critique literary norms governed by a Christian belief system. Their poems represented, in essence, an intervention in these dominant norms, and were related to the religious imagery in work by more well-known non-Jewish poets like Elizabeth Barrett Browning. For example, according to Scheinberg, Milton ’ s Paradise Lost “ present[ s ] Mary as the object of male narrational gaze and minimize[ s ] her active role in Christian history. ” 39 However, we ĳind the related ĳigure of Mary Magdalene cast in a very different role in Amy Levy ’ s poem “ Magdalen. ” That poem alludes to an intimate physical relationship between Jesus and his female disciple, but ultimately refuses to accept the transformation of their relationship after his resurrection – a rejection of Christianity and an insistence on Magdalen ’ s ( and the poet ’ s ) Jewish roots.40 Obviously there exist signiĳicant linguistic and cultural differences between the work of Anna Margolin and Leah Goldberg, on the one hand, and the Victorian milieu of Amy Levy, on the other. However, when we expand our purview beyond Hebrew and Yiddish modernism to consider work by Jewish women writers from other periods, we isolate gender as a category of analysis, enabling us to better and more critically view the strategies historically deployed by women writers operating in these diverse social settings. Embedding these insights in a more complex discussion of Margolin ’ s and Goldberg ’ s work and its reception deepens our appreciation of the meaning of these two poets for Hebrew and Yiddish literary history. In some sense, their poetry exists at the canonical center of modernist literary production in Hebrew and Yiddish – both for its formal innovation and for the multiple cultural afĳiliations that emerge through a close reading of their work. At the same time, however, something about these Mary poems resists absorption into this consensual center, pushing stubbornly against the cultural taboos governing the depiction of both female agency and Christian icons, offering an alternative path for the reading of Jewish literary history. Bibliography Brenner, Naomi, 2010 : “ Slippery Selves : Rachel Bluvstein and Anna Margolin in Poetry and in Public. ” In : nashim : A Journal of Jewish Women ’ s Studies and Gender Issues 19 : 100 – 133. 39 Scheinberg 2002 : 77. 40 Ibid. : 220 f. Levy ’ s “ Magadalen ” also includes the line “ I wonder, did God laugh in Heaven ? ” Barbara Mann : Of Madonnas and Magdalenes 67 Gluzman, Michael, 1991 : “ The Exclusion of Women from Hebrew Literary History. ” In : Prooftexts 11 ( 3 ) : 259 – 278. Goldberg, Leah, 1986 : Šīrīm. 3 vols. Tel Aviv : Sifriat hapoalim. – 2005 : Yōmānēy Lēāh Gōldberg. Tel Aviv : Sifriat hapoalim. – 2007 a ( 1937 ) : Mikhtavīm mi-něsī ‘āh mědummāh. Tel Aviv : Sifriat hapoalim. – 2007 b : “ Tōlědōt ḥayyīm. ” In : Haaretz 4 February 2007. http ://www. haaretz.co.il/literature/poetry/1.1382965 Glatshteyn, Yankev, Leyeles, A[rn], and Minkov, N[okhem], 1986 : “ Introspectivism [ manifesto of 1919 ]. ” Transl. by Anita Norich. In : Benjamin Harshav and Barbara Harshav, eds., American Yiddish Poetry. A Bilingual Anthology. Berkeley : University of California Press, 774 – 784. Hoffman, Matthew, 2007 : From Rebel to Rabbi : Reclaiming Jesus and the Making of Modern Jewish Culture. Palo Alto, ca : Stanford University Press. Hellerstein, Kathryn, 1988 a : “ ‘ A Word for My Blood ’ : A Reading of Kadya Molodowsky ’ s ‘Froyen-lider ’ ( Vilna 1927 ). ” In : ajs Review 13 ( 1 – 2 ) : 47 – 79. – 1988 b. “ A Question of Tradition : Women Poets in Yiddish. ” In : Handbook of American Jewish Literature. New York : Greenwood Press, 195 – 237. – 1992 : “ From Ikh to Zikh : A Journey from ‘ I ’ to ‘ Self ’ in Yiddish Poems by Women. ” In : Naomi B. Sokoloff, Anne Lapidus Lerner and Anita Norich, eds. Gender and Text in Modern Hebrew and Yiddish Literature. New York : Jewish Theological Seminary, 113 – 143. – 2000 : “ Translating as a Feminist : Reconceiving Anna Margolin. ” In : Prooftexts 20 ( 1 – 2 ) : 191 – 208. Hirshfeld, Ariel, 2000 : “ ‘Al mišmār ha-nā ’ īviyyūt : ‘al tafqīdāh ha-tarbūtī šel šīrat Lēāh Gōldberg. ” In : Pěgīshōt ‘im měshōreret : masōt u-měḥqārīm ‘al yěẓirātāh šel Lēāh Gōldberg. Jerusalem : Sifriat hapoalim/Hebrew University, 135 – 151. Karton-Blum, Ruth, 2006 : “ Mū ’eket ha-ḥillōniyyūt : ha-dī ’alōg ‘ im ha-brīt ha-ḥadāšāh ba-sifrūt ha-yiśrě ’ ēlīt. ” In : Dimui 27 : 7 – 32. – and Anat Weissman, eds., 2000 : Pěgīshōt ‘im měshōreret : masōt u-měḥqārīm ‘al yěẓirātāh šel Lēāh Gōldberg. Jerusalem : Sifriat hapoalim/Hebrew University. Kronfeld, Chana, 1996 : On the Margins of Modernism : Decentering Literary Dynamics. Berkeley : University of California Press. Mann, Barbara, 2002 : “ Picturing Anna Margolin. ” In : Modern Language Quarterly 63 ( 4 ) : 501 – 536. – 2004 : “ Jewish Imagism and the ‘ Mosaic Negative. ’ ” In : Jewish Quarterly Review 11 ( 3 ) : 282 – 291. Margolin, Anna, 1929 : Lider. New York : n. p. – 2005 : Drunk from the Bitter Truth : The Poems of Anna Margolin. Shirley Kumove, ed. and trans. Albany : suny Press. 68 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Meyers, Carole, 2005 : “ Miriam, Music, and Miracles. ” In : Deirdre Good, ed., Mariam, the Magdalene and the Mother. Bloomington : University of Indiana Press, 27 – 48. Miron, Dan, 1991 : ’ Immāhōt měyasddōt, aḥāyōt ḥōrěgōt. Tel Aviv : Hakibbutz hameuchad. – 1999 : “ Ha-’ōmeẓ lěḥullīn u-qěrīsātō : ‘al ṭabbā ’ōt ‘āšān mē ’ ēt Lēāh Gōldberg kě-taḥanat-ẓōmet bē-hitpatḥūt ha-šīrāh ha-‘ivrīt ha-mōdernīt. ” In : Ha ’ ādām ’ ēynō ’ ellā… : ‘ iyyūnīm bě-šīrāh. Tel Aviv : Zmora-Bitan, 309 – 388. Novershtern, Avraham, 1990 : “ Who would have believed a bronze statue could speak… ” In : Prooftexts 10 ( 3 ) : 435 – 467. – 1991 : “ Ana Margolin : materyaln tsu ir poetisher geshtalt. ” In : yivo-bleter, New Series 1 : 129 – 171. – 2008 : “ Ha-qōlōt wě-ha-maqhēlāh : šīrat nāšīm bě-yīdīš bēyn šětēy milḥamōt ha-‘ ōlām. ” In : Biqqōret u-faršānūt 40 : 61 – 145. Schachter, Allison, 2011 : Diasporic Modernisms : Hebrew and Yiddish Literature in the Twentieth Century. New York : Oxford University Press. Scheinberg, Cynthia, 2002 : Women ’ s Poetry and Religion in Victorian England : Jewish Identity and Christian Culture. New York : Cambridge University Press. Setzer, Claudia, 2005 : “ Three Odd Couples : Women and Men in Mark and John. ” In : Deirdre Good, ed., Mariam, the Magdalene and the Mother. Bloomington : University of Indiana Press, 75 – 92. Shocham, Haya, 2000 : “ Ha-děmūt ha-nāshīt wě-‘ iẓẓūvāh bě-šīrīm ’ interteqstūālīm šel Lēāh Gōldberg. In : Pěgīshōt ‘im měshōreret : masōt u-měḥqārīm ‘al yěẓirātāh šel Lēāh Gōldberg. Jerusalem : Sifriat hapoalim/Hebrew University, 167 – 183. Sokoloff, Naomi B., Anne Lapidus Lerner and Anita Norich, eds. : Gender and Text in Modern Hebrew and Yiddish Literature. New York : Jewish Theological Seminary, 1992. Stahl, Neta, 2008 : “ ‘Uri Zvi Before the Cross : ’ The Figure of Jesus in the Figure of Uri Zvi Greenberg. ” In : Religion & Literature 40 ( 3 ) : 49 – 80. Ticotsky, Gideon, 2006 : “ Yiẓẓūg ha-nōf ha-’ ereẓ-yiśrě’ēlī bě-šīrat Lēāh Gōldberg kě-zīrat hitmōdědūt ‘ im muskāmōt sifrūtiyyōt wě-’ īdēy’ōlōgiyyōt. ” Masters ’ thesis, The Hebrew University of Jerusalem. Weissler, Chava, 1998 : Voices of the Matriarchs : Listening to the Prayers of Early Modern Jewish Women. New York : Beacon Press. Zierler, Wendy, 2004 : And Rachel Stole the Idols : The Emergence of Modern Hebrew Women ’ s Writing. Detroit : Wayne State University Press. Kathryn Hellerstein Against “ Girl Songs ” Gender and Sex in a Yiddish Modernist Journal This article presents poems by women in ‫שריטן‬, a modernist Yiddish miscellany published in New York between 1912 and 1926. These poems are shot through with sexual language and situations, which reflect varying ideas about gender held by the poets themselves and the editors of the journal. Considering the gendered authorship and the sexual themes of these poems, I will attempt to articulate what these poets and their New York editors assumed about women and Yiddish poetry. We must ĳirst consider what kind of a place ‫ שריטן׃ ַא ַזאמלבוך‬initially made for women poets. The novelist and poet David Ignatov established this serialized miscellany to present the works of the immigrant avant-garde poets who, after the publication of their collection ‫ יוגנט‬in 1908, had been derisively labeled ‫ די יונגע‬by the mainstream Yiddish press. In the ĳirst issue of ‫שריטן‬, in 1912, Reuven Iceland wrote an essay that reclaimed the appellation ‫ די יונגע‬from its dismissive intent, by explaining the aims of and evaluating the 15 poets he considered part of the group.1 Even while reluctantly accepting the idea that these poets did form something of a literary movement, Iceland insisted on distinguishing among the distinct talents and individual styles of these “ young poets. ” 2 Iceland credited them all with “ a proud separatism ” ( ‫ַא‬ ‫ראטיזם‬ ַ ‫סעפּא‬ ַ ‫שטאלצן‬ ָ ) that stands in contrast to “ the gray, monotonous life of the American Jewish street, in which ‘ the youth ’ ( ‫ ) די יונגע‬appear to live collectively ; where all is raw, base, and materialistic ; where there is no trace of tradition and where the overblown yellow press kills off every taste for things that depart from the ordinary banal sort. ” 3 For Iceland, “ the deep seriousness with which the ‘ Yunge ’ devote themselves to their calling ” offsets the threat of “ the Future ( ‫– ) די צוקונט‬ For their comments and suggestions on early drafts of the essay and translations, I am grateful to the members of the Philadelphia Women Writers Group – Cynthia Baughman, Deborah Burnham, Carolyn Daffron, Adele Aron Greenspun, Emilie Harting, and Carolyn Raskin, as well as to Bethany Wiggin, and to David Stern. 1 2 3 Iceland 1912 : 1 – 20. Ibid. : 20. Ibid. 70 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ that dark labyrinth that terriĳies American Jewish life like a demon and threatens to swallow it. ” 4 The poets whom Iceland named as having participated in the earlier Yunge publications – ‫ליטעראטור‬ ַ ,‫ טרוים און ווירקלעכקייט‬,‫ יוגנט‬and now ‫ – שריטן‬included eleven men and one woman. According to Iceland, the older poets Avrom Reyzen, Josef Rolnik, and Yehoash served as models for the newer voices of Yoel Slonik, D. Rozenblat, Mani Leyb, Zishe Landau, Moyshe-Leyb Halpern, I. J. Schwartz, Josef Bank, and E. L. Flayshman. Iceland devoted most of his article to analyzing the poetry of these ĳigures, in order to distinguish each by the distinct gifts offered to the future of Yiddish literature.5 At the end of the article, Iceland added a list of four younger writers, “ all of whom are poets with talent, who will perhaps yet develop nicely ” 6 : three men – M. Bassin, A. M. Dillon, and L. Miller – and a lone woman, Fradl Shtok.7 Despite his mention of Fradl Shtok in this list, the American “ future ” into which Iceland peered seems to have included women poets only by chance. Dovid Ignatov, the publisher and editor of ‫שריטן‬, which came out as nine issues in eight thick, hardbound, illustrated volumes, from 1912 – 1914, from 1919 – 1921, and in 1925 / 1926, did not publish poems by any women poets until the Summer issue of 1919. Thereafter, ‫ שריטן‬published a total of eleven poems by six women poets : Eda Glazer, Roshelle Veprinski, Celia Dropkin, Esther Pevzner, Berta Kling, and Malka Lee. Rather than publish a poem by the promising Fradl Shtok, though, the 1912 ‫ שריטן‬presented an impersonation of a woman poet in Zishe Landau ’ s sequence of four ‫געזאנגען‬ ַ ‫ ( מיידלשע‬Girl Songs ).8 Here are the four sections of Landau ’ s poem with my translation : 1 ,‫איך קוק אוין זייגער‬ .‫אר שרעק‬ ַ ‫הארץ גייט אויס‬ ַ ‫דאס‬ ָ ‫שרײבסטו — קומען‬ ַ — ‫כ׳וועל זיבן‬ .‫און ַאכט איז שוין ַאוועק‬ 4 5 6 7 8 Ibid. Ibid. : 4 – 19. Ibid. : 20. Ibid. Landau 1912 : 6 f. I keep looking at the clock, My heart expires in fright. You write – I ’ ll come at seven, And now it ’ s after eight. Kathryn Hellerstein : Against “ Girl Songs ” 71 ‫דאס ָאוונטברויט צו עסן‬ ָ — — ,‫הײנט נישט געקענט‬ ַ ‫האב איך‬ ָ — — ,‫געצערטלט מיר די ינגער‬ .‫מײנע הענט‬ ַ ‫דאך‬ ָ ‫דו קושסט‬ ,‫איך ווייס ניט צי געדענקסטו‬ ‫האנט‬ ַ ‫דײן‬ ַ ‫מאל‬ ָ ‫ס׳האט ַא‬ ָ ‫ווי‬ — ‫זאג קיין ליגן‬ ָ ‫האר מיר — איך‬ ָ ‫די‬ — ‫נאנד‬ ַ ‫נאך ַא‬ ָ ‫געגלעט שטיל‬ ‫באדעקט מיט קושן‬ ַ ‫כ׳האב זיי‬ ָ ,‫ארקעמט‬ ַ ‫און ליב ַאזוי‬ “ ‫„ ַא שיינע מיידל בין איך‬ .‫ארשעמט‬ ַ ‫האלב‬ ַ ‫געמורמלט‬ ,‫נאר גיכער‬ ָ ‫ קום‬,‫נאר‬ ָ ‫דו קום‬ ! ‫נײן‬ ַ ‫שלאגט שוין‬ ָ ‫דער זייגער‬ ‫מיר וועלן ביידע זיצן‬ .‫רײן‬ ַ ‫טאג ַא‬ ָ ‫אין גרויסן‬ Today I am unable To eat the evening bread – Fondling my ĳingers, – You kiss my hands. I don ’ t know if you remember How once – I tell no lie – Your hands stroked and stroked My hair quietly – I covered them with kisses And love – your combing hands, “ I am a pretty girl ” I murmured, half ashamed. Come now, but come quicker, The clock is striking nine ! And we will sit together ’ Til the sun begins to shine.9 2 ‫יארן‬ ָ ‫מײנע‬ ַ ‫נאר‬ ָ ‫דו ניט צייל‬ ,‫מײן שטערן‬ ַ ‫און די קנייטשן ון‬ ‫געווארן‬ ָ ‫איך בין ייִ נגער שוין‬ .‫דײנע ווערן‬ ַ ‫טראכטנדיק׃ כ׳וועל‬ ַ — —,‫הארץ מיר קלעמען‬ ַ ‫דאס‬ ָ ‫ס׳נעמט ַא רייד‬ — — — ,‫ארלירן‬ ַ ‫קאפּ‬ ָ ‫נאר ניט דעם‬ ָ ‫כ׳זאל‬ ָ ,‫ וועסט מיך נעמען‬,‫דו וועסט קומען‬ .‫וועסט ַאהיים צו זיך מיך ירן‬ 9 Don ’ t just count my years, you, And the wrinkles on my brow, I have already grown younger Thinking : I will soon be yours. My heart pinches me with pleasure – But I should not lose my head, – You will come, you will take me, You will carry me to our bed. ‫פּראצע ווערן‬ ַ ‫ַאלט וועל איך ון‬ .‫איידער ס׳וועט די עלטער קומען‬ ,‫באשערן‬ ַ ‫גאט‬ ָ ‫נאר‬ ָ ‫גוט ! ווען ס׳וועט‬ .‫זאל קומען‬ ָ ‫יאר‬ ָ ‫ַאז ַא קינד צום‬ Toiling hard, I will grow old Even before my old age comes. Good ! If only God decrees, Within the year, may a child come. ‫ארוויגן‬ ַ ‫זינגענדיק וועל איך‬ ...‫מײן טרויער‬ ַ ‫צוזאמען מיט‬ ַ ‫ס׳קינד‬ ,‫יארן וויגן‬ ָ ‫פּײן זיך‬ ַ ‫און אין‬ ...‫ גרויער‬,‫און איך ווער מיר גרויער‬ Singing, I will rock to sleep My child together with my tears … And, growing ever grayer, grayer, In pain I ’ ll rock for years. Ibid. All translations in this article are by the author, unless otherwise noted. 72 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ 3 — ‫מײן אויער‬ ַ ‫ס׳לאמט‬ ַ ‫אוי ווי‬ .‫ס׳טרײבט רכילות ווער‬ ַ ,‫גארנישט‬ ָ ‫באדויער‬ ַ ‫איך‬ .‫מאל שווער‬ ָ ‫דאך ווערט ָאט‬ ָ ‫נאר ַא טרייסט געוועזן‬ ָ ,‫פּײן‬ ַ ‫מײן‬ ַ ‫וואלט מיר אין‬ ָ ,‫באלד קומען‬ ַ ‫דארף‬ ַ ‫וואס‬ ָ ,‫ס׳קינד‬ .‫זײן‬ ַ ‫זאל ַא מיידל‬ ָ ‫זאג איך‬ ָ ,‫ווערט זי עלטער‬ — .‫ַאלעס איר ַאליין‬ ,‫טאכטער‬ ָ ‫ס׳משפּט ניט ַא‬ .‫ארשטיין‬ ַ ‫זי וועט מיך‬ Oh, how my ears are burning – With gossip and with lies. I regret nothing, How burdensome is life. But one consolation Would ease the hurt in me : The child soon to come A girl must be. When she grows older, I will Tell her everything. – A daughter will not judge me, She will understand. 4 ‫כאטש דו שווערסט זיך ׃‬ ָ ,‫ איך גלויב ניט‬,‫ניין‬ — — ,‫ליבסט מיך מער שוין ניט ַאצינד‬ ‫פּײנען שווערע‬ ַ ‫טראג איך נישט דורך‬ ָ ? ‫דײן קינד‬ ַ ‫הארצן איצט‬ ַ ‫מײן‬ ַ ‫אין‬ No ! You swear, I won ’ t believe That you don ’ t love me now, – Don ’ t I bear with pain and grief, Your child now in my heart ? ‫נאר בעט איך ׃‬ ָ ‫גאט‬ ָ ‫בײ‬ ַ ‫טאג‬ ָ ‫ַאלע‬ ; ‫זײן צו דיר‬ ַ ‫זאל ענלעך‬ ָ ‫ס׳קינד‬ ,‫דאס קינד מיט ליבע‬ ָ ‫גלעטנדיק‬ ? ‫טראכטן דען ון מיר‬ ַ ‫וועסט נישט‬ Every day, I pray to God : May the child look like you ; Caressing this child with love Wouldn ’ t you, then, think of me ? ,‫רטראגן‬ ָ ‫א‬ ַ ‫מעגן ימען דיך‬ — ‫לאנד‬ ַ ‫שטאט צי‬ ָ ‫מעג אונדז שיידן‬ ‫צוזאמען‬ ַ ‫האלט אונדז עסט‬ ַ ‫אייביק‬ .‫האנט‬ ַ ‫עפּעס ַא געהיימע‬ Oceans may carry you away, Cities divide us, and vast lands – Always holding us together Will be this secret hand.10 In Landau ’ s “ Girl Songs, ” a girl speaks to her absent lover. As the clock hands move from seven, to eight, to nine, the girl waits vainly for his return and reveals that he has seduced and deserted her, leaving her pregnant. In his absence, she hopes that the child will be a girl, who, as a fellow female, will never judge her for having been seduced outside of marriage. As work and worry age her, the narrator prays that the unborn child will look like her lover and thus, somehow, cause him to think of her. In the end, she asserts that even though he has fled far away and 10 Ibid. Kathryn Hellerstein : Against “ Girl Songs ” 73 will not return, the “ secret hand ” of their illegitimate child binds the lover to her.11 Landau ’ s poem presents a man ’ s fantasy of how a young woman might respond to her seduction, pregnancy, abandonment, and subsequent ostracism by society. Expressing her longing and desire for the absent lover, the girl extends the powerful hand of her powerlessness and grasps the man with the onerous fact of their illegitimate child. She reaches beyond her solitude to manipulate the man into recognizing his connection to her through the child. Giving voice to the victimized, passive woman, Landau ’ s poem nonetheless focuses on the predatory man, even though this character remains completely off-stage. Rather than judge, condemn, or question this man ’ s actions and motives, the poems valorizes him. The key words, repeated throughout the poem – “ ‫ „שווער‬,“ ‫ „ליבע‬,“ ‫ „טרויער‬,“ ‫הארץ‬ ַ „ ,“ ‫פּײן‬ ַ „ – signal the conventional vision of the pining maiden. The girl ’ s voice is so annoyingly guilt-inducing that the reader sympathizes and identiĳies with the man who has abandoned her. Landau ’ s “ Girl Songs, ” depicting a young woman as passive, longing, victimized, and, above all, sexual, seem to set the tone for the unstated assumptions about the poems by women published in ‫שריטן‬ seven years later. There is no explicit discussion in ‫ שריטן‬of the signiĳicance of publishing women poets. Yet the fact that women writers were absent from the journal, despite their presence in the Yunge circles, and Landau ’ s single, ersatz representation of a female persona who composes “ songs, ” suggest that these richly creative modernist writers held unexamined notions about what women might write. Such expectations are not what six actual women poets delivered when their work was published in ‫ שריטן‬beginning in 1919. No poems or any other writings by women appeared in ‫ שריטן‬between 1912 and 1914. The editors suspended publication of ‫ שריטן‬from 1915 through 1918. When they resumed, in the summer of 1919, they included a poem by a woman I had never heard of – Eda Glazer, a poet who subsequently published a number of books. The fall issue of 1919 included one more poem by Eda Glazer, and one each by Roshelle Weprinsky, Celia Dropkin, Esther Pevzner, and Berta Kling. The spring 1921 issue included one poem by Roshelle Weprinsky. Publication again ceased from 1922 – 1925. In the ĳinal issue of ‫שריטן‬, winter 1925 – 1926, the editors included two poems by Roshelle Weprinsky and one by 11 An alternate reading, offered by Roland Gruschka and Simon Neuberg, would emphasize the girl ’ s conventionality, in that she desires to become pregnant in order to force her lover to marry her, so that she would not have to bear the stigma of having lost her virginity. 74 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Malka Lee. Despite Reuven Iceland ’ s praise for Fradl Shtok in his 1912 article, none of her poems ever appeared in ‫שריטן‬, although her sonnet sequence was published in a rival miscellany, ‫נײע היים‬ ַ ‫די‬, in 1914. At this time, women writers were a notable presence in the New York Yiddish press, both in print and as a topic of discourse. For example, Anna Margolin published a weekly column on women ’ s topics, “ In der froyen velt, ” in ‫טאג‬ ָ ‫דער‬, starting in 1914,12 and Aron Glanz, later a founder of Introspectivism, wrote an article in the New York newspaper ‫רײע ַארבעטער ־ שטימע‬ ַ ‫ ( די‬The Free Worker ’ s Voice ), called ‫קולטור‬ ‫ ( און די רוי‬Culture and Woman ), on October 30, 1915. Despite this visibility, the inclusion of women writers seems more an afterthought than a priority of ‫שריטן‬, which featured novels by Dovid Ignatov and Joseph Opatoshu, translations into Yiddish of Walt Whitman, as well as of poems by classical Greek, Chinese, and Indian writers ; poemes many pages long by Mani Leyb, Zishe Landau, Reuven Iceland, and MoysheLeyb Halpern, and essays by Khayim Zhitlovski and others. Yet the eleven poems by women that ‫ שריטן‬published over the years reveal a quiet rebellion against the premises of Landau ’ s “ Girl Songs. ” In contrast to Landau ’ s pastiche of an abandoned, impregnated girl, these poems by women authors express how the imaginative act of writing can offer alternative responses to gender-tinged social and sexual dilemmas. In the ĳirst of these eleven poems, ‫שטראם‬ ָ ‫ ( ליסט ַא שטילער‬A Quiet Stream Flows ), in the ĳirst issue of ‫ שריטן‬to be revived after World War I, in the summer 1919, Eda Glazer writes : 13 .‫הארץ‬ ַ ‫מײן‬ ַ ‫שטראם אין טיעניש ון‬ ָ ‫ליסט ַא שטילער‬ ? ‫קלאר‬ ָ ‫טאג צי‬ ָ ‫מאכט מיר אויס צי גרוי עס איז דער‬ ַ ‫וואס‬ ָ ‫שײן ון זון‬ ַ ‫טורמאלין אין העלן‬ ַ ‫ילארביק ווי דער‬ ַ ‫טאג‬ ָ ‫נאך‬ ָ ‫טאג‬ ָ ‫שטראם זיך‬ ָ ‫רוישט און לויט ַאזוי דער‬ .‫יאר‬ ָ ‫נאך‬ ָ ‫יאר‬ ָ ‫און‬ .‫זײן ברעג‬ ַ ‫וואקסן אויף‬ ַ ‫גראזן‬ ָ ‫ ווילדע‬,‫ווילדע בלומען‬ ,‫אײן‬ ַ ‫הארץ זיך‬ ַ ‫מײן‬ ַ ‫גראזן הילט‬ ָ ‫אין די ווילדע‬ ,‫שטראם‬ ָ ‫מײן גרויע ווירקלעכקייט שפּיגלט זיך אין‬ ַ ‫און‬ .‫שײן‬ ַ ‫וואסערשוים אין רעגנבויגן ־‬ ַ ‫שפּילט זיך מיטן‬ 12 Swartz 2009. 13 Glazer 1919 a : 6. A quiet stream flows in the deeps of my heart. What does it matter to me if the day is gray or clear ? Many-colored as tourmaline in the bright light of the sun The stream rushes and races, day after day, year after year. Wildflowers and wild grasses grow on its banks. In the wild grasses, my heart heals. And my gray reality, reflected in the stream, Plays with the waters ’ foam in the rainbow ’ s shine. Kathryn Hellerstein : Against “ Girl Songs ” 75 In Glazer ’ s lyric, the speaker reflects upon herself as a sentient being. The character, apparently alone in a landscape, describes the natural beauty that surrounds her. But a closer look reveals that this is an internal landscape, for the stream “ flows in the deeps of my heart. ” The environment of the jewel-hued stream and wildflowers and wild grasses is a metaphor by which the speaker ’ s imagination transforms her “ gray reality. ” Although the imagery of Glazer ’ s poem is conventional, it reads with a concreteness and immediacy when contrasted to the poem ’ s only abstraction, “ ‫ ( „ ווירקלעכקייט‬reality ). In contrast to Landau ’ s “ Girl Songs, ” which characterize the female speaker only in terms of her relationship to her absent lover and unborn daughter, Glazer ’ s poem foregrounds a woman outside of the network of sexual and social relationships. Portraying a girl who longs for but can never achieve the traditional roles of marriage and childbearing because she has allowed herself to be seduced, impregnated, and abandoned, Landau ’ s poem limits her vision to longing for her seducer and her child. In contrast, Eda Glazer ’ s ĳirst ‫ שריטן‬poem presents a woman speaker who transcends the conĳinement and monotony of her life through her solitary making of metaphors, which is the work of the poet.14 The fall 1919 issue of ‫ שריטן‬presents a group of ĳive poems by women in a section called ‫ ( איינציקע לידער‬Individual Poems ). This section of poems by women is preceded by a group of erotic drawings by Y. Topl, illustrating the New Testament narrative of Salome, as she dances nude and bears the severed head of John the Baptist on a platter. Salome was an object of fascination for immigrant Jewish writers and artists, testing the limits of cultural tradition to draw metaphors from the Christian Bible, as in Moyshe-Leyb Halpern ’ s 1919 Yiddish love poem “ Salome, ” Anzia Yezierska ’ s 1923 English-language novel Salome of the Tenements, Yiddish poet Fradl Shtok ’ s 1914 untitled sonnet on the subject, and Celia Dropkin ’ s famous poem ‫דאמע‬ ַ ‫ ( די צירקוס ־‬The Circus Lady ).15 By prefacing, as it were, the section of ĳive women poets with Y. Topl ’ s provocative drawings, the editors of the fall 1919 ‫ שריטן‬titillate the reader and, perhaps unconsciously, raise expectations and anxieties that the poems by women that follow will be as transgressive and sexual as the erotic 14 Eda Glazer, now all but forgotten, went on to publish at least four books, including a volume of her poetry and three books for children, in New York, between 1922 and 1940 ( Glazer 1922, 1929a, 1929b and 1940 ). 15 See Halpern 1919 : 149 – 151 ; Shtok 1914 : 7 in the sixth section ; Shtok 1928 : 98 ; Yezierska 1923 ; Hoberman 1991 : 105 f. The interest in Salome among Yiddish writers may have been roused by a performance in Yiddish of Oscar Wilde ’ s 1894 play Salome, although I have not been able to document such a performance. In 1909 a Yiddish translation by A. Frumkin of Wilde ’ s play was published in London. 76 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ dance of the temptress in the Christian legend. Moreover, the nude images draw lascivious attention to the female body, versions of which were presumably possessed by the women poets.16 These illustrations exemplify both the daring of Yiddish modernism and a Jewish male ambivalence toward that daring in the appropriation of Christian themes and the exposure of female sexuality. The ĳirst of the group of “ Individual Poems, ” Roshelle Weprinsky ’ s “ From My Slender Limbs ” ( ‫שלאנקע גלידער‬ ַ ‫מײנע‬ ַ ‫) ון‬, focuses on a woman ’ s sexual body in a way that undoes the objectiĳication in Topl ’ s illustrations. Moreover, Weprinsky ’ s poem offers what seems like a response to the illicit pregnancy of Landau ’ s girl narrator in “ Girl Songs ” seven years earlier. Unlike Landau ’ s deserted mother, who invokes his child to manipulate her lover into returning to her, the speaker of Weprinsky ’ s poem mourns the children she refuses to bear, who “ weep ” “ from my slender limbs ” and who “ want to discover the world through my flesh. ” This woman resists the pressure of the maternal urge to bring these unborn children to life. Instead, she admits : 17 ‫ארטויב איך‬ ַ ‫נאר טיף אין זיך‬ ָ ; ‫צארטע שטימעלעך‬ ַ ‫יענע‬ ,‫דראנג‬ ַ ‫מיט טויזנט שטימען ון ַא יבערישן‬ ‫שלאנק‬ ַ ‫ ַאזוי‬,‫בויגזאם‬ ַ ‫ אייביק ַאזוי‬,‫זײן ווי איצטער‬ ַ ‫צו‬ ,‫קאפּריז‬ ַ ‫מײן‬ ַ ‫אר‬ ַ ‫רײ‬ ַ ‫און‬ ,‫אר נעכט געשטערנטע‬ ַ — ‫דײנע צערטלענדיקע הענט‬ ַ ‫אר‬ ַ ‫און‬ But deep inside, I silence Those gentle little voices With a thousand voices of feverish struggle To be forever as I am now, so lithe, so slender And free for my caprice, For starry nights, And for your fondling hands – With the phrases ‫קאפּריז‬ ַ ‫מײן‬ ַ and ‫דײנע צערטלענדיקע הענט‬ ַ ( “ my caprice ” and “ your fondling hands ” ), the speaker silences the cries of the unborn babies. Choosing sexual pleasure over the maternal urge in the middle of the poem, this speaker seems to embrace the modern ideas of free love and to put aside the conventional woman ’ s role of childbearing. The poem, however, suddenly reverses itself, as the speaker contemplates the danger of that choice and addresses her unborn children ( in the plural ‫) איר‬, rather than her lover ( in the singular ‫ ) דו‬: 16 Fradl Shtok was the only woman poet, besides Celia Dropkin, included by Zishe Landau in the 1919 ‫ יונגע‬anthology of Yiddish poetry in America, a fact that conĳirms the limited place women modernists were given by their male contemporaries. The anthology included Dropkin ’ s poem, ‫ווײסע שניי ־ פּרינצעסין‬ ַ ‫מײן‬ ַ , 51 f, and Shtok ’ s, ‫הארץ‬ ַ ‫דאס‬ ָ ‫טראגסט‬ ָ ‫דו‬, 172. Landau 1919 : 51 f and 172. 17 Weprinsky 1919 : 17. Kathryn Hellerstein : Against “ Girl Songs ” 77 ,‫ארשווענדט‬ ַ ‫האסטיקער‬ ַ ‫כאטש ווערן‬ ָ ‫מײנע טעג‬ ַ ‫זאלן‬ ָ — ‫ווארט‬ ַ ‫דארטן וווּ איר‬ ָ ‫ַאז‬ ‫ווײסע טויערן‬ ַ ‫איר וויינענדיקע אייגעלעך אונטער די‬ ,‫אײך‬ ַ ‫זאל איך יונג צו‬ ָ ‫קומען‬ ,‫צוזאמעננעמען‬ ַ ‫אײך שטיל‬ ַ ‫איך וועל‬ ,‫ווײסע ליגלען‬ ַ ‫מײנע‬ ַ ‫אונטער‬ ‫און אויף עפּעס טרויערן‬ .‫אײך‬ ַ ‫און וויינען שטיל מיט‬ Although my days may be more swiftly squandered When to where you wait – Your weeping little eyes beyond the white gate, – Still young, I shall come to you. Quietly, I will gather you Under my white wings And grieve about something And weep quietly with you. Shifting her address in this stanza from the “ ‫ „ דו‬of the lover to the “ ‫„ איר‬ of the unborn children, the speaker contemplates the possibility that, if she were to die “ still young, ” “ more swiftly, ” perhaps because of the excesses of the sexual pleasure she pursues, she would join her unborn children and, like an angel or the Shekhinah, take them under her “ white wings. ” Together they would “ ‫ “ ( „ אויף עפּעס טרויערן‬grieve about something ) – the “ ‫ ( „עפּעס‬something ) being the fact that she chose not to bear them. With its circular structure – beginning and ending with the unborn children that pivot around the lovers – and the incantatory repetition of “ ‫ „ אויגן‬,“ ‫ „ וויינען‬,“ ‫ „שטים‬the poem emphasizes that the woman speaker has chosen not to bear these children. This allusion to the emotional cost of such a choice for this speaker, whether made through the practice of birth control or of abortion, places her in a vise of conflicting feelings that form a contrast to the sentimentality of Landau ’ s narrator. Having rejected the traditional role of childbearing, Weprinsky ’ s speaker longs for what she has renounced – children – and regrets the consequences of the modern choice she made in favor of sexual pleasure. The third poem in the fall 1919 issue of ‫שריטן‬, ‫העמאק‬ ַ ‫ ( אין‬In the Hammock ) by Celia Dropkin, opens by evoking an image of language and resolves it by returning to sexual love : 18 ‫העמאק‬ ַ ‫איך ליג אין‬ ,‫רײן די זון‬ ַ ‫שײנט הייס ַא‬ ַ ‫צווײגן‬ ַ ‫דורך‬ ‫מײנע אויגן‬ ַ ‫רמאך‬ ַ ‫א‬ ַ ‫איך‬ ‫און זע ַא בלויע כינעזישע שריט‬ .‫בלאט‬ ַ ‫גאלדענעם‬ ָ ‫אויף ַא‬ ‫ליכטיק בלויע כינעזישע אותיות‬ ,‫ראפּ‬ ָ ‫ינקלען ַארויף און ַא‬ ,‫נטאסטישע ענצטער‬ ַ ‫א‬ ַ ‫ווי קליינע‬ 18 Dropkin 1919 : 18. I lie in the hammock The sun shines in hot through branches, I close my eyes And see a blue Chinese script On a golden page. Radiant blue Chinese characters Sparkle above and below, Like small, fantastic windows 78 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ .‫גאלדענעם טורעם‬ ָ ‫וואנט ון ַא‬ ַ ‫אויף ַא‬ ‫ארשטיי ניט די שריט‬ ַ ‫איך‬ ,‫הארץ‬ ַ ‫מײן‬ ַ ‫ארדריקט‬ ַ ‫נאר עפּעס‬ ָ ‫דערמאן זיך׃‬ ָ ‫איך‬ ,“ ‫ איך ליב דיך‬,‫„ איך ליב דיך‬ ‫ַאזוי לעז איך די בלויע‬ .‫כינעזישע שריט‬ In the wall of a golden tower. I do not understand the script But something presses upon my heart, I remember : “ I love you, I love you ” This is how I read the blue Chinese script. In a hammock, under a tree, the speaker describes the patterns of the branches and the sun that remain on the insides of her eyelids when she closes her eyes. Like Eda Glazer ’ s persona, who described the flowing stream in her imagination with the unexpected metaphor of the gemstone tourmaline, Dropkin ’ s speaker transforms what she has seen in nature into the unexpected ĳigure of Chinese characters written in “ bright blue ” “ on a golden page. ” As the poem progresses, the image of this writing develops from an inscrutable message into sparkling “ fantastic windows/ In the wall of a golden tower. ” The juxtaposition of the indecipherable script and the phallic tower with its portals for seeing in or out leads the speaker to feel “ something press[ … ] upon [ her ] heart ” and to remember and repeat the words, “ ‫ ( „ איך ליב דיך‬I love you ). The memory of these words makes comprehensible to the speaker the enticing foreignness of nature ’ s writing, or “ Chinese script. ” Now she can “ read ” it. That Dropkin calls this visionary writing “ Chinese ” emerges in part from the modernist interest in actual Chinese culture and literature prevalent at the time, an interest that extended into Yiddish when, in 1925 – 1926, an issue of ‫ שריטן‬presented Meyer Shtiker ’ s Yiddish translations of classical Chinese poetry.19 Whatever Chinese texts or art Dropkin may have seen, in fact her image of blue Chinese characters on a gold page reverses the actual inscribed panels that hang in Buddhist and Confucian temples. In Dropkin ’ s poem, it is the inscrutability of the Chinese pictograms that emphasizes the act of the imagination. Dropkin ’ s strange, beautiful poem traces the work of the imagination through a process of vision. The external image of nature ’ s beauty becomes the projection of that image into the woman ’ s body, the insides of her closed eyelids. This transformation, from nature to the woman ’ s body to an indecipherable language to an architectural structure, presses upon the woman ’ s “ heart. ” With this mention of the heart, the poem returns to the woman ’ s body. Such physicality brings forth memory ; memory brings to the surface words of love ; and such words 19 I have written at length about Meyer Shtiker ’ s Yiddish translations of Chinese poetry in Hellerstein forthcoming. Kathryn Hellerstein : Against “ Girl Songs ” 79 allow the woman to interpret the script that she could not read before. The speaker ’ s inability to interpret the visual symbols of the outside world leads to a memory of a key emotional and erotic experience. It is only this memory that enables her to decipher the “ script ” she reads. By making sensual memory the means by which a woman can interpret an inscrutable text, Dropkin depicts the interdependence between nature, art, culture, and eros in a woman poet ’ s creative process. There is a crucial difference between the women narrators in Glazer ’ s, Weprinsky ’ s, and Dropkin ’ s poems and Landau ’ s girl. Because Landau ’ s persona is preoccupied with the conventional female gender roles, the poems objectify the girl who sings them. In contrast, the female personae in the three poems by Glazer, Weprinsky, and Dropkin engage actively in making a poetry that lifts them out of those conventions. Landau has romanticized the illegitimate mother, who is also a version of the agune or abandoned wife, by making her disempowerment the occasion for her songs. In contrast, Glazer ’ s speaker comes across as primarily a poet engaged in an act of the imagination that transforms her perception of her life. And Weprinsky and Dropkin give each female speaker agency through her sexuality, which is bound up in the imagery of writing. For Landau, the songs of a girl emerge from the social and religious castigation of transgressive sexual behavior : she is punished by becoming both an abandoned wife ( ‫ ) עגונה‬and the mother of an illegitimate child ( ‫) ממזר‬. Glazer prioritizes the woman ’ s imagination, while Weprinsky exposes the emotional consequences of the speaker ’ s rebellion against the norms of women ’ s sexual roles in Jewish law by choosing to engage in sex for its own pleasure and refusing to procreate. Dropkin celebrates that same pleasure-driven sexuality by expressing it through metaphors of writing. The angry persona in Eda Glazer ’ s ‫קלאנג‬ ַ ‫ ( דער לעצטער‬The Last Sound ), further challenges Landau ’ s stereotype of passive women. In this fourth poem by a woman in the fall 1919 ‫שריטן‬, and Glazer ’ s second to appear in that journal, Glazer depicts a woman ’ s resistance to a lover ’ s violence as an act of strength : 20 ‫זײט טיר שטייסטו ַאצינד‬ ַ ‫ון איין‬ .‫און הערסט נישט אויף צו קלינגען‬ ‫בײס איך זיך די הענט‬ ַ ‫ון ווייטיק‬ .‫און דריי זיך אויף אין רינגען‬ 20 Glazer 1919b : 19. Now you ’ re standing at the door And won ’ t stop ringing. In pain, I bite my hand And go crazy with the clanging. 80 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ — ‫רײסן זיך די יס צום טיר‬ ַ ‫עס‬ ,‫דאך זיצן‬ ָ ‫בלײב איך‬ ַ ‫אין שטול‬ ‫און הער צונויגעדרייטערהייט‬ .‫מײנע ציינער קריצן‬ ַ ‫ווי‬ ————————— ‫דײנע טריט‬ ַ ‫קלאנג ון‬ ַ ‫דער לעצטער‬ ,‫ארשלונגען‬ ַ ‫אין שטילקייט ווערט‬ ,‫און אין דער שטילקייט ווער איך אויך‬ .‫ארזונקען‬ ַ ‫דײנע טריט‬ ַ ‫ווי‬ ————————— ‫מײן טיר‬ ַ ‫מאל מער‬ ָ ‫עס וועט זיך קיין‬ ... ‫אר דיר‬ ַ ‫ניט עענען‬ My feet pull me to the door – On the chair, I remain sitting And hear how insanely My teeth are grinding. The last sound of your footsteps Is swallowed by silence, And, like your footsteps, I sink into the silence. Rest assured, for you, my door Will open nevermore. Unlike Landau ’ s anxious girl, who “ keeps looking at the clock ” for her absent lover, Glazer ’ s speaker struggles to resist her lover ’ s arrival by sitting in silence, rage, and ambivalent desire behind the closed door. When he ĳinally leaves, she is relieved. Glazer conveys this scene through the imagery of sound and silence, as heard by the narrator through the door she has locked against the intruder. Subjected to the lover ’ s presence on the other side of the door, the speaker sits passively. Although tempted to open to him again and trying not to respond verbally, she becomes so “ crazed ” that she bites her own hand and grinds her teeth. As long as the lover is standing outside the door, the speaker cannot articulate her own response. Tension reverberates in the third stanza, as silence swallows the last sound of the man ’ s departing footsteps. Momentarily, the speaker remains suspended in a stillness that seems to have defeated her. Likening herself to the man ’ s now-vanished footsteps, the speaker, too, seems to have disappeared. But the ĳinal couplet reverses that impression, as the speaker deĳiantly declares her decision that, should the lover return, she will never allow him to enter. Unlike Landau ’ s abandoned girl, Glazer ’ s speaker welcomes the silence that results from her lover ’ s departure, because in this silence, she ĳinds her voice. The link between poetry and a woman ’ s sexuality recurs in Esther Pevzner ’ s ‫מײנע‬ ַ ‫ ( די שליסל‬My Keys ) and again challenges the portrayal of the victimized woman in Landau ’ s ‫געזאנגען‬ ַ ‫מיידלשע‬. Pevzner's poem expresses the conundrum of an isolated modern self, unable to speak to or be heard by another person, and a woman trapped by her inhibitions, which are at once both sexual and verbal. This woman addresses Kathryn Hellerstein : Against “ Girl Songs ” 81 a remote lover and links a sexual letting-go with the futile hope that she will communicate with the reader of her poem. Locked within the doors of the house of her self, this speaker longs to give the keys to another, but cannot communicate that longing. Although she says that she wants to be more than “ a mark in the air,/ A gesture that seeks a purpose, ” she cannot tell her would-be savior how to reach her, much less that she wants to be freed, because he exists only in “ the land of my secrets, ” her imagination and her poem. The only way that Pevzner ’ s speaker can articulate her stymied love to herself is by writing a poem that will act as a key to unlock her solipsism. In contrast to Landau ’ s “ girl, ” who attempts with her unborn daughter to manipulate the man who has left her, Pevzner ’ s speaker is both more hopeless and more empowered, for she lives fully in the imagination. Although writing poetry will not solve her problems in the world, with it she creates an interiority that, it is implied, will somehow save her. In the last of the fall 1919 poems, Berta Kling ’ s minimalist ‫טעג‬ ‫געגארטע‬ ַ ( Days Desired ), an aging woman mourns the passing of empty days : 21 ,‫געגארטע‬ ַ ‫טעג‬ ,‫גענארטע‬ ַ ‫טעג‬ ,‫טעג איר בלויע‬ ,‫טעג איר גרויע‬ ,‫אײער גיין‬ ַ ‫אײער קומען‬ ַ ‫וואס‬ ָ ‫בײ מיר‬ ַ ‫האט‬ ָ .‫שטענדיק צוגענומען‬ ,‫שטראלטע‬ ַ ‫בא‬ ַ ‫טעג‬ ,‫קאלטע‬ ַ ‫טעג איר‬ ,‫באשיינטע‬ ַ ‫טעג‬ ,‫באוויינטע‬ ַ ‫טעג‬ ‫געלאזן‬ ָ ‫מיר‬ ‫נאר‬ ָ ‫האט איר‬ ָ ‫עדעם זילבער‬ .‫האר‬ ָ ‫גרויע‬ Days desired, Deceptive days, You blue days, You gray days, Your goings, Your comings Always took a little Out of me. Dazzling days, You cold days, Days of beauty, Days of crying To me, you have Left only Silver threads, Gray hair. The speaker in Kling ’ s poem considers the consequences of time ’ s passing. She tells of days that she longs for, days that deceived her and were nonetheless blue and gray, ĳilled with comings and goings, dazzling, beautiful, and sad. Dynamic in their oppositions, these days have 21 Kling 1919 : 21. 82 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ left the speaker in her late years with, it seems, nothing but gray hair. By calling that gray hair ‫ ( עדעם זילבער‬silver threads ), however, the speaker implies that beauty glimmers within her years. While it echoes the girl ’ s anxiety about aging expressed in Landau ’ s ‫געזאנגען‬ ַ ‫מיידלשע‬, Kling ’ s poem disciplines the cliché by addressing not a lover but time itself. The experimental verse form that Kling introduces in this poem ( and develops in the several books she published in the 1930s ) 22 conveys emotion though repetition in a stringently restrained catalogue of irregularly rhymed two-beat verse lines. Like the poems by Glazer and Pevzner, Kling ’ s ‫געגארטע‬ ַ ‫ טעג‬establishes an environment of the imagination and words for the woman speaker to inhabit. Women poets appeared again in 4 ‫שריטן‬, in the spring of 1921. Two poems by Roshelle Weprinsky, . . . ‫ ( ווען‬If… ) and ‫כוואליעס‬ ַ ( Waves ), also turn convention into something new : 23 ‫זאל קינדערלעך געבוירן‬ ָ ‫ווען איך‬ ,‫האבן צען‬ ָ ‫יאר ַא קינד ביז איך וועל‬ ָ ‫יעדן‬ .‫וואלט געווען‬ ָ ‫דאס‬ ָ ‫ווי וווּנדערלעך‬ ,‫וואלט זיי דורך די טעג געזויגן און געוויגט‬ ָ ‫איך‬ ‫בײם געלן ליכט ביז שפּעט‬ ַ ‫וואלט איך‬ ָ ‫און אין די ָאוונטן‬ ,‫אר זיי געשטריקט‬ ַ ‫וואל‬ ָ ‫לײבעלעך ון‬ ַ ,‫געוואשן‬ ַ ‫אר זיי‬ ַ ‫וואלט איך‬ ָ ‫העמדעלעך און ווינדעלעך‬ ‫שלאן‬ ָ ‫טאג ווען ַאלע‬ ָ ‫אר‬ ַ ,‫צעהאנגען אויף די שטריק‬ ַ ‫וואלט איך‬ ָ ,‫געשטאנען‬ ַ ‫ווײלינקע‬ ַ ‫וואלט ַא‬ ָ ‫און‬ ‫געקוקט אין גרויסן בלויען הימל‬ ,‫הײנט רעגענען‬ ַ ‫אויב ס׳וועט‬ ‫הארץ‬ ַ ‫מײן‬ ַ ‫ס׳וואלט‬ ָ ‫און‬ ,‫ שירך‬,‫שארך‬ ָ ,‫נגעקוואלן ון דעם שירך‬ ָ ‫האלטן ָא‬ ַ ‫בא‬ ַ ‫מאכט‬ ַ ‫וואס דער ווינט‬ ָ ‫טרײבנדיק די שטריק‬ ַ ‫ הין און הער‬,‫הין און הער‬ ‫בײכלעך אין די העמדעלעך‬ ַ ‫אויבלאזנדיק‬ ָ ,‫און ווינדעלעך‬ .‫אנען ון ַא זעגלשיף‬ ָ ‫ווי די‬ ,‫מײן זעגלשיף‬ ַ ‫אנען ון‬ ָ ‫די‬ .‫וואלט געווען‬ ָ ‫דאס‬ ָ ‫ווי וווּנדערלעך‬ 22 Kling 1935, 1939 and 1952. 23 Weprinsky 1921 : 11. If I had borne little children, A child every year, until I had ten, How wonderful that would have been. I would nurse them and rock them through the days, And late into the evenings by the yellow light, I would Knit them little jackets, Little shirts and little diapers I would wash for them. At dawn, when all were sleeping I would hang clothes on the line, And would stand there a while, Looking into the great blue sky To see if it would rain today, And my heart would Hide, swollen with the shirkh, shorkh, shirkh That the wind makes Driving the line Back and forth, back and forth Blowing out little bellies in the shirts and diapers, Like the flags of a sailing ship. The flags of my sailing ship, How wonderful that would have been. Kathryn Hellerstein : Against “ Girl Songs ” 83 In . . . ‫ ווען‬, Weprinsky develops the tension between sexual freedom and motherhood for the modern woman, expressed in her 1919 poem, ‫ון‬ ‫שלאנקע גלידער‬ ַ ‫מײנע‬. ַ Weprinsky depicts a woman ’ s sense of loss as she imagines an unexpected adventure arising in the domestic task of hanging up the laundry of her ten children, none of them actually born. The speaker tells how, performing such a mundane task, she would ĳind the time to contemplate her future as she stood outdoors by the clothesline and gazed into the blue sky. Should a breeze pick up, it would bring the little shirts and diapers to life, ĳilling them out like the “ little bellies ” that never came into being. The image of baby clothes animated by the wind leads to an even more powerful image of promise and hope – the sails of “ my sailing ship, ” which would transport the speaker toward the possibility of realizing miraculous things that might have been. The poem begins in the subjunctive mood and moves quickly into the future tense and then to the conditional voice : ‫זאל קינדערלעך געבוירן‬ ָ ‫ווען איך‬ ,‫האבן צען‬ ָ ‫יאר ַא קינד ביז איך וועל‬ ָ ‫יעדן‬ ( lines 1 – 3 ) .‫וואלט געווען‬ ָ ‫דאס‬ ָ ‫ווי וווּנדערלעך‬ The poem ’ s concluding line 21 poignantly repeats the third line : “ How wonderful that would have been. ” 24 With this deliberate, subtle shift and repetition, Weprinsky establishes the distance between what is and what cannot be. The grammar itself is the means through which the speaker must both confront her regret at not bearing children and imagine how she would attend to them if she had. Signiĳicantly, this fantasy of motherhood depicts the interaction between mother and children in a single line : “ I would nurse them and rock them through the days ” ( 4 ). The rest of the poem describes the activities the narrator would engage in while her children were sleeping : knitting, sewing, and washing the babies ’ clothing ( 5 – 7 ). The remaining two-thirds of the poem evokes the mother hanging the laundered baby clothes out to dry at dawn. In this solitary act, the wind brings her unborn children momentarily to life and then becomes the means for the woman ’ s escape ( 8 – 18 ). The grammatical features of verb mood and tense produce the act of the imagination that lets the image of clothing evolve into the image of a ship ’ s sail. This metaphorical sailing ship would allow the speaker to escape both from the traditional decree that a married woman must produce children, and from the law that labels an unmarried woman having sex as an adulteress whose children will be ‫ממזרים‬ 24 This line could also be translated as “ How wonderful that would be. ” 84 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ ( illegitimate and excluded from the Jewish community ). This conundrum reflects Weprinsky ’ s own life-long extramarital relationship with the married poet Mani Leyb. It also helps to demonstrate how for the women published in ‫שריטן‬, the language of poetry becomes the locus for the possibility of the impossible and the means for the articulation of what otherwise remains unspeakable. The tension between muteness and expression recurs in Weprinsky ’ s ‫כוואליעס‬ ַ ( Waves ), also in ‫ שריטן‬4 : 25 ,‫הארץ‬ ַ ‫מײן‬ ַ ‫האסט אויגעברויזט אין‬ ָ ‫וואס דו‬ ָ ‫כוואליעס‬ ַ ,‫מײנע ליפּן‬ ַ ‫שלאגן זיך ָאן ָאן די ברעגן ון‬ ָ ‫זײנע ברעגן‬ ַ ‫שלאגט זיך ָאן דער ים אין‬ ָ ‫ווי עס‬ .‫בלײבט ַאלץ שטום‬ ַ ‫און‬ ,‫בלײבן ניט שטום‬ ַ ‫מײנע אויגן‬ ַ ‫נאר‬ ָ ‫ארדעקטע אויגן‬ ַ ‫מײנע ניט‬ ַ ‫בלײבן ניט שטום‬ ַ ‫זיי‬ .‫אר דיר‬ ַ ‫האלט זיי ניט‬ ַ ‫בא‬ ַ ‫און איך‬ Waves you have stirred up in my heart, Beating against the shores of my lips, Like the sea that beats against its shores And remains always mute. But my eyes do not remain mute, They do not remain mute, my uncovered eyes And I do not conceal them before you. In this poem, Weprinsky develops an analogy between the ocean and a speaker who hears the ocean ’ s waves. Comparing herself to the roiling yet mute ocean waves, the speaker claims that she cannot utter her own turbulent heart. But unlike the waves, she can speak to her lover with her eyes. As in Glazer ’ s and Pevzner ’ s poems in earlier issues of ‫שריטן‬, Weprinsky ’ s ‫כוואליעס‬ ַ creates a place where otherwise thwarted expression is possible. The ĳinal issue of ‫ ( שריטן‬Winter 1925 / 1926 ) includes two more poems by Weprinsky and one by Malka Lee. Weprinsky ’ s poems, ‫דײן מידער‬ ַ ‫קאפּ‬ ָ ( Your Tired Head ) and ‫ ( רילינג‬Spring ), are sensuous love poems. The ĳirst compares a lover ’ s breath on a woman ’ s neck to a spill of rose petals : 26 ‫נאקן‬ ַ ‫מײן‬ ַ ‫קאפּ הענגט אויף‬ ָ ‫דײן מידער‬ ַ ; ‫ארחלשטע רויז‬ ַ ‫ווי ַא‬ ,‫איך יל ניט איר געוויכט‬ ‫איך יל בלויז דעם ָאטעם‬ ‫דײן מויל‬ ַ ‫קײקלט זיך ון‬ ַ ‫וואס‬ ָ ‫ ווייכע רויזנבליטלעך‬,‫ווײסע‬ ַ ‫ווי‬ ‫ונאנדער‬ ַ ‫און שיטן זיך‬ .‫מײן קלייד‬ ַ ‫איבער‬ 25 Weprinsky 1921 : 11. 26 Weprinsky 1925 – 1926a : 13. Your tired head leans on the nape of my neck Like a fainting rose ; I do not feel its weight, I feel only the breath That rolls from your mouth Like soft, white rose-petals And spills Over my dress. Kathryn Hellerstein : Against “ Girl Songs ” 85 In an exquisite simile, the speaker depicts the sensation of her lover ’ s close physical presence in terms of a rose that falls apart. The lassitude of his tired head, ĳigured as the “ fainting rose, ” emphasizes the approaching pleasure. As the man breathes upon the woman ’ s dress, the ĳigurative flower disintegrates, and the soft touch of its petals heightens the expectation. Weprinsky breathes new life into the rose, a convention of European love poetry wherein typically it is a man who compares his beloved woman to a rose. Weprinsky reverses the gender roles and particularizes the moment to achieve a stunningly understated erotic effect. In contrast, the second of Weprinsky ’ s poems in ‫שריטן‬, ‫רילינג‬ 1925 / 1926 depicts the revitalization of the speaker through love : 27 ,‫לײכטנדיקער רילינג ־ רעגן‬ ַ ‫דער בלוי ־‬ ‫בײטשן‬ ַ ‫בײסנדיקע‬ ַ ‫בײטשט אויף מיט‬ ַ .‫די ַאלטע ערד צום לעבן‬ ‫דײנע בלויע בליקן‬ ַ ,‫געווארן בלוט‬ ָ ‫מײן מיד‬ ַ ‫בײטשן אויף‬ ַ ‫דײנע בלויע בליקן‬ ַ ; ‫מײן געבויגענעם רוקן‬ ַ ‫רעגענען רילינג אויף‬ — ‫גלײך זיך אויס‬ ַ ‫און איך‬ .‫גלײך זיך צו דיר‬ ַ ‫איך‬ ‫מײנע ליפּן בליט דער שמייכל‬ ַ ‫אויף‬ ‫רײקייט קלוג‬ ַ ‫ון‬ ‫ווײסע אויסגעשרייען‬ ַ ‫מײנע‬ ַ — ‫מײנע הענט‬ ַ ‫און‬ .‫לאטער ון זעגלען‬ ַ ‫דא דער כּוח און דער‬ ָ ‫אין זיי איז ווידער‬ The shining-blue spring rain, Whips the old earth Back to life with biting whips. Your blue gazes Whip my exhausted blood, Your blue gazes Rain down spring onto my bent back ; And I stand up straight – I straighten up to you. The smile of ripeness blossoms Wisely on my lips, And in the white exclamations of my hands There is again the strength and the fluttering of sails. In this poem, again, Weprinsky takes a conventional poetic ĳigure, the coming of spring, and makes it new, this time through an extended metaphor rather than a simile. Comparing the lover ’ s blue gaze to the “ shining-blue spring rain ” that “ whips the old earth / back to life with biting whips, ” the speaker tells how he makes her “ stand up straight ” like a seedling and renews the strength of her “ white hands. ” In these two love poems, Weprinsky demonstrates her knowledge of old poetic conventions and her skill at making them new, in the modernist manner. The cumulative strengths of Weprinsky ’ s poems in ‫שריטן‬, which incorporate multiple aspects of sexuality into a variety of poetic forms and styles, outshine the male-composed “ girl songs ” at the start of the publication. 27 Weprinsky 1925 – 1926b : 13. 86 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ In contrast to Weprinsky ’ s depictions of pleasurable sex, Malka Lee, in ‫פּיראסן‬ ָ ‫פּא‬ ַ ‫ ( קויט‬Buy Cigarettes ! ), echoes the meter and tone of Moyshe-Leyb Halpern ’ s famous ‫גאסן ־ פּויקער‬ ַ ‫ ( דער‬The Street Drummer ), to narrate the disturbing story of a very young girl selling cigarettes on the street who is accosted by a Cossack : 28 ! ‫פּיראסן‬ ָ ‫פּא‬ ַ ! ‫פּיראסן‬ ָ ‫פּא‬ ַ ,‫גאסן‬ ַ ‫מײן שטים דורך‬ ַ ‫קלינגט‬ — ‫ארצויגן‬ ַ ‫מיט אויגן נעפּלדיק‬ ! ‫קויט ! קויט ! קויט‬ — ‫זאקן‬ ַ ‫קא‬ ָ — ‫יאגן וקסן זיך‬ ָ — ‫קאסעס‬ ָ ‫דקאוועס ווי די‬ ָ ‫פּא‬ ָ ‫מיט‬ ‫זאנגען ׃‬ ַ ‫קלאנגען ַאזוי ווי‬ ַ ‫שנײדן‬ ַ ! ‫פּיראסן‬ ָ ‫פּא‬ ַ ! ‫קויט ! קויט‬ ,‫ראד‬ ָ ‫זאק מיט ערד אין‬ ַ ‫קא‬ ָ ‫טאנצט‬ ַ ,‫האד‬ ָ ‫רא‬ ַ ‫קא‬ ַ ‫שפּרינג איך צו אין‬ ,‫גלעט די על מיט פּחד שטילן‬ — ‫מײן זיידנס תּילין‬ ַ ‫ווי איך גלעט‬ — ‫ בעטן‬,‫מײנע אויגן בעטן‬ ַ ! ‫סיגארעטן‬ ַ ! ‫קויט ! קויט‬ Cigarettes ! Cigarettes ! My voice rings through the streets With eyes overcast, cloudy – Buy ! Buy ! Buy ! Hunting foxes – Cossacks ride – With horseshoes like scythes – And cut down sounds like sheaves : Buy ! Buy ! Cigarettes ! Cossack and horse dance in a circle, So I jump into the whirl, Stroke the horsehide with quiet fear, The way I stroke my grandfather ’ s teĳillin – My eyes beg, beg – Buy ! Buy ! Cigarettes ! While Halpern ’ s street drummer is a ĳigure for the Yiddish male immigrant poet – wild, passionate, fearless, impoverished, on the street – he possesses the power of voice and instrument to respond to adversity – “ dzhin dzhin bum bum bum. ” In contrast, Malka Lee ’ s girl cigarette vendor, while also impoverished, stands on the Galician street, where she is objectiĳied sexually and violently by a Cossack. She gives in to the mute appeal of his horse and strokes it the way that she once caressed her grandfather ’ s teĳillin. The Cossack ’ s gaze transforms the girl into a reverse Salome, and forces her into an erotic dance that disempowers her : ,‫זאק מיט לייבן—אויגן‬ ַ ‫קא‬ ָ ‫קומט‬ — ‫מײן קערפּער ווי מיט שפּיזן‬ ַ ‫בריט‬ — ‫לײב‬ ַ ‫מײן‬ ַ ‫שארט מיט מעסערס דורך‬ ַ ‫מײן צוגעדעקטן קלייד‬ ַ ‫דורך‬ ...‫נאקעטקייט‬ ַ — ‫ שלינגט ער‬,‫שלינגט ער‬ — ‫שיילט ַארונטער מיט דער הויט‬ .‫ גלידער רויט‬,‫לאמען‬ ַ ‫גלידער‬ — ‫האד‬ ָ ‫רא‬ ַ ‫קא‬ ַ — ‫גאסן‬ ַ — ‫מענטשן‬ 28 Lee 1925 – 1926 : 16. Then comes a Cossack with lion-eyes, Scalds my body as with spears – Pierces through my flesh with knives – Through the dress that covers me He gulps, he gulps – nakedness… Peels off my skin – Limbs flaming, limbs red. People – streets – in a whirl – Kathryn Hellerstein : Against “ Girl Songs ” 87 ‫ראד‬ ָ ‫נאקעט — אין ַא‬ ַ ‫און איך‬ ‫ בעטן׃‬,‫און די אויגן בעטן‬ ! ‫סיגארעטן‬ ַ ! ‫קויט ! קויט‬ And I, naked – in a circle And my eyes beg, beg, Buy ! Buy ! Cigarettes ! In the end, the only thing that saves her is the Cossack ’ s declaration : that she is still a child, not a woman, and not yet an appropriate sexual object : ,‫זאק געלעכטער אויס‬ ַ ‫קא‬ ָ ‫פּראלט‬ ַ ‫פּראלט‬ ַ ‫ַאזוי ווי וועש מען‬ — — ‫טײך ַארויס׃‬ ַ ‫ון‬ ! ‫ דו שיינע קליינינקע‬,‫ַאך‬ ! ! ! ‫זא קליינינקע‬ ַ ‫דו ביסט ַא‬ Then the Cossack wrings out laughter, The way that laundry ’ s wrung out In the river : – Ach, you pretty little thing You are still such a little thing ! ! He ogles her “ with lion-eyes ” and “ pierces through my flesh with knives – / through the dress that covers me / he gulps, he gulps – nakedness ” until she whirls, “ naked – in a circle, ” still attempting to sell the cigarettes she needs to unload in order to make a living. Although it is not clear whether the Cossack actually strips and rapes her, or if she is “ only ” terrorized by his sexual gaze, the poem is shot through with the vulnerability of a Jewish girl who has no choice but to peddle her cigarettes in order to survive. By transforming her sexual victimization into a brazen modern street song, this girl survives. The editors of ‫ שריטן‬included eleven poems by six women in the last eight years of its fourteen-year publication life-span. Following the initial example of the ersatz female narrator in Zishe Landau ’ s ‫מיידלשע‬ ‫געזאנגען‬ ַ , the poems by actual women treated the topic of a modern sexuality that deviated from traditional attitudes toward marriage and childbearing. However, in contrast to the pathos of the impregnated girl in Landau ’ s sequence, the narrators in the poems by Eda Glazer, Roshelle Weprinsky, Celia Dropkin, Esther Pevzner, Berta Kling, and Malka Lee throw off the contemporary clichés of women ’ s passivity and victimization to ĳind power in the linking of their sexuality and their poetic voices. 88 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Bibiliography Dropkin, Celia, 1919 : “ In hemak. ” In : Shriftn 3 ( harbst ) : 18. Glazer, Eda ( Eda Glasser/Eda Glazer-Andrews/Edith Glasser-Andrews ), Summer 1919a : “ Flist a shtiler shtrom. ” In : Shriftn 2 ( zumer ) : 6. – 1919 b : “ Der letster klang. ” In : Shriftn 3 ( harbst ) : 19. – 1922 : In halb-shotn. New York : Farlag Kultur. – 1929 a : In Feld. Illus. N. Kozlovski. New York : Kinder. – 1929 b : Yung lebn. Illus. N. Kozlovski. New York : Kinder. – 1940 : A rayze tsu der levone. New York. Glanz [ Glanz-Leyeles ) ], Aron, 1915 : “ Kultur un di froy. ” In : Di fraye arbeter-shtime ( 30 October 1915 ) : 4 – 5. Halpern, Moyshe-Leyb, 1919 : “ Salome. ” In : In Nyu-york . Cleveland : Farlag Vink, 149 – 151. Hellerstein, Kathryn, forthcoming : “ China in One New York Yiddish Translation : Modernist Adaptation and Appropriation. ” In : Bethany Wiggin and Catriona MacLeod, eds., UnTranslatables. Evanston, il : Northwestern University Press. Hoberman, J [ames Lewis], 1991 : Bridge of Light : Yiddish Film Between Two Worlds. New York : Museum of Modern Art / Schocken Books, 105 f. Iceland [ Ayzland ], Reuven, 1912 : “ Di yunge. ” In : Shriftn : Ershtes zamlbukh 1. Illus. Z. Maud. New York : Farlag Amerika, 1 – 20 in ĳirst section. Kling, Berta ( Bertha ), 1919 : “ Teg gegarte. ” In : Shriftn 3 : 21. – 1935 : Lider. New York : n. p. – 1939 : Vi ikh shtey un gey. New York : n. p. – 1952 : Fun mayne teg. New York : n. p. Landau, Zishe, 1912 : “ Meydlshe gezangen. ” In : Shriftn : ershtes zamlbukh 1. Illus. Z. Maud. New York : Farlag Amerika, 6 – 9 in second section. – ed., 1919 : Antologye : di yidishe dikhtung in Amerike biz yor 1919. New York : Farlag Yidish. Lee, Malka, 1925 – 1926 : “ Koyft papirosn ! ” In : Shriftn 5 – 6 ( vinter ), 16. Shtok, Fradl, 1914 : “ Sonnet 8 ” ( “ Vi beyz du bist, mayn fraynd, mayn shlekhter fraynd ” ). In : Di naye heym : ershtes zamlbukh 1, 7 in the sixth section. – 1919 : Gezamlte ertseylungen. New York : Farlag Nay-tsayt. – 1928 : “ Sonnet 1 ” ( “ Vi beyz du bist, mayn fraynd, mayn shlekhter fraynd ” ). In Ezra Korman, ed., Yidishe dikhterins : antologye. Chicago : Farlag L. M. Shteyn, 98. Swartz, Sarah Silberstein, 2009 : “ Anna Margolin. ” In : Jewish Women : A Comprehensive Historical Encyclopedia. Jewish Women's Archive. Kathryn Hellerstein : Against “ Girl Songs ” 89 <http ://jwa.org/encyclopedia/article/margolin-anna>. ( last consulted on May 1, 2012 ) Weprinsky, Roshelle, 1919 : “ Fun mayne shlanke glider. ” In : Shriftn 3 ( harbst ) : 17. – 1921 : “ Ven… ” In : Shriftn 4 ( friling ) : 11. – 1925 – 1926a : “ Dayn mider kop. ”In : Shriftn 5 ( vinter ) : 13. – 1925 – 1926b : “ Friling. ” In : Shriftn 5 ( vinter ) : 13. Wilde, Oscar, 1909 : Salome : Tragedye in eyn akt. A. Frumkin, trans. London : L. Fridman. Yezierska, Anzia, 1923 : Salome of the Tenements. New York : Grosset and Dunlap. Jordan Finkin The Consolation of Sadness The Curious Exile of Dovid Hofshteyn ’ s Troyer Dovid Hofshteyn ’ s poetic cycle ‫ ( טרויער‬Sadness ; 1922 ) was written – or, more properly, given that the majority of its poems were written and published separately prior to 1922, assembled – as a response to the devastating anti-Jewish violence of 1919 – 1920.1 At the time of its conception, Hofshteyn was in Malakhovka, a refuge for orphans of the violence and a waystation for Yiddish writers, and undertook the preparation of ‫ טרויער‬in collaboration with Marc Chagall, who was living in Malakhovka at the time. The resulting dramatic modernist text, the proceeds of which were earmarked for the support of the orphans, presents a vivid and fragmented depiction of the aftermath of the violence in eleven poems of varied form and perspective, including calligrams, nature poems, Expressionist lyrics, long modernist associative rambles, and tours of the smoldering shtetl. Unlike the big-voiced protest of other contemporary pogromologies – though no less anguished for it – ‫ טרויער‬achieves its emotional ends through a less nightmarish and more “ subtle ” vocabulary of pain.2 Though Seth Wolitz has written two important articles on the art and artistry of ‫טרויער‬,3 it has otherwise received very little contemporary scholarly attention. This essay seeks to remedy that situation. As I think Wolitz rightly opines, the germinal core of ‫ טרויער‬consisted of three poems published in the second volume of the literary miscellany ‫ אייגנס‬in Kiev in 1921. Appearing under the collective heading Tristia, in Latin type, the poems present the somber and ominous existence of Jews forced into the role of prey-like victims of violence and epochal rupture. The reference to Ovid in the title is pivotal, I suggest – far more so than the few brief references to it in the literature might indicate.4 Tristia ( Sad Things ) is the title of a book of elegiac poems which Ovid wrote after he was exiled to Tomis ( present-day Constanţa in Romania ) on the Black Sea after falling afoul of 1 The literature here is robust. See for example the relevant portions of Novershtern 2003 ; Roskies 1999 ; Mintz 1984 ; as well as Wolitz 1987 : 56 – 72 ; Koller 2010 : 105 – 122. 2 One critic notes Hofshteyn ’ s “ grimly silent, deceptively dispassionate and seeming philosophical observations [ … ] ” ( Kerler 1998 : 178 ). While I do not ĳind this evaluation accurate, its intuition of a distinction in Hofshteyn ’ s diction, imagery, and technique is valid. 3 Wolitz 1995 – 1996 : 95 – 115 ; Wolitz 1997 : 111 – 129. 4 See, for example, Wolitz 1997 : 114. 92 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Emperor Augustus. For their pathos, pain, ire, resentment, and overall psychological and literary complexity, the poems of Ovid ’ s Tristia have long captivated readers as some of the most compelling literary depictions of the exilic mind. His insights have been a particular source of inspiration to modernist poets. Hofshteyn not only gestures to Ovid in the title of the poems in ‫ – אייגנס‬and in a converted form in the echoing word ‫ – טרויער‬but also adopts an Ovid-inflected persona : “ the poet as exiled protagonist. ” 5 As I will argue, however, one of Hofshteyn ’ s radical revisions of Ovid is to present that exile not as an exile from homeland ( expatrial exile ), but as exile in homeland ( intrapatrial exile ). This is the state that Hofshteyn describes so devastatingly. Consolatio ad Exulem The dominant linking ĳigure in the expanded cycle of ‫ טרויער‬is that of the devastation of Ukraine as seen through the window of a train by one of its native Jews. This perspective of fractured and dynamically shifting images has its counterpart in the modernist mechanics of the verse itself and in the accompanying artwork by Chagall.6 Wolitz sees a larger structural dynamic at work in the orchestration of the chaotic fragments, in effect a chiasm, nascent in Tristia and brought into sharper focus in ‫טרויער‬, with its hinge or pivot in the concept of “ abyss ” ( ‫ ) ָאפּגרונט‬in the sixth poem, ‫אלן‬ ַ ‫ ( אין‬In Falling ). Schematically, the chiasm runs ( in Wolitz ’ s analysis ) : “ order / chaos // chaos / hoped-for-order. ” 7 It is less “ order, ” however, that occupies the ĳinal position in both poems than a kind of consolation. This is one of the strongest points of consonance between ‫ טרויער‬and Ovid ’ s work. One of Ovid ’ s innovations in his Tristia was a revision of the traditional genre of consolatio ad exulem, or ‘ consolation of an exile. ’ His khidesh presented a ‘ self-consolation ’ and a mythologization of his exilic persona, which in many ways flout the traditional conventions of the philosophical genre, and in which “ [ … ] Ovid sets a paradigm for the literary treatment of the hopes, fears and vicissitudes of political displacement. Hereby he ĳixed many of the conventions of exilic poetry, for example the stereotyped bleakness of the place of exile, the metaphor of exile as death, and the mythologizing of the central, lonely 5 Claassen 1999 : 24. 6 This essay will not deal with Chagall ’ s artwork, but Wolitz ’ s article ( Wolitz 1995 – 1996 : 95 – 115 ) gives the most synthetic presentation of the composite text. For the image of modernist fragments in the poem see Wolitz 1997 : 114 – 118. 7 Wolitz 1997 : 116. Jordan Finkin : The Consolation of Sadness 93 ĳigure of the exile. ”8 Mutatis mutandis, this description could also serve as an eerily accurate characterization of the poems of ‫טרויער‬. However, within the fulcrum poem, “ In Falling, ” Hofshteyn has not described a Jewish existence utterly consumed by the gaping abyss, but offers a poetic consolation of sorts, a way of beginning to convert ‫ ( טרויער‬mourning, sadness ) into ‫ ( טרייסט‬consolation ). The central image of the poem describes a hunter wounding and indeed killing a white fox on the Ukrainian snows. The image of Jewish victimization needs little elaboration here. Given the biblical resonance of the cycle as a whole, the choice of the fox takes on a threnodial complexion. Not only in Ezekiel ( 13 : 4 ) 9 but also in Lamentations ( 5 : 18 ), the fox is the haunter of ruins. How much starker a visual contrast could there be than that between the white fox upon the white snow, with little black eyes and leaking red drops of blood ? 10 The red blood drops in turn act as a legible text,11 the text of a poem Hofshteyn himself is inscribing. Moreover,12 ‫אר קיינעם‬ ַ ‫נאר טרייסט איז‬ ָ ! ‫רבאטן‬ ָ ‫א‬ ַ ‫אויף ערד ניט‬ ,‫אר יקסל ַאזוינעם‬ ַ ,‫געוואלט‬ ָ ‫האט ניט‬ ָ ‫וואס‬ ָ ,‫צעשאטן‬ ָ ‫ארט זיי‬ ָ ‫האט‬ ָ ‫און‬ ,‫טראפּנס‬ ָ ‫די בלוטיקע‬ ,‫אויף זויבער ון שנייען‬ — ,‫ראנען‬ ַ ‫א‬ ַ ‫דא‬ ָ ‫נאך ַא טרייסט‬ ָ ‫איז אויך‬ But consolation is not forbidden To anyone on earth ! For such a little fox Who had not wanted it And for all that had scattered them, The bloody drops On the cleanness of the snows, There is also yet a consolation, – Though still inchoate, the cycle will go on to provide the rudimentary prescription for this consolation through a process of mythologizing. A conventional example of the consolatio ad exulem genre normally takes the form of a second-person discourse, addressed to the person in exile ( e. g., a letter ). The Ovidian self-consolation deploys ĳirst-person as well as second-person devices. In Jo-Marie Claassen ’ s account of Ovid ’ s techniques, “ To the degree that we have distinguished creative poet [ … ] and suffering exile [ … ] we may see Ovid ’ s pervasive ĳirst person narrative as a form of impersonalised mythologising. Each allusion to a mythical hero recalls an encapsulated tale. In that sense the exilic poems have an extensive subtext of untold narratives that re8 Claassen 1999 : 22, 30 f. 9 Wolitz 1995 – 1996 : 100. 10 Hofshteyn 1922 : 14 – 16. 11 “ And your poem will be so free and clean / like bloody drops / upon the snows [ … ] ” ( Ibid. : 14 ). 12 Ibid. : 16. All translations from Hofshteyn, unless otherwise noted, are my own. 94 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ late to dispossession and alienation. ” 13 Hofshteyn ’ s modernist sensibilities orchestrate the tensions of this “ dispossession and alienation ” in a similar deployment of the ĳirst and second persons. Hofshteyn ’ s swing to consolation takes place in the next poem ( the seventh ), ‫קינדער ־ שפּרוך‬ ( Children ’ s Incantation ). As Wolitz notes, “ The poetic voice reflects the dualism witnessed about. The ĳirst-person voice is splintered between the ‘ I, ’ which presents itself in its present decentered and dislocated insecurity, and its ‘ Other, ’ often addressed in the second person singular ‘ You ’ as either the past self ( Poem 7 ) or the objectivised self. ” 14 It is tempting to hear an echo here of a similar tension in Pushkin. One of Hofshteyn ’ s favorite poets,15 Pushkin penned a poem “ K Ovidyu ” ( To Ovid ) with which Hofshteyn was surely familiar. The poem was written during Pushkin ’ s own internal exile to the southern parts of the Russian empire, not too distant from Ovid ’ s own place of banishment. Stephanie Sandler notes a “ rhetorical equivocation ” in the text “ between apostrophe and self-address, between dialogue and soliloquy, ” 16 which echoes the tensions in the poem between Pushkin ’ s simultaneous identiĳication with Ovid and drawing of essential distinctions between himself and the ancient poet. Where Ovid ultimately sought eternal fame through his poetry ( though proximally seeking an easing of his punishment from Augustus ), Pushkin published his poem only anonymously.17 As we will see, Hofshteyn ’ s consolatory mode is neither the immortality of fame nor Romantic anonymity, but conscious artistic memorialization and collective ethical action. Returning to the mythic discourse, from a technical point of view biblical allusions and epigraphs serve as both the analog to the Ovidian self-mythologization as exile and the engine of Hofshteyn ’ s consolatory discourse. The two epigraphs to “ Children ’ s Incantation ” point to the despair-to-hope trajectory of the work as a whole : 18 13 14 15 16 17 18 Claassen 1999 : 70. Wolitz 1997 : 120. Sherman 2007 : 106. Sandler 1989 : 47. See Sandler 1989 : 51 – 54. Hofshteyn 1922 : 17. Hofshteyn's citation of Isaiah 25 : 8 differs slightly from the text. Jordan Finkin : The Consolation of Sadness 95 . . . ‫אסור לקראת‬ ‫בּנביאים וכתובים‬ . . . ‫ומותר לקראת באיוב‬ ( ‫) דיני אבילות‬ . . . . It is forbidden to read… Prophets and Writings, but permitted to read Job… ( Laws of Mourning ) . ‫בלע המות לנצח‬ . . . ‫ומחה אדני דמעה מכל ־ פּנים‬ ( ‫) ישעיה כ ” ה‬ He will destroy death forever, And God will wipe away tears from every face… ( Isaiah 25 ) We note the interesting irony that simply to read the second epigraph, from the prophet Isaiah, is in direct opposition to the law of mourning cited immediately before it. This confounds and denies any religious content to the consolation. That is another reason why the central intertext of this poem is not vatic, but rather is Job.19 ,‫שטאנען‬ ַ ‫בא‬ ַ ‫מײן טרייסט איז אין דעם מיר‬ ַ ,‫ראנען‬ ַ ‫א‬ ַ ‫זא עוץ איז‬ ַ ‫לאנד ַא‬ ַ ‫וואס ערגעץ ַא‬ ָ ,'‫מאן איו‬ ַ ‫האט געוווינט ַא‬ ָ ‫דארט‬ ָ ‫וואס‬ ָ ,‫וואס הייסט קיִ עוו‬ ָ ,‫שטאט‬ ָ ‫ אין‬,‫דא ָאט‬ ָ ‫און‬ ,‫יארן מיט טויזנטער שפּעטער‬ ָ ‫מיט‬ ,‫גלאטינקע בריטישע בלעטער‬ ַ ‫האב איך‬ ָ ‫געמישט‬ . . . ‫ארשריבן‬ ַ ‫ וווּ ון איו' אין זיי איז‬,‫דארט‬ ָ ‫ָאט‬ My consolation consisted in the fact that There was such a land as Utz, Where there lived a man named Job, And right here, in this city called Kiev, Thousands of years later, I turned the smoothish British pages [ of a prayerbook ], Right there where in them is written down about Job … In the fourth poem of the cycle, Hofshteyn evokes a different biblical landscape. ‫לאנד‬ ַ ‫מײן‬ ַ he says, was a beautiful valley ‫ אין גליל‬. The tokens of the life of Jesus ( son of ‫מאמע‬ ַ ‫ ) ַא ייִ דישע‬in Ukraine – the crosses on the churches – torment the Jewish traveler.20 In this spatial mapping of Ukraine and Galilee, the ‘ here ’ is unstable. This identiĳication of Ukraine with Galilee is found, however, in the pre-consolatory half of the chiasm. Its counterpart in the consolatory half is the connection of Ukraine with Job ’ s land of Utz made in the passage above. In UkraineGalilee there is torment, cruciĳixion, and pogrom. In Ukraine-Utz, however, Job suffers at the hands of God, in whom he ĳinds recourse and from whom he receives his ultimate consolation. ( How like Ovid ’ s continued pleas – alternately laudatory, plaintive, and kvetching – to Augustus, whom Ovid regularly portrays as an avatar of Jove, for clemency and even repatriation ! ) 19 Hofshteyn 1922 : 18. 20 Ibid. : 10. 96 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ A different Joban theme is brought into stark relief, however, when one compares ‫ טרויער‬to its core sequence in Hofshteyn ’ s Tristia, in which Job is deployed to up the ante on the Ovidian tropes of exilic trauma. Ovid ’ s mythologization of the poet-as-exile, drawing upon a vast array of mythological similes for his own condition, has its counterpart in Hofshteyn ’ s use of Job. And how the echo reverberates when Ovid, in his inversion of his birthday poem,21 ( Tristia iii . 13 ) writes : My birthday god ’ s here again, on time – and superfluous : what good did I get from being born ? 22 A Jewish reader cannot but think of the beginning of Job ’ s lament in chapter 3 : “ Perish the day on which I was born and the night it was announced ‘ A man has been conceived ’ ” ( Job 3 : 3 ). Ovid ’ s complaints, constant and bitter, focus on the unbearableness of his physical, spatial dislocation : both being in the inhospitable, inclement barbarian wilderness and not being in Rome. That is why the exile-as-death image recurs so often in that work. Hofshteyn, however, claims that his reality is far worse, and, through his use of Job, intimates an exile-in-homeland. Neither the pains of frigid winter nor the threat of barbarian assaults on the lonely Roman outpost can match the actual communal slaughter at the hands of erstwhile neighbors so stinging to Hofshteyn. Looking at the epigraph to Hofshteyn ’ s Tristia we ĳind the kernel of both lament and consolation which is curiously downplayed – but not erased – in ‫טרויער‬. The dedication to ‫טרויער‬, incorporated into a design by Chagall, reads “ ‫ארשניטענע‬ ַ ‫צײט‬ ַ ‫אר דער‬ ַ ‫ ( „ ַאלע‬All those cut down before their time ), with an epigraph taken from “ In Falling ” : “ I do not demand, / I only ask… ” This rhetoricizing gesture replaces the earlier dedication from Tristia : “Ale far der tsayt farshnitene gevidmet ” ( “ umibsori ekheze eloya ” Job 19 ) ( Dedicated to all those cut down before their time ” [ “ But in my flesh I will see God ” Job 19 : 26 ] ).23 The context of chapter 19 in Job is central to Hofshteyn ’ s use of the citation. In the previous chapter, Job ’ s so-called friend and would-be consoler Bildad has concluded a screed against the wicked, which is but a thinly veiled accusation that Job is complicit in his own misfortune in spurning the wise counsels of his friends. Job then complains both that his friends torment him and that God has authored such a series of cruel punishments : 24 21 22 23 24 The genethliacon genre ; see the note on this text by Peter Green ( Ovid 2005 : 251 f ). Ovid 2005 : 61. Hofshteyn 1920 : 44. Tanakh 1985 : 1365. All translations from Job are from this JPS translation. Jordan Finkin : The Consolation of Sadness 97 ‫ְחיק‬ ִ ‫ַא ַחי ֵמ ָע ַלי ִה‬ : ‫ְֹעי ַאְ ־ זָ רוּ ִמ ֶמּ ִנּי‬ ַ ‫י‬6 ‫ְרוֹבי‬ ָ ‫ָחְלוּ‬ : ‫חוּני‬ ִ ‫וּמיֻ ָדּ ַעי ְשׁ ֵכ‬ ְ ‫א ְמה ַֹתי ְלזָ ר ַתּ ְח ְשׁ ֻב ִני‬6 ַ ‫יתי‬ ִ ‫ָגּ ֵרי ֵב‬ : ‫יהם‬ ֶ ‫ינ‬ ֵ ‫יתי ְב ֵע‬ ִ ִ‫ָנ ְכִי ָהי‬ He alienated my kin from me ; My acquaintances disown me. My relatives are gone ; My friends have forgotten me. My dependents and maidservants regard me as a stranger ; I am an outsider to them. ( Job 19 : 13 – 15 ) The word for ‘ stranger ’ here – ‫ – נכרי‬is often more strongly spatial than the English word ‘ stranger ’ ; it means ‘ from a foreign place. ’ The verb meaning ‘ alienated ’ has the sense of ‘ placing afar off. ’ Taken in sum, the passage describes the psychological torments of being in exile in one ’ s own home. But Job goes on : ‫ֵעי‬ ָ ‫ָח ֻנּ ִני ָח ֻנּ ִני ַא ֶתּם‬ : ‫ ָנ ְג ָעה ִבּי‬,‫לוֹהּ‬ ַ ‫ִכּי יַ ד ־ ֱא‬ ‫אל‬-‫מוֹ‬ ֵ ‫ְדּ ֻפ ִני ְכ‬ ְ ‫ָל ָמּה ִתּ‬ : ‫וּמ ְבּ ָשִׂי לֹא ִת ְשׂ ָבּעוּ‬ ִ Pity me, pity me ! You are my friends ; For the hand of God has struck me ! Why do you pursue me like God, Maligning me insatiably ? [ or : You are not satisĳied with my flesh ]. ( Job 19 : 21 – 22 ) Job ’ s call for his friends to pity him – or show mercy to him ( ‫ – ) ָח ֻנּ ִני‬is a call for consolation they are ill-equipped to provide. It is only then that Job makes the volta in which Hofshteyn ’ s epigraph is embedded : ‫ַע ִתּי גּ ֲֹא ִלי ָחי‬ ְ ָ‫וַ ֲא ִני י‬ : ‫וְ ַא ֲחרוֹן ַעל ־ ָע ָפר יָ קוּם‬ ‫ ִנ ְקּפוּ ־ זֹאת‬,‫א ַחר עוִֹי‬6 ַ .‫לוֹהּ‬ ַ ‫וּמ ְבּ ָשִׂי ֶא ֱחזֶ ה ֱא‬ ִ But I know that my Vindicator lives ; In the end He will testify on earth – This, after my skin will have been peeled off. But I would behold God while still in my flesh. ( Job 19 : 25 – 26 ) This Vindicator ( ‫ – ) גואל‬how this recalls Ovid ’ s pleas to Augustus ! – is precisely the God who Job complains so bitterly persecutes him. But no matter his calamities, what Job wants more than anything here is a kind of poetic comeuppance to his tormenting friends : 98 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ ‫גּוּרוּ ָל ֶכם ִמ ְפּ ֵני ־ ֶחֶב‬ ‫ִכּי ־ ֵח ָמה ֲעוֹנוֹת ָחֶב‬ : [ ‫ְל ַמ ַען ֵתְּעוּן שדין ] ַשׁדּוּן‬ Be in fear of the sword, For [ your ] fury is iniquity worthy of the sword ; Know there is a judgment ! ( Job 19 : 29 ) Job trusts that God ’ s ire will punish them for their blaming of and failure to console him. Job ’ s feeling of trust ĳilters through to the conclusion of “ In Falling, ” which presents Hofshteyn ’ s most vigorous image of self-consolation : 25 ,‫ קלוגער אליז‬,‫ָא‬ ,‫אליז ון תּימן‬ ‫קלארע חריות‬ ָ ‫דײן‬ ַ . . .‫ווארעמט שוין קיינעם‬ ַ ‫ניט‬ ,‫שאטן‬ ָ ‫בא‬ ַ ‫קאפּ איז מיט ַאש ניט‬ ָ ‫מײן‬ ַ — ‫איך שטיי ַאן ַאנטבלויזטער‬ !‫רבאטן‬ ָ ‫א‬ ַ ‫גארניט‬ ָ ‫דא‬ ָ ‫אר מיר איז‬ ַ ‫נמאכט‬ ַ ‫מײן מענטשלעכער ָא‬ ַ ,‫נמאכט‬ ַ ‫מײן ָא‬ ַ ,‫נאך ון די דילן ון קלויסטערס‬ ָ ‫איז נידריקער‬ ‫ארבוקטע‬ ַ ‫ון דילן‬ ‫דורך שטערנס ון דורות‬ ‫גלײכן‬ ַ ‫ס׳האט אויך אין הייך ניט קיין‬ ָ ‫נאר‬ ָ — ‫מײן מענטשלעכע דרייסטקייט‬ ַ ‫איך וויל ון קיין טרייסטערס ניט וויסן‬ !‫דא אויף דער ערד צווישן וועלטן‬ ָ ‫ָאט‬ ,‫מײן מענטשלעכן עלנט‬ ַ ‫די גרייס ון‬ — ‫מײן טרויער‬ ַ ‫די גרייס ון‬ ,‫מײן טרייסט‬ ַ ‫דאס איז‬ ָ ‫ָאט‬ ,‫מײן געוויסן‬ ַ ‫מײן דרייסט‬ ַ . . .‫מײן כּוח‬ ַ ‫און‬ Oh, clever Eliphaz Eliphaz the Temanite, Your clear acuity Warms no one… My head is not strewn with ashes I stand stripped bare – For me nothing here is forbidden ! My powerlessness, my human powerlessness Is lower still than the floors of churches, Than floors bowed By the foreheads of generations… But in height it has also no equal My human boldness – I do not want to know any consolers Here on the earth between worlds ! The size of my human misery, The size of my sadness [ troyer ] – This is my consolation [ treyst ], My conscience My boldness And my power… The paradoxical conversion of sadness to consolation, of powerlessness to strength, is more than a poetic conceit. In this swing out of the abyss, Hofshteyn will ultimately come to an ethical conclusion. Where for Ovid there is a kind of “ psychological redemption by means of poetry ” 26 in which “ attention to the delights and endlessly playful possibilities of poetic composition [ … ] draw[ s ] the exile in another guise, as a selfconsoler, whiling away his dreary time ” 27 – though in a famous elegiac gesture Ovid laments “ that writing a poem you can read to no one is like 25 Hofshteyn 1922 : 19. 26 Claassen 1999 : 10. 27 Ibid. : 141. Jordan Finkin : The Consolation of Sadness 99 dancing in the dark ” ( Epistulae ex Ponto iv . 2 ) 28 – Hofshteyn ’ s goal is more complicated. While he was very consciously producing high modernist art, some of the contours of which this essay seeks to tease out, his primary aim is emblematized on the back cover of ‫ טרויער‬: ‫גאנצע‬ ַ ‫די‬ ‫לאניעס‬ ָ ‫קא‬ ָ ‫ ( הכנסה ונעם בוך לטו'ת די הונגערנדיקע ייִ דישע‬All of the proceeds from the sale of this book will go towards the beneĳit of the starving Jewish colonies ). The mobilization of communal support by means of the self-consolatory act of buying and appreciating new art itself enacts the conversion of powerlessness to strength. Temporality Comparison of Ovid ’ s exilic model with the way Hofshteyn constructs his poetic reality in ‫ טרויער‬points up the fact that the two diverge most obviously in the presentation of space. Ovid ’ s exile describes a Roman center and his own extreme peripheral distance. Hofshteyn has no such distance. While he is an exile – particularly in the Joban sense – he has not left his center. It is rather in the presentation of time that Hofshteyn further expands the exile-in-homeland model. In Claassen ’ s description of Ovid ’ s exilic temporality : 29 The encapsulation of time by means of the normal epistolary remove involved in true letter-writing reflects a basic aspect of exilic psychology. The poet, writing in an exilic ‘ now and here,’ projects his readers ’ reception of a poem in a future ‘ then ’ and distant ‘ there.’ A further time shift occurs when he pleads [ … ] that his readers should, at the time when they read it, remember his circumstances, already past, within which the letter-poem was written. The device conflates present, future and past. The poet-as-exile composes his verse in a “ shifting series of ‘ nows ’ ” and as a result “ [ e ]very year passed in exile forms part of an agglutinated ‘ now, ’ with very little perception of progression within it. ” 30 An intuitive apprehension of that complex static present is heightened in Hofshteyn ’ s ‘ Cubist ’ approach to the exilic tour through his homelandscape. In Wolitz ’ s analysis,31 28 29 30 31 Ovid 2005 : 176. Claassen 1999 : 185. Ibid. : 186. Wolitz 1997 : 118. 100 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ The present, recognised and depicted as dislocated, splintered and decentered in the verses is, through the poetic fragments, necessarily foregrounded. Thus the poet gives the elusive present a deĳining artistic shape – the fragment – in order to accommodate that complex of emotions attendant upon the unexpected disaster of the pogroms. The persona functions in the body of the text suspended upon the horizontal axis of chronological time and earthly space, and within the vertical synchronic axis, the poles of which are the decanted void of the sacral and the all-too real abyss. Between these four poles the persona wends a disastrous path lost in the present. In the pre-consolatory section of the cycle, especially in the calligram ‫רגאנג‬ ַ ‫א‬ ַ ‫ ( זון ־‬Sunset ), the image of decline and rupture predominates.32 However, in the consolatory section, Hofshteyn focuses on the intergenerational distribution of grief : 33 . . . ? ‫מײן זיידע‬ ַ ,‫האט ער געטרויערט‬ ָ ‫ווי‬ ,‫נאך קליינע‬ ָ ‫ קינדער‬,‫ווי וועלן זיי טרויערן‬ ,‫נאך ווילדע‬ ָ ,‫שווײגן‬ ַ ‫מײן‬ ַ ‫וואס ברעקלען דעם טונקלען געוועב ון‬ ָ ,‫באלד‬ ַ ‫גאנץ‬ ַ ‫מאכן אים‬ ַ ‫און‬ ‫און וויקלען צונויף אים‬ . . . ‫קלאנגען ון יונגן געפּילדער‬ ַ ‫אין איינעם מיט‬ How did he grieve, my distant grandfather ? How will they grieve, those still small Still wild children Who crumble the dark web of my silence, And make it soon whole And roll it up Together with the sounds of youthful noise … Here we have a polyphony of grief across multiple generations, which rejects the exilic topos of silence – not only in Ovid,34 but most classically in Psalm 137 ( “ How can we sing the Lord ’ s song upon foreign [ ‫] ֵנ ָכר‬ soil ? ” [ 137 : 4 ] ). In the poem ’ s exploration of these temporal markers, both the past ( “ grandfathers ” ) and the future ( “ children ” ) are interrogated for their interpretive insight into the consolatory speculation of the immediately preceding poem ( “ In Falling ” ). For the children – and we remember that not only is the poem offered to them as an “ Incantation, ” but the book ‫ טרויער‬itself came into being to raise money for the orphaned victims of the violence – despite the fact that they are destined to grieve, it is their noise which constitutes their power here ; ‫ איז ביז טיער‬// ,‫טאג‬ ָ ‫פּגעזאגט דער‬ ָ ‫האט געוויין דיר ָא‬ ָ / ...‫לאם ון לעבן‬ ַ ‫רײען‬ ַ ‫אר‬ ַ ‫דא טויג‬ ָ ‫„ ַאלץ‬ “ // ...! ‫צעטראגן‬ ָ ‫ווײט‬ ַ ‫ ון ָאפּשייד‬,‫ וויי ון ריס‬/ — ‫ארבליבן‬ ַ ‫נאכט דיר גלי‬ ַ ( Everything here is good 32 for the free flow of life / So the day told you all its laments, // Till deep into the night a glow remained for you – / The pain of rupture, of departure being carried far off ! // ) ( Hofshteyn 1922 : 11 ). 33 Ibid. : 17. 34 See Claassen 1999 : 129 f. Jordan Finkin : The Consolation of Sadness 101 it is their wildness which serves as the animating analog to the poet ’ s consolatory ‘ boldness ’ at the conclusion of the poem. In the present of the poem, however, the temporality is more complicated : 35 . . . ? ‫מײן זיידע‬ ַ ,‫האט ער געטרויערט‬ ָ ‫ווי‬ ,‫נאר איך רעג עס‬ ָ ,‫שטארק‬ ַ ‫עס ַארט מיך ניט‬ ‫באלייט מיך ׃‬ ַ ‫ראגע‬ ַ ‫הײנט אין שטילקייט ַא‬ ַ ‫ון רי‬ ‫באוויזן ׃‬ ַ ‫ס׳האט זיך‬ ָ ‫ און‬. . . ‫ַא סידור ַאן ַאלטן‬ — ‫) מיט דיני ־ ַא'ילות‬ ( '‫ַאן ַאלטן בית ־ יעק‬ ‫דאנקען‬ ַ ‫הײנט צו‬ ַ ‫האב איך‬ ָ ,‫מאנעלעך טרייסט‬ ָ ‫אר‬ ַ . . . ‫פּאר רישע רגעס‬ ָ ‫אר ַא‬ ַ How did he grieve, my grandfather ?... It does not concern me greatly, but I ask, From early on today silently a question accompanies me : … And it showed : An old prayerbook ( With the laws of mourning – An old Beys-Yankev ) Today I have to thank For little bits of consolation, For a couple of fresh moments … The ‘ agglutinating ’ temporality of the poem comes not from the conflict between a never-changing present and the passage of time in exile, but from reading and from text. It is precisely here that the allusion to Job mentioned earlier appears. The equation of “ little bits of consolation ” and “ a couple of fresh moments ” runs counter to the static present of Ovidian exile. The frangible modernist ‘ moment ’ for Hofshteyn is the device by which he can read Job now, how Ukraine-Utz can be here. It is not because of a simple thematic consonance with grief that the epigraph ’ s citation of the Laws of Mourning ( echoed in the passage just quoted ) permits the reading of Job but forbids the reading of the Prophets, whose vocabulary of imprecation defers its effects endlessly into the future. Echoing the experience of grief can provide consolation, but pronouncing the expectation of it provides none. It ought not to be overlooked that in this period of upheaval, rupture, dislocation, and ( thus ) exilic thinking, Hofshteyn was not the only Jewish poet invoking Ovid. The Russian poet Osip Mandel ’ shtam ’ s second book of poems, Tristia ( 1922 ) – whose title appears ( I would say signiĳicantly ) in Latin type – came out in the same year as Hofshteyn ’ s. In that volume we see a similar interest in reconĳigurations of time and space. To take but one example, in an untitled poem ( dated 1917 ) we see a young Levite at his vigil during the rebuilding of the Temple.36 35 Hofshteyn 1922 : 17 f. Emphasis my own – note again the foregrounding of silence. 36 Mandel ’ shtam 1922 : 30. Translations from Mandel ’ shtam are my own. 102 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ He said : the sky is an alarming yellow, Night is already upon the Euphrates, so run, Priests. These compact lines present a complicated exilic consciousness. The Jews have returned to Jerusalem, the Babylonian exile is over, and the Temple is being rebuilt. However, for the young Levite – a high functionary of the Temple cult whose very ofĳice revolves around Jerusalem ’ s centrality in and to the world – time is not reckoned by the present place but rather from his native Mesopotamian time zone. If the sky is twilit yellow here in Jerusalem, then it must already be dark in Babylon ; and therefore the Sabbath must soon begin here. The realities of “ here, ” the supposed center, are irrelevant to a consciousness of one ’ s homeland. And as the poem concludes : 37 And with the heavy Menorah we illumined The Jerusalem night and the charcoal-fumes of nonexistence. The poem describes competing claims to the meaning of home based on a realignment of how time and space are understood. A homeland which is not home is like a wisp of sacriĳicial smoke, indeed a “ nonexistence. ” This is one dramatic conceptualization of exile. Hofshteyn is more ambivalent about the biblical imagery. Nevertheless, he is explicit in the case of Ukraine-Utz that the biblical landscape is textual and not historical. Ukraine One of the clearest points of breakdown between the exilic discourse of Ovid ’ s Tristia and Hofshteyn ’ s is suggested by Pushkin. In “ To Ovid ” Pushkin ’ s identiĳication with the Roman poet only goes so far : “ As a severe Slav, I have not shed any tears, / But I understand them. ”38 In reappropriating Ovid ’ s denigration of the co-territorial barbarians ( Scythians, Sarmatians, Getae ), Pushkin goes on to say that while the rugged wilds and inclement frigidity of the Black Sea shore may have been inimical to the Italian, to the Slav they were more than familiar. ( Ovid ’ s frigid North is Pushkin ’ s South. ) His exile was in a way much closer to home. The image of exile that Hofshteyn paints is much closer still. One of Hofshteyn ’ s earlier poetic achievements, and part of what has secured his enduring legacy in Yiddish poetry, was the body of lyrical por37 Ibid. 1922 : 30. 38 Sandler 1989 : 43. Jordan Finkin : The Consolation of Sadness 103 traits of the rural beauty of his native Ukraine. I would like to conclude this essay by turning to the important second poem of ‫טרויער‬, entitled ‫אוקראינע‬ ַ ( Ukraine ).39 There are two contemporary corpora into which this poem ĳits. As part of the cycle ‫טרויער‬, it can be placed, as has generally been done, alongside the other great pogromologies of 1919 – 1920, including Perets Markish ’ s ‫ ( די קופּע‬The Heap ) and Leyb Kvitko ’ s 1919. However, it can also be paired with Markish ’ s ‫וואלין‬ ָ ( Volhynia ) and Moyshe Kulbak ’ s ‫רײסן‬ ַ ( White Russia ), as distinctly intimate evocations of the poets ’ native Eastern European space as homeland. These two parallel, or indeed overlapping, readings point directly at the exile-inhomeland theme that Hofshteyn develops so powerfully. Structurally, the poem “ Ukraine ” forms an apostrophe to the poet ’ s native Ukraine as he travels by train over that landscape in the aftermath of the pogroms. The train-car vantage point allows for kaleidoscopic, and nearly simultaneous, pulses of nightmarish images and the meditations they inspire : the “ wasted cities, ” the gentle ĳields, the marketplaces with their violent rabbles, the Dnieper and the steppes. And even though the poetic persona is a traveller there after the fact, he implicates himself in the vista of destruction : 40 ‫ [ ווי עס שווינדלען‬. . . ] ‫מײנע חור'ות‬ ַ ‫ָא ַאזיסן ון‬ ,‫לאך ון עלדער מילדע‬ ַ ‫אויף ברייטער‬ ‫רשאטענע‬ ָ ‫א‬ ַ ‫שטיל‬ ,‫בענקשאט‬ ַ ‫מיט‬ ‫ײכטע‬ ַ ‫בא‬ ַ ‫רײך‬ ַ . . . ‫מײן בלוט‬ ַ ‫מיט‬ [ … ] As oases of my ruins Reel Over the broad plain of gentle ĳields, Quietly strewn With longing, Richly moistened With my blood… The juxtaposition of the silence and the bloodshed are part of the associative structure of “ ruins. ” Hofshteyn ’ s own possessive vocabulary – “ my ruins, ” “ my blood ” – shows that in vieweing scenes of destruction from the train, he has become distanced from his own real, physical body ; this is part of the psychic toll the devastation of the pogrom has taken on the poet. Because of both his transience and his dissociation ( so beautifully illustrated by Chagall on the cover of ‫ טרויער‬by a twoheaded man, one head with a face and one without, pierced through the chest by the word “ troyer ” ), the poetic persona can only be called an exile. But for all the violence of the bandit-like, drunken perpetrators, the poet ’ s erstwhile neighbors, and all his incomprehension ( “ What outweighs / A drop of blood / From a childlike / Innocently-beautiful 39 This poem was ĳirst published in full in the journal Shtrom 2 ( 1922 ) : 26 – 28. 40 Hofshteyn 1922 : 7. 104 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ being… ” ),41 Hofshteyn cannot help but speak affectionately about this place, which is still his home and homeland, after all : 42 ‫נאך ׃‬ ָ ‫איך יל מיט ליבע‬ ‫געפּלאצט‬ ַ ‫דא ניט‬ ָ ‫האט קיין שויב‬ ָ ‫עס‬ ,‫דײנע‬ ַ ‫אין בערג ־ טורעמס אין‬ ,‫נאך‬ ָ ‫ לויטער‬,‫וואס קוקן‬ ָ ,‫אויף די געוויסערן ון דניעפּר‬ . . . ‫דײנע‬ ַ ‫אויף סטעפּעס‬ I still feel with love : No windowpane here has been broken In your mountain-towers That look out, still pure, Over the floods of the Dnieper, Over your steppes … This self-consciously loving description of the landscape – the mountains, the Dnieper ( which echoes other bucolic river scenes used to construct the literary landscape of homeland in Kulbak ’ s descriptions of the Nieman River in ‫רײסן‬ ַ or in Markish ’ s depictions of the Horyn River in ‫וואלין‬ ָ ), and the steppe – participates in a discourse of home and homeland, and folds it over onto the modernist catastrophe genre. Hofshteyn, however, brings his description to a head by explicitly inverting precisely the paradigm of exile that was complicated in the folding-over of discourses.43 ‫דאס אויך ׃‬ ָ ‫איך ווייס‬ ‫לאנג‬ ַ ‫ביסט דורות‬ ‫פּלאץ‬ ַ ‫געווען ַא מיקלט ־‬ ‫אר אויסוווּרן‬ ַ . . . ‫לאנד‬ ַ ‫ון גרויסן גרויען‬ ‫זײנע‬ ַ ‫אויף ַאלע ־ ַאלע שטרעקעס‬ ,‫שאנד‬ ַ ‫דײן‬ ַ ‫שאטנט זיך‬ ָ ! ‫אוקראיִ נע‬ ַ I know this too : You were for generations A place of refuge [ miklet-plats ] For the exiles [ oysvurfn ] From the great grey land… Over all-all of its distance Your shame hides itself, Ukraine ! There is doubtless an ideological dimension in these lines, as elsewhere in the poem. ( Wolitz for his part makes a case for an overtly political reading of the poem as a “ fellow-traveller dirge. ” 44 ) The complexity of Hofshteyn ’ s modernist polyphony may be unpacked still further, however, beyond these ideological dimensions. 41 Ibid. : 7. 42 Ibid. : 8. 43 Ibid. As Wolitz assesses this passage, Hofshteyn ’ s “ moral and social protest defends his own and his folk ’ s right to inhabit the Ukraine no less than the Gentile peasant ” ( Wolitz 1997 : 122 ). 44 Wolitz will make an analogous and similarly persuasive case for Perets Markish ’ s long poem ‫דיא‬ ָ ‫רא‬ ַ ( Radio ; 1922 ) as a brilliant exponent of Yiddish agitprop ( Wolitz 2011 : 103 – 113 ). Jordan Finkin : The Consolation of Sadness 105 Let me here recapitulate some of the intuitions I have written of elsewhere about how a sense of homeland ĳits into an oppositional construction of Exile and Diaspora.45 Hofshteyn ’ s use of “ generations ” as the temporal measurement, which we have seen elsewhere in the cycle, presents the familial or tribal element over against the national or historical vocabularies used to inscribe Jewish life in Ukraine. This in turn sets up the core biblical intertext which follows. The phrase Hofshteyn uses, “ place of refuge ” ( miklet-plats ), is a calque of the Hebrew měqōm miqlāṭ, with the same meaning. That phrase is itself a later Hebrew synonym for the biblical ‘ īr miqlāṭ ( city of refuge ). Of the seven Hebraic words used in “ Ukraine, ” this is both the most marked and the least common. Given both the carefulness and the relative straightforwardness of Hofshteyn ’ s diction in general, and the relative paucity of Hebraic words in his work as a whole, this word choice seems particularly semantically fraught. The term ‘ īr miqlāṭ is used in the book of Numbers, as well as elsewhere in the Bible,46 to refer to a speciĳically urban settlement singled out as a place to which someone who has unintentionally killed a person may flee for safety from retribution. At the very least, the stigma of some kind of guilt attaches to anyone seeking out such a place. However, Hofshteyn ’ s refuge-seekers are not – or not simply – the manslaughterers associated with the biblical term. Instead they are explicitly referred to as ‘ exiles ’ ( ‫) אויסוווּרן‬. The term is itself a study in a kind of modernist ambiguity, in that it can mean both ‘ exile as outcast ’ and ‘ exile as outlaw. ’ Interpretation is a matter of perspective. The generational timescale, biblical intertext, and an association of travellers ( ‫ ) וסגייער‬and wanderers ( ‫וואנדערער‬ ַ ) with the demography of the steppes all implicate both Jews and non-Jews in Hofshteyn ’ s understanding of space. Hofshteyn makes no claim to sacredness of place ; rather, he verges on his own version of sentimentality when describing his native environs. Nevertheless, in deploying the Ovid-inflection of ‫ – טרויער‬Tristia he inverts the exilic trope implicit in that association : Jews are ultimately no more in exile in Ukraine than are its non-Jewish denizens, and therefore equally at home. This is precisely the reason that “ place of refuge ” ( miklet-plats ) is presented as an inversion of “ city of refuge ” ( ‘ īr miqlāṭ ). The train-travelling voyeur has become an exile in his own home. To conclude, never forgetting that the work is a profound expression of grief and sadness at the all-too-real destruction and bloodshed, 45 This discussion is part of my monograph manuscript “ An Inch or Two of Time : Time and Space in Jewish Modernisms. ” 46 Numbers 35, Joshua 20 and 21, i Chronicles 6 ; in the Bible the word miqlāṭ occurs only in the phrase ‘ īr miqlāṭ. 106 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ it is nevertheless also a consummate work of modernist art, one which tries to understand that sadness in a variety of ways. At the risk of overindulging the intertextuality of Troyer – Tristia, I think Hofshteyn ’ s connection with Ovid ’ s Tristia is more than fortuitous, especially since Pushkin and Mandel ’ shtam evince a similar sort of connection to it. The thematic consonance is simply too great. Hofshteyn subverts the traditional understanding of Exile ( goles ; gālūt ) as a distinctly negative experience of negated space ( i.e., absence from the center, from homeland ). The privations and depredations of anti-Jewish violence do not arise out of or as a result of a state of being in such an Exile. After all, Hofshteyn is very clear in describing this Ukrainian landscape as the poet ’ s homeland, his center. In this Diasporic, as opposed to Exilic, state – a state of being that is consonant with the progressive ideals of the revolution with which Hofshteyn sympathized – an exilic condition is still possible. But it is an exile understood by modernist means. Hofshteyn orchestrates the spatial and temporal complexities of exile, complexities implicit in the very idea of writing about it ( classically in Ovid ), in conversation with a strongly read tradition of consolation and circumspection ( especially Job ). In doing so, he advocates a communal cohesion – and its ethical core – which can still participate in a universalized, humanist project. Bibliography Claassen, Jo-Marie Claassen, 1999 : Displaced Persons : The Literature of Exile from Cicero to Boethius. London : Duckworth. Hofshteyn, Dovid, 1920 : “ Tristia. ” In : Eygns 2 : 44 – 54. – 1922 : Troyer. Kiev : Kooperativer farlag “ Kultur-lige ”. Kerler, Josef, 1998 : “ Dovid Hofstein – Our First Wonder. ” In : Dov-Ber Kerler, ed., Politics of Yiddish : Studies in Language, Literature, and Society. Walnut Creek, ca : AltaMira Press, 171 – 185. Koller, Sabine, 2010 ; “ ‘ The Air Outside is Bloody ’ : Leyb Kvitko and His Pogrom Cycle 1919. ” In : Gennady Estraikh and Mikhail Krutikov, eds., Yiddish in Weimar Berlin : At the Crossroads of Diaspora Politics and Culture. Oxford : Legenda, 105 – 122. Mandel ’ shtam, Osip, 1922 : Tristia. Petersburg – Berlin : Petropolis. Mintz, Alan L., 1984 : Ḥurban : Responses to Catastrophe in Hebrew Literature. New York : Columbia University Press. Novershtern, Avraham, 2003 : Qesem ha-dimdūmīm : ’ Apōqālīpsāh u-měšīḥiyyūt bě-sifrūt yīdīš. Jerusalem : Magnes Press, Hebrew University. Jordan Finkin : The Consolation of Sadness 107 Ovid, 2005 : The Poems of Exile : Tristia and the Black Sea Letters, trans. Peter Green. Berkeley : University of California Press. Roskies, David G., 1999 : Against the Apocalypse : Responses to Catastrophe in Modern Jewish Culture. Syracuse : Syracuse University Press. Sandler, Stephanie, 1989 : Distant Pleasures : Alexander Pushkin and the Writing of Exile. Stanford : Stanford University Press. Sherman, Joseph, 2007 : “ David Hofstein ( Dovid Hofshteyn ). ” In : Joseph Sherman, ed., Writers in Yiddish. Dictionary of Literary Biography, vol. 333. New York : Thomson Gale, 98 – 107. Tanakh 1985 : Tanakh : The Holy Scriptures. Philadelphia : The Jewish Publication Society. Wolitz, Seth, 1987 : “ A Yiddish Modernist Dirge : Di Kupe of Perets Markish. ” In : Yiddish 6 ( 4 ) : 56 – 72. – 1995 – 1996 : “ Chagall ’ s Last Soviet Performance : The Graphics for Troyer, 1922. ” In : Jewish Art 21 / 22 : 95 – 115. – 1997 : “ Troyer ( Grief ) – Hofshteyn ’ s Fellow-Traveller Dirge. ” In : Slavic Almanach : A Year Book of the South African Society for Slavic, Central, and East European Studies 4 ( 5 – 6 ) : 111 – 129. Wolitz, Seth, 2011 : “ Markish ’ s Radyo ( 1922 ) : Yiddish Modernism as Agitprop. ” In : Joseph Sherman, Gennady Estraikh, Jordan Finkin, and David Shneer, eds., A Captive of the Dawn : The Life and Work of Peretz Markish ( 1895 – 1952 ). Oxford : Legenda, 103 – 113. Avrom Sutzkever : Self portrait Courtesy of Mire Sutzkever Heather Valencia From Der tsirk to Erev mayn farbrenung The Transformation of Experience in Two Poems by Avrom Sutzkever Every literary treatment of an experience involves a process of transformation, and the theme of the ‫( חורבן‬the Holocaust) is one of the key strands in Sutzkever ’ s work that constantly undergoes development and metamorphosis throughout his poetry and prose, from his contemporaneous treatment of it until the end of his creative life.1 A signiĳicant early example of this can be seen in three works based on an ordeal which Sutzkever endured in the Vilna ghetto in the summer of 1941. Together with an elderly rabbi and a boy, he was seized by a German stormtrooper and forced to dance naked round a ĳire, singing Russian songs and tearing up and burning Torah scrolls in front of a crowd of spectators. Eventually the victims were allowed to dress and escape. This traumatic event gave rise to two poems and a prose account. The poem ‫ ( דער צירק‬The Circus ), written shortly after the event, in July 1941,2 was not published until 1978, when it appeared together with other previously unpublished ghetto poems.3 The prose description is contained in Sutzkever ’ s memoir ‫געטא‬ ָ ‫ ( ווילנער‬Vilna Ghetto ), written between 1944 and 1946.4 In 1949 Sutzkever wrote a second poem arising from this incident, ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ ( ער‬Before My Burning ), publishing it in the volume ‫וואגן‬ ָ ‫ײער ־‬ ַ ‫ ( אין‬In the Fiery Chariot ),5 his ĳirst collection of poetry published in Israel. In a talk given to launch the book, Sutzkever focussed speciĳically on ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ער‬, saying : 6 ‫גראיע ון ַא ליד איז ַא סך לענגער און‬ ַ ‫ביא‬ ָ ‫די‬ .‫דאטע ווען ס ‘ווערט ָאנגעשריבן‬ ַ ‫עלטער ווי די‬ ‫ַא ליד ווערט אויסגעשפּיגלט און אויסגעטיגלט‬ ‫ [ ָאבער כּדי‬. . . ] ‫גאנץ לעבן‬ ַ ‫מאל ַא‬ ָ ‫ ַא‬,‫יארן‬ ָ ‫לאנגע‬ ַ The biography of a poem is much longer and older than the date when it was written. The image and form of a poem evolve over a long period of years, some- 1 Cf. Valencia 2004 : 217 – 239. 2 There is a discrepancy about the date of the actual event : in ‫געטא‬ ָ ‫ ווילנער‬Sutzkever states that it took place in August 1941, whereas the inscription at the end of the poem ‫דער‬ ‫ צירק‬reads 1941 ‫ ָאנהייב יולי‬,‫באהעלטעניש‬ ַ ‫ ( געשריבן אין ַא‬Written in a hideout, beginning of July 1941 ). 3 96 / 95 ‫גאלדענע קייט‬ ָ ‫די‬. The poems then appeared in book form : Sutzkever 1978. 4 Sutzkever 1947. 5 Sutzkever 1952 : 115 – 117. 6 Novershtern 1983 : 177. All translations are by the author. 110 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ " ‫לקט‬ ‫בארוכפּערט‬ ַ ‫ מוז עס‬,‫זאל זיך געבוירן‬ ָ ‫דאס ליד‬ ָ ‫ווערן מיט ַא „ קלייניקייט “ — די קלייניקייט קען‬ ‫ ַא בליק ון ַא חיה‬,‫צווײגל‬ ַ ‫באוועגונג ון ַא‬ ַ ‫זײן די‬ ַ .‫טראפּן אוין פּנים ון ַא שויב‬ ָ ‫ [ צי ַא רעגן ־‬. . . ] ,“ ‫ָאבער ָאן ָאט דער געבענטשטער „ קלייניקייט‬ ‫כא ָאס‬ ַ ,‫געזאנג‬ ַ ‫רוואנדלט ווערטער אין‬ ַ ‫א‬ ַ ‫וואס‬ ָ ‫ [ קען‬. . . ] ‫ טרערן אין אויסלייזונג‬,‫רמאניע‬ ָ ‫הא‬ ַ ‫אין‬ ‫ און סע טרעט ַאז‬.‫דאס ליד ניט געבוירן ווערן‬ ָ ‫רײן דער‬ ַ ‫בלאזט ַא‬ ָ ‫ערשט מיטן ָאטעם ון טויט‬ .‫געזאנג — לעבן‬ ַ ‫זײן‬ ַ ‫דיכטער אין‬ times a whole lifetime [ … ] But in order for the poem to be born, its seed must be fertilised by a ‘ trifle ’ – the trifle can be the movement of a twig, the glance of an animal [ … ] or a raindrop on the face of a window-pane. Without this blessed ‘ trifle, ’ which transforms words into song, chaos into harmony, tears into redemption [ … ] the poem cannot come into being. And it may well happen that only with the breath of death does the poet breathe life into his song. His singling out of this poem as a paradigm of the poetic process, coupled with the ĳinal sentence of these remarks – that the life of a poem can emerge from the ‫ – ָאטעם ון טויט‬as well as the intriguing fact that the poem ‫ דער צירק‬was withheld from publication for so many years, are indicators that this incident and the works arising from it were of particular signiĳicance to the poet. A study of the evolution of ‫מײן‬ ַ ‫ער‬ ‫ארברענונג‬ ַ , taking into account the two earlier stages in its biography – the poem ‫ דער צירק‬and the prose description of the incident – affords insights into Sutzkever ’ s poetic process of transformation. ‫געטא‬ ָ ‫ווילנער‬, written while Sutzkever was in Moscow between 1944 and 1946, bears witness to the atrocities inflicted on the Jews of Vilna by the Nazis and their collaborators. Its purpose is to give factual information, and Sutzkever ’ s description of this ordeal is very detailed. The stormtrooper ’ s mocking words of “ comfort ” to his victim, in which the origin of the title of the 1941 poem can be seen, are reproduced : 7 ‫ איך‬.‫טאן קיין שלעכטס‬ ָ ‫ [ וועל איך נישט‬. . . ] ‫דיר‬ ‫בײ מיר‬ ַ ‫בײ היטלערן ! דו וועסט בלויז‬ ַ ‫שווער‬ .‫גארנישט‬ ָ ‫ מער‬,‫שפּילן אין ַא צירק‬ [ … ] I will not do you any harm. I swear it by Hitler! You’re simply going to perform in a circus, that’s all. The poet describes his fear, his attempts to bribe his captor with a watch, the appearance of the old rabbi, the boy ’ s terror. We witness the way their clothes were neatly laid in a pile and covered by the rabbi ’ s prayer-shawl, the tire marks all over the scattered Torah scrolls, the frail old man ’ s difĳiculty tearing the stiff parchment, and his suffering when pushed near the ĳire by the Nazis : 8 7 8 Sutzkever 1947 : 28. Ibid. Heather Valencia : From Der tsirk to Erev mayn farbrenung 111 ‫האט‬ ָ ‫ דער רויך‬.‫רמאכט די אויגן‬ ַ ‫א‬ ַ ‫האט‬ ָ ‫דער ר‬ ‫האט זיך ַארויסגעריסן‬ ָ ‘ ‫ ס‬.‫אים ַארומגעקנוילט‬ .“ ‫זײן מויל ַאן „ אוי‬ ַ ‫ון‬ The rabbi closed his eyes. The smoke wreathed around him. Out of his mouth came a groan: “ Oy ! ” Finally Sutzkever gives dispassionate details of the end of the ordeal : 9 ‫רײן אין דער חרוער קלויז און זיך‬ ַ ‫דער ר איז ַא‬ ,‫נטלאן‬ ָ ‫דאס ייִ נגל איז ַא‬ ָ .‫דאווענען‬ ַ ‫געשטעלט‬ ‫ זיך ַאוועקגעלייגט‬,‫רײן‬ ַ ‫איך בין אויך אין קלויז ַא‬ ‫מארגנדיקן‬ ָ ‫דערווארטונג אוין‬ ַ ‫ אין‬,‫אין ַא ווינקל‬ .‫טאג‬ ָ The rabbi entered the destroyed studyhouse and began to pray. The boy fled, and I went into the study-house too and lay down in a corner to await the next day. In this report, there is no suggestion of the existential questioning which underpins both poems, but several speciĳic similarities and discrepancies between the prose account and the poems should be mentioned. Sutzkever comments on the comfort he derived from the old man ’ s composure : 10 ‫זײן בליק‬ ַ ‫ און‬,‫געטאן אוין זקן‬ ָ ‫האב ַא קוק‬ ָ ‫איך‬ .‫מײן מורא‬ ַ ‫האט ָאפּגעטייט‬ ָ I looked at the old man and the look on his face conquered my fear. The character of the old rabbi is of seminal signiĳicance in ‫מײן‬ ַ ‫ער‬ Absent from the prose account is any comment on the behavior of the crowd, or on the writer ’ s emotions after the ordeal. In ‫דער‬ ‫צירק‬, however, these two aspects are very important. As in all his prose writing, Sutzkever uses poetic strategies to arouse emotional responses. The image of the rabbi begins its transformation from human individual to the symbolic ĳigure he becomes in the poems : 11 ‫ארברענונג‬ ַ . ‫שווארצע‬ ַ ‫ די‬,‫ווײס ווי שניי‬ ַ ,[ . . . ] ,‫ַא נידעריקער‬ .‫נאך נידעריקער‬ ָ ‫מאכט אים‬ ַ ‫פּאטע‬ ָ ‫קא‬ ַ ‫לאנגע‬ ַ ‫אר ַא‬ ַ ‫ארגרימירט‬ ַ ‫ ער איז ַא קינד‬,‫דאכט‬ ַ ‫מיר‬ .‫זקן‬ 9 Ibid. : 28. 10 Ibid. : 27. 11 Ibid. : 26. A small ĳigure [ … ] white as snow, his long black gaberdine makes him even smaller. To me he seems like a child disguised as an old man. 112 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ " ‫לקט‬ This is a dramatic visual image of contrasting black and white, and the idea of the child conveys the helplessness of the victim. He acquires stronger symbolic status during the enforced dance : 12 ‫שײן ון‬ ַ ‫ אין‬,‫אײנגעשרומפּענער גוף‬ ַ ‫דארער‬ ַ ‫זײן‬ ַ ‫האט אויסגעזען ווי ַא‬ ָ ,‫שײטער‬ ַ ‫אויסגייענדיקן‬ .‫רצײטליכט אויסגעבויגן און געל‬ ַ ‫יא‬ ָ ‫וואקסענע‬ ַ His thin shrivelled body looked, by the glow of the dying ĳire, like a wax memorial candle, bent over and yellow. The image of the melting memorial candle links the rabbi to the idea of death but also to that of hallowed memory. A similar juxtaposition of Nazi desecration with Jewish holiness and beauty is present in the description of the deĳiled Torah scrolls : 13 ‫אר־‬ ַ ‫ [ מיט צעריסענע‬. . . ] ‫ַא הוין סר ־ תּורות‬ ‫ דורכגעזוימט מיט זיל־‬,‫בלוטיקטע מענטעלעך‬ .‫בערנע עדעם‬ A heap of Torah scrolls [ … ] with torn, bloodstained mantles bordered with silver thread. Sutzkever also introduces one of his key images, the sunset, in the description of the bonĳire : 14 ‫קרא ט‬ ַ ‫לאקער מיט מער‬ ַ ‫האט דער‬ ָ ‫שפּעטער‬ ‫פּארמעט און מיט ַא‬ ַ ‫זיך ַאדורכגעריסן דורכן‬ ‫געטאן אין דער הויך צו דעם‬ ָ ‫קנאק ַא לייץ‬ ַ .‫רגאנג‬ ַ ‫זונא‬ ַ ‫ײער ון‬ ַ Later the flames burst more powerfully through the parchment and with a crackling sound surged upwards to the ĳire of the sunset. As well as contributing to the visual power of the scene, this image brings together symbolically the iniquitous ĳire of the violators and that of the natural universe, the sunset, which emphasizes the grotesque dichotomy between the two, intensifying the desecration. The sunset image recurs at the beginning of ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ער‬. It is clear, therefore, that although Sutzkever ’ s prose narrative is detailed and factual, he subtly employs poetic devices to engage the reader and suggest moral issues, which are indeed the central focus of both the poems. 12 Ibid. : 28. 13 Ibid. : 27. 14 Ibid. : 28. Heather Valencia : From Der tsirk to Erev mayn farbrenung 113 The most important study of ‫ דער צירק‬to date is Yechiel Szeintuch ’ s essay 15 “ ‘ ‫ דער צירק‬, ‫גראיע ון ליד‬ ַ ‫ביא‬ ָ ‫ „ די‬in which he assesses the poem ’ s signiĳicance within Sutzkever ’ s ghetto poetry. He maintains that in all previous poems the lyrical ‫ איך‬had been an individual, personal ‫איך‬ whereas here,16 ‫וואס‬ ָ ,‫קאלעקטיווער איך‬ ָ ‫ [ איז עס ַא לירישער‬. . . ] ‫נאמען ון ַא מיר — ברט אין‬ ָ ‫רעדט ס ‘רו אין‬ ‫ אין דער‬.‫שאונג‬ ַ ‫דער ערשטער העלט ון דער‬ ‫צווייטער העלט רעדט אויך דער פּערז ענלע־‬ ‫ארבינדונג מיט‬ ַ ‫ ָאבער דורכאויס אין‬,‫כער איך‬ ‫ צו וועמענס מדרגה ער‬,‫היסטארישן כּלל‬ ָ ‫ַא‬ ‫ ָאבער ער איז צו דעם‬,‫שט רעבט צו דערגרייכן‬ .‫ניט מסוגל‬ [ … ] it is a lyrical collective I which generally speaks in the name of a we – especially in the ĳirst half of the work. In the second half the personal I also speaks, but always in connection with a historical collective, whose level he is striving to reach, but cannot. Szeintuch analyses the struggle of the ‫ איך‬in terms of four interlinked themes which run through the poem : the relationship between the individual and the collective, the motif of the ‫גאלדענע קייט‬ ָ ( The Golden Chain ), the desecration of the Torah scroll, and the theme of ‫קידוש‬ ‫ ( השם‬martyrdom ). The attempt of the individual ‫ איך‬to become a link in the chain which represents ‫ ון‬,‫טראדיציע ון לעבעדיקער המשכדיקייט‬ ַ ‫ַא‬ ‫ ( צוגעבונדנקייט צום כּלל ון ַא יחיד‬a tradition of living continuity, of the attachment of the individual to the community ) 17 is for him the central theme of the poem. The poem ’ s speaker fails to achieve this, ĳirst, by his act of tearing up the Torah scroll, which for Szeintuch represents the destruction of ‫אויסטײטש ון מענטשלעכער עקסיסטענץ‬ ַ ‫ ( דעם ייִ דישן‬the Jewish interpretation of human existence ),18 and second, by his inability to choose death rather than betrayal of Jewish belief and honor. Paradoxically, in a situation where the moral foundations of Jewish life are being destroyed, the only way to keep the chain unbroken may be voluntary death : ‫קידוש ־ השם‬. In my analysis of this poem, I am indebted to Szeintuch ’ s insights, but my interpretation diverges from his in one signiĳicant respect. For the speaker ’ s failure to achieve ‫קידוש ־ השם‬, Szeintuch concludes, he accepts punishment, but at the same time acquires a mission : 19 15 16 17 18 19 Szeintuch 1983 : 258 – 279. Ibid. : 258. Ibid. : 267. Ibid. : 265. Ibid.: 269. 114 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ " ‫לקט‬ ‫פּאעט ניט דער־‬ ָ ‫האט דער‬ ָ ‫צו ָאט דער מדרגה‬ ‫ [ דער מקור‬. . . ] ‫דעראר‬ ַ ‫דאס ווערט‬ ָ ‫גרייכט און‬ ‫ ָאבער אין דער זעלביקער‬,‫ון ַא שולדגעיל‬ ‫ווײטער צו‬ ַ ‫זײן כּוח‬ ַ ‫אר‬ ַ ‫צײט אויך ַא מקור‬ ַ ‫זײן‬ ַ ‫שטראף — צו‬ ָ ‫שאן און נעמען אויף זיך די‬ ַ ‫זײנע‬ ַ ‫ַא לעבעדיקער עדות ון אומקום דורך‬ .( 89 — 88 ‫ליד ער ) שורות‬ The poet has not attained this level and his failure therefore becomes [ … ] the source of a guilt feeling, but at the same time a source of his strength to carry on creating, and to take upon himself the punishment – to be a living witness of the annihilation through his poems ( lines 88 – 89 ). The ĳinal lines of the poem ( lines 88 – 91 ) read : 20 ‫האלב געטייט‬ ַ ‫שטראף צו זשיפּען‬ ָ ‫דײן‬ ַ ‫דאס‬ ָ ‫איז‬ .‫כארכל ון די ברידער‬ ָ ‫און רעסן גסיסה ־‬ ‫ארדינט די לעצטע רייד‬ ַ ‫האסט ניט‬ ָ ‫ווײל דו‬ ַ .‫ ון ווערן ווידער‬: ‫דאס מיינט‬ ָ — ‫ון ווערן אויס‬ That is your punishment, to gasp half dead and gobble down the death-throes of your brothers. Because you have not earned the last joy of dying – which means: of being reborn. Szeintuch ’ s analysis implies that there is, implicitly, an optimistic note in these ĳinal lines, the idea of expiation and poetic mission. In my view this is not the case : this poem ends in despair, and the sense of poetic mission is not realised until Sutzkever reworks the material eight years later in ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ער‬. Szeintuch does mention at the end of his essay that “ ‫ דער צירק ‘ ַא תּיקון‬, ‫באקומט‬ ַ ‘ ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ער‬, ‫ ( „ אין ליד‬In the poem “ Erev mayn farbrenung ” the poem “ Der tsirk ” attains completion) but he does not develop this. However, by comparing and contrasting both poems, it becomes clear that ‫ דער צירק‬is only the ĳirst stage in a complex process of metamorphosis through which Sutzkever transforms concrete experience into poetry. ‫ דער צירק‬is divided into three sections. The ĳirst of these consists of four unequal parts, dealing with the question of collective and individual guilt and introducing the central moment of the poem, the “ circus ” in which the ‫ איך‬and the two other Jews were forced to perform. In the ĳirst three parts, which are in free verse with varying rhythms, the speaker questions himself and his fellow Jews. Here, as Szeintuch points out, the ‫ איך‬sees himself as part of the collective, and therefore he addresses his questions to a ‫ ברודער‬who stands for the Jewish people. The poem opens with the ĳirst question : 21 ,‫זאג‬ ָ ,‫מײנער‬ ַ ‫ ברודער‬,‫זאג מיר‬ ָ ‫ אונדזער‬,‫טײט ער‬ ַ ‫בא‬ ַ ‫וואס‬ ָ ,‫וואס איז ער‬ ָ ? ‫געראנגל‬ ַ ‫הינטישער‬ 20 Sutzkever 1978 : 9. 21 Ibid. : 6. Tell me, my brother, tell What is it, what does it mean, our vile, servile struggle ? Heather Valencia : From Der tsirk to Erev mayn farbrenung 115 The derogatory adjective ‫ הינטיש‬is repeated in the second part, and recurs, also in the context of guilt and self-loathing, in the 1942 poem ‫מײן‬ ַ ‫מאמע‬ ַ ( My mother ), in which the poet castigates himself for his absence when his mother was murdered.22 In the latter poem it expresses the individual ’ s self-loathing, but here it encompasses the moral degradation of the Jewish people. In his attempt to answer his own question, the poet depicts a state of madness – ‫הארץ איז דול‬ ַ ‫דאס‬ ָ ( the heart is mad ) – in which even words have fled ‫גארטלטער מיט‬ ַ ‫בא‬ ַ ‫בינשטאק ַא‬ ָ ‫גלײך בינען ון ַא‬ ַ ‫ ( רויך‬like bees from a beehive wreathed in smoke ). Here one of Sutzkever ’ s early metapoetic images, poetic words as bees,23 has been adapted to ĳit the dark times. The introductory section contains no answer to the poet ’ s initial question, but ends with the observation that even in extremis the will to live asserts itself : 24 ‫וווּסטזײן‬ ַ ‫בא‬ ַ ‫נאר ערגעץ אין ַא הינטערגעסל ון‬ ָ ‫נאך‬ ָ ‫שלאגט‬ ָ ,‫געראטעוועט ון חורבן‬ ַ ‫ַא צוקנדיקער פּיצל נערוו‬ ‫וואס ווידערשפּעניקט יענע‬ ָ ‫ַא לעצטער קרעכץ‬ ‫בלינדע שטילקייט‬ .‫ארחתמעט מיט ַא הוין ערד‬ ַ ‫וואס ווערט‬ ָ But somewhere in a back street of our consciousness still beats a tiny, twitching nerve, saved from destruction, a last groan rebelling against that blind silence which will be sealed by a heap of earth. The imagery of these four lines precludes interpretation as a positive evaluation of the life-urge ; its animalistic, instinctive nature places it within the negative category of the earlier epithet ‫הינטיש‬. Two further questions to the ‫ מיר‬of the Jewish people open the second section : 25 ? ‫ווער זענען מיר‬ ? ‫לײדן‬ ַ ‫וואס איז דער זין ון ַאלע אונדזערע‬ ָ Who are we ? What is the meaning of all our sufferings ? Instead of an answer, the speaker can give only a nihilistic description of Jewish history, poetically conveyed through the reversal of positive motifs of Jewish life and faith into their negative mirror-image : if, in contrast to the Divine promise to the Jews, they are merely ‫קרבנות ון‬ ‫האר‬ ַ ‫בלוטדארשטיקן‬ ָ ‫ ( ַא‬victims of a bloodthirsty master ), then instead of human beings they should have been born as frogs – the cold-blooded frog suggesting the furthest extreme from the human essence. The second reversal is the rejection of Isaiah ’ s promise of a messianic age 22 23 24 25 Sutzkever 1945 : 33 – 37. Cf. ‫דאך‬ ָ ‫ ָאט בין איך‬, Sutzkever 1963 : 27. Sutzkever 1978 : 6. Ibid. 116 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ " ‫לקט‬ when “ the wolf also shall dwell with the lamb ” 26 as a lie that blisters the tongue : 27 ,‫זשאווערדיקער טרייסט‬ ַ ‫די צונג איז אויגעבלעטערט ון דער‬ .‫צוזאמען‬ ַ ‫זאל הויערן‬ ָ ‫לאם‬ ַ ‫וואלף און‬ ָ ‫ַאז‬ Our tongues are blistered by the blighted consolation that wolf and lamb shall crouch down together. The unreliability of a promise from the ‫ ( תּנך‬Tanakh ) signiĳies the collapse of the essence of Judaism, and as faith in the word is central to Sutzkever ’ s poetic credo, this negation of the holy word, as with the flight of ‫( ַאלע שיינע ווערטער‬all beautiful words) in the ĳirst part, is a powerful image of despair. The concept of the ‫גאלדענע קייט‬ ָ , the chain of Jewish tradition and continuity, is introduced as the third image which is turned on its head : instead of focussing on the proud aspects of Jewish tradition, the speaker sees only the tragedy and despair of Jewish fate : 28 — ‫מאמע‬ ַ ‫טאטע ־‬ ַ ‫דאס קינד ון‬ ָ ‫און ווי עס ירשנט ענלעכקייט‬ ,‫פּלאג‬ ָ ‫ירשען מיר די ענלעכקייט ון דורותדיקער‬ ‫בײ דער וועלטס‬ ַ ‫ארקנעכטע קעלנערס‬ ַ ‫זײן‬ ַ ‫ון‬ ‫געגרייטן טיש‬ .‫צוגעווארענער מטבע‬ ָ ‫אר דער‬ ַ ‫דאנקען‬ ַ ‫און הינטיש‬ ,‫יאר‬ ָ ‫וואס בינדט צוויי טויזנט‬ ָ ‫גאלדענע‬ ָ ‫דאס איז די קייט די‬ ָ .‫די טרערן ־ קייט אויף אונדזערע נשמות‬ And, as a child inherits similar qualities from his parents so we inherit the curse of generations of being enslaved waiters at the world’s set table and, like a servile dog, thanking for the coin thrown down for us. That is the golden chain that links two thousand years, the chain of tears upon our souls. These lines encompass the whole history of persecution ; reflecting the speaker ’ s bitter despair, the ‫גאלדענע קייט‬ ָ has become a ‫טרערן ־ קייט‬ through generations of humiliation and enslavement. The third section continues the train of thought which castigates the collective ‫מיר‬, bringing the focus onto the more recent history of the Jews. Sutzkever criticizes the Jewish people for the foolish political optimism of the ‫ ( נעכטן‬yesterday ), which one could interpret as the period which began with the Haskala. The participation of Jews in Europe ’ s wars and revolutions led them into an illusory dream of acceptance ; Sutzkever uses the image of soldiers who believe they have an equal entitlement to a share of the booty : 29 26 27 28 29 Isaiah 11 : 6. Sutzkever 1978 : 6. Ibid. Ibid. : 7. Heather Valencia : From Der tsirk to Erev mayn farbrenung 117 ,‫זאקרויב‬ ַ ‫האבן אויך ַא חלק אין דעם חלום ־‬ ָ ‫ מיר‬,‫הא‬ ָ ‫הא‬ ָ — ! ‫רעוואלוציעס‬ ָ ‫צאלן אויכעט צינדז מיט אונדזער בלוט די‬ ָ ‫מיר‬ – Ho ho ! we also have a share in the dream-booty, we also contribute to the revolutions with our blood ! But the Jewish people have not learned from history ; false hopes have concealed ‫שארבנס ון די דורות‬ ַ ‫בארוטע‬ ַ ‫ ( די ניט‬the skulls of generations that have not come to rest ), and the lion does not see the trap beneath its paws. After this initial existential enquiry into the historical role and fate of the Jewish people in light of the present catastrophe, the fourth part of the ĳirst section of the poem brings an abrupt change of focus. The general becomes the personal : the broad ‫ נעכטן‬becomes the precise ‫הײנט‬ ַ (today) of the central event, and the collective ‫ מיר‬among whom the poet had sought refuge becomes the speciĳic ‫מיר‬, namely the three participants in the ‘ circus. ’ It is as if the ‫איך‬, initially unable to contemplate the horror of the event he had just experienced, had taken refuge in general speculations about the Jewish people, but is now forced to confront his own individual guilt and the shocking event itself. The pause in the ĳirst line of the section : ‫ אין ַאן עיגול‬,‫נאכט‬ ַ ‫הײנט — — ער‬ ַ ‫און‬ ( And today – – before night, in a circle ) creates the impression of a momentary hesitation, before the writer can bring himself to plunge into the painful description. The ‫הײנט‬ ַ ‫ און‬parallels the ‫ ( ָאט נעכטן‬just yesterday ) of the previous section, and the reader expects a continuation of the historical, reflective mode ; the switch to the personal plight of the ‫ איך‬is dramatic. A further important marker for this change in perspective is the striking alteration in form and meter. The ĳirst three parts each consisted of between nine and twelve lines in free verse, with different line lengths. This gives way in the fourth part to a series of rhyming couplets, mainly of dactyls and trochees : a nervous, jumpy rhythm, evoking the insane dance of the victims. At the end, there is a broken line, a pause, and then a line standing on its own, without a rhyme : 30 ,‫ אויף קנוילן הויכע‬,‫ווײטער‬ ַ ‫און‬ ‫רײסט זיך ַארויף דער ָאנכי‬ ַ ‫פּארמעט‬ ַ ‫ארשלונגענעם‬ ַ ‫ון גיריק‬ — ‫גארניט‬ ָ ‫און‬ .‫דערווײטערט‬ ַ ‫אויך ער איז‬ 30 Ibid. And further, in high smoke spirals surges upwards the onoykhi from the parchment that is being greedily consumed and there’s nothing – it too has disappeared. 118 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ " ‫לקט‬ This dramatic pause, marked by the dash, creates an instant of suspense, followed by the ĳinal, tragic disappearance of the sacred word. Here a motif which is merely mentioned in the prose account attains central signiĳicance : the tearing and burning of the Torah scrolls and pages of the Talmud. These writings represent the very being of the Jewish people, so that when the poet destroys them he is destroying himself : ‫ ( די אייגענע גלידער‬my own limbs ). In his description of their disappearance in the smoke, he uses images resonant with meaning : ‫ ( דער קול ון גן ־ עדן‬the voice of Paradise ), the ‫ ( אותיות ון בל‬letters of the Babylonian Talmud ) and, most signiĳicantly, ‫ ָאנכי‬, the word for “ I ” with which God identiĳies Himself at the giving of the Ten Commandments ; the ‫ ָאנכי‬therefore represents the living presence of God and the essence of Judaism. In Sutzkever ’ s depiction the ‫ ָאנכי‬detaches itself from the parchment, but this does not denote survival : the last lines, quoted above, instead suggest that the sacred ‫ ָאנכי‬has departed from them ( ‫דערווײטערט‬ ַ ). The second section of the poem is characterized by further changes of form. The biographical ‫ איך‬disappears, as if the poet cannot bear to contemplate his involvement in this degradation, and the central section depicts a macabre dance of death where the speaker addresses a ‫ דו‬whom he exhorts : ‫ארברען אים‬ ַ — ‫נאך ַא געיל‬ ָ ‫האסט‬ ָ ( If you still have a feeling – burn it ). The new rhythm dramatically evokes the frenetic dance ; the regular four-line stanzas of trochaic tetrameter with the rhyme scheme abba provides a monotonous rhythm for this inexorable ‫האד‬ ָ ‫רא‬ ַ ‫קא‬ ַ ( circular dance ).31 The grotesque atmosphere is heightened by the description of the sadistic behavior of the onlookers. In contrast to the prose account, which simply mentions a ‫צײטנס צונויגעטריבן‬ ַ ‫בײ‬ ַ ‫האבן‬ ָ ‫דײטשן‬ ַ ‫ וועלכן די‬,‫המון‬ ‫ספּעקטאקל‬ ַ ‫ ( אוין‬crowd that the Germans had rounded up in good time for the spectacle ), here we witness a peasant woman rejoicing, a prostitute sniggering at the victims ’ nakedness, and stones being thrown which, it is implied, kill the old rabbi, who in the prose account had in fact gone back to the prayer-house after the ordeal. The indifference of heaven to his ĳinal prayer intensiĳies the pessimism of the poem : 32 ‫אלט דער ר‬ ַ .‫אלן שטיינער‬ ַ .‫קושנדיק אין ַאש די ונקען‬ ‫ארזונקען‬ ַ ‫זײן שמע ווערט אויך‬ ַ ‫און‬ .‫קאלטקייט ון אין ־ סוף‬ ַ ‫אין דער‬ Stones fall. The rabbi falls kissing the sparks in the ash. And his Shema also sinks down into the coldness of inĳinity. 31 Both Yitskhok Yanasovitsh ( Yanasovitsh 1981 : 66 ) and Avrom Novershtern ( Novershtern 1983 : 131 ) comment on afĳinities between ‫ דער צירק‬and Moyshe Leyb Halpern ’ s apocalyptic poem ‫נאכט‬ ַ ‫ ( ַא‬A night ). This comparison is particularly apt with respect to the nightmarish atmosphere of this second section of Sutzkever ’ s poem. 32 Sutzkever 1978 : 8. Heather Valencia : From Der tsirk to Erev mayn farbrenung 119 This central section could be seen as a kind of interlude where the poet has momentarily moved away from his own raw anguish into the “ refuge ” of a vision of hell in which he himself is not involved. However, in the ĳinal section, consisting of two parts, the whole issue is ĳinally confronted. Returning to the free verse of the poem ’ s beginning, the ‫ איך‬unequivocally admits his own guilt : using the circus image, he pictures himself as the ‫ ( לץ‬clown ) – a personage without dignity and often with negative connotations. His shameful role consists of two failures to act and one dishonorable action which, together, destroy the ‫גאלדענע‬ ָ ‫ קייט‬: he did not have the courage to curse his tormentors, nor could he summon up ,‫טאן אין טויט‬ ָ ‫ווארף צו‬ ָ ‫ [ דעם כּוח זיך ַא‬. . . ] ‫צײט ון ַאדריִ ַאן דעם רוימער‬ ַ ‫מײנע ברידער אין דער‬ ַ ‫ווי‬ ‫האט דערשטיקט אין קערפּער די יסורים‬ ָ ‫בשעת דער גלויבן‬ [ … ] The strength to throw myself into death, like my brothers in the time of the Roman Hadrian, when their faith smothered the agony in their bodies. Confronted by another Hadrian, he was not the equal of his forebears. These two failures to act honorably are compounded by the only action which the speaker was able to perform, namely his begging for mercy from those whom he describes as having ‫טאטן אין ַזײן קר‬ ַ ‫מײן‬ ַ ‫געשענדט‬ ( deĳiled my father in his grave ) – this image emphasises the disgracefulness of his action. Through these failures, he has broken the chain. In the ĳirst part of the poem the ‫גאלדענע קייט‬ ָ was described as a ‫טרערן ־ קייט‬ because of the two-thousand-year-long sufferings of the Jews. The reference to tears in this ĳinal section of the poem echoes this earlier image, but also contrasts with it : his own cowardly tears are ‫שווארצע‬ ַ ‫פּאקן‬ ָ ( black pocks ), which he views with self-disgust. In the ĳinal two four-line stanzas, the poem comes to its despairing conclusion, and in doing so returns to the relationship between the individual and the collective, but this time, in light of the event just depicted, the speaker gives a ĳinal judgment on his own inability to act as a true Jew. He calls himself ‫רשאלטענער‬ ָ ‫א‬ ַ and in the ĳirst of the two stanzas questions his own identity : 33 ‫דײן ַאלטע שילד‬ ַ ‫רשאלטענער ! וווּ איז‬ ָ ‫א‬ ַ ? ‫האט צעבויגן עלקערלעכע שפּיזן‬ ָ ‫וואס‬ ָ ,‫ארב ון יענעם בילד‬ ַ ‫דערגרייכט דיר ניט קיין‬ ? ‫באוויזן‬ ַ ‫פּשטאם ניט‬ ַ ‫דײן ָא‬ ַ ‫מאל זיך‬ ָ ‫האט קיין‬ ָ 33 Ibid. : 9. Accursed one! where is your ancient shield which bent the spears of nations ? Does no single colour of that image reach you, has your lineage never revealed itself ? 120 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ " ‫לקט‬ The questions are about the ĳitness of the ‫ איך‬to consider himself part of the Jewish people ; the image is that of a hero who has lost his shield – the allusion to the ‫ מגן דוד‬is clear – and the implied answer to the second question is a negative one : he has also lost the vision of his noble lineage. For this he visualises his punishment : 34 ‫האלב געטייט‬ ַ ‫שטראף צו זשיפּען‬ ָ ‫דײן‬ ַ ‫דאס‬ ָ ‫איז‬ ‫כארכל ון די ברידער‬ ָ ‫און רעסן גסיסה ־‬ That is your punishment to gasp half dead and gobble down the death-throes of your brothers. He is condemned to remain alive – though spiritually dead – by nourishing himself parasitically on the death-throes of the other, braver Jews, who achieved what he did not. The word ‫ ברידער‬recalls the ‫ברודער‬ ‫מײנער‬ ַ of the ĳirst line, but whereas at the beginning of his enquiry he and the ‫מײנער‬ ַ ‫ ברודער‬were part of a ‫מיר‬, now, having unflinchingly explored his role in the ‘ circus, ’ he realizes that he is separate and alienated from his brothers, surviving, as he sees it, at their expense. The last two lines make the cause of his guilt absolutely clear : ‫ארדינט די לעצטע רייד‬ ַ ‫האסט ניט‬ ָ ‫ווײל דו‬ ַ .‫ ון ווערן ווידער‬: ‫דאס מיינט‬ ָ — ‫ון ווערן אויס‬ Because you have not earned the last joy of dying – which means: of being reborn. He is not permitted to become a link in the chain – he has not died, and so cannot be spiritually reborn. The despair and lack of resolution in the poem may be the main reason why Sutzkever did not publish it until almost four decades later, as Novershtern also suggests : 35 ‫האט‬ ָ ‫ [ ניט די שוידערלעכע איבערלעבונג‬... ] ‫זײן‬ ַ ‫זאל גונז‬ ָ ‫גורם געווען דערצו ַאז סוצקעווער‬ ‫ווײל דער זעלביקער‬ ַ ,‫יארן‬ ָ ‫לאנגע‬ ַ ‫דאס ליד אויף‬ ָ ‫אר‬ ַ ‫אן‬ ָ ‫האט שפּעטער געדינט ווי ַא‬ ָ ‫עפּיזאד‬ ָ ‫וואס איז גע־‬ ָ ( 1949 ) ‘ ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ער‬, ‫אויסנאמ־‬ ַ ‫ די‬.‫ווארענישן‬ ָ ‫בא‬ ַ ‫געווארן ָאן‬ ָ ‫דרוקט‬ ‫באשטייט אין דעם ַאז‬ ַ ‘ ‫דער צירק‬, ‫לעכקייט ון‬ ‫ארענט־‬ ַ ‫די סקות וועגן איבער זייער מעגלעכע‬ ‫פּאעט געינט ניט קיין און ווי‬ ָ ‫ערונג און דער‬ .‫וומאטישע געשעענישן‬ ַ ‫טרא‬ ַ ‫באזיניקן די‬ ַ ‫צו‬ 34 Sutzkever 1978 : 9. 35 Novershtern 1983 : 132. [ … ] It was not the dreadful experience itself that led Sutzkever to hide the poem for many years, because the same episode later served as the background for “ Erev mayn farbrenung, ” ( 1949 ) which he published with no inhibitions. The exceptional nature of “ Der tsirk ” is that [in it] the doubts outweigh their possible resolution and the poet ĳinds no way of coming to terms with the traumatic events. Heather Valencia : From Der tsirk to Erev mayn farbrenung 121 The eight years between ‫ דער צירק‬and ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ ער‬took the poet from the immediate experience itself, through a period of wandering, mourning and reflection, to a new, optimistic beginning in Israel, evoked in the opening poems of the volume ‫וואגן‬ ָ ‫ײער ־‬ ַ ‫ ( אין‬In the Fiery 36 Chariot ), which appeared in 1952. The book is divided into ĳive sections, and most of the poems either celebrate Sutzkever ’ s relationship with the land of Israel, or pursue his ever-present metapoetic theme. Though never absent from his mind or writing, the experiences of the ‫ חורבן‬are now in the realm of memory, and the poet places a group of poems speciĳically focussing on this theme in a separate section of the book, which he calls ‫דערמאנונג‬ ָ ‫קארש ון‬ ַ ‫ ( די‬The Cherry of Memory ). Among the poems of this section is ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ער‬. Formally there are signiĳicant differences between the two works : the ĳirst poem proceeds through a series of rapid, dramatic changes of meter and form, with rhyme and free verse, while the later poem consists of three sections of – with two signiĳicant exceptions – regular unrhymed trochaic heptameters, an unusual metre for Sutzkever. Whereas ‫ דער צירק‬begins with the collective ‫ מיר‬of the Jewish people, this poem opens with the depiction of the ‫ איך‬in an imaginary landscape, a projection of his inner state, reflecting his isolation. This can be perceived in the opening image of the sunset, which, like all the other attributes of nature, emanates from the fantasy of the ‫ איך‬: 37 ‫קוואלן‬ ַ ‫רגאנג צו‬ ַ ‫זונא‬ ַ ‫ניט ון מער קומט צו מיר דער‬ .‫וואס קיינער זעט ניט‬ ָ ,‫הארץ‬ ַ ‫נאר ון אייגן‬ ָ — ,‫ַאלע ָאוונט‬ ‫ זיי לייצן‬,‫ ביז – אים ָאפּגעוועלטיקטע‬,‫ַאלע זונען‬ ‫ארשלינגען‬ ַ ‫ שלינגען און‬,‫רצקוואל‬ ַ ‫הא‬ ַ ‫ונעם‬ ,‫ מענטשן‬,‫גאסן‬ ַ ‫ארלייצונג‬ ַ ‫ ווי אין ַא‬,‫בלײב ַאליין אין וועלט ־ סוד‬ ַ ‫און איך‬ ,‫שטאק ־ עלנט מיט משוגע ־ גרינע אויגן‬ ָ ‫‘בלײבט ַא בוים‬ ַ ‫ס‬ ‫ די ַאלט‬,‫צײט‬ ַ ‫וואס דערקענען ניט די‬ ָ .‫נדשאט‬ ַ ‫לא‬ ַ ‫קאנטע‬ ַ ‫בא‬ ַ .‫זאנגענעלד ַאנטקעגן — ניט בנמצא‬ ַ ,‫וועגן ־ שטעגן‬ ‫קאפּויערקייט ון ָאפּשפּיגל ַאנטפּלעקט זיך‬ ַ ‫בלויז אין דער‬ . . . ‫אייגן פּנים‬ 36 Sutzkever 1952 : 9, 10 f. 37 Ibid. : 115. It is not from the west that the sunset surges towards me every evening – but from my own heart, which no one sees. All the already disappeared suns flood out from the heart-spring, swallow and devour streets and people, and I alone remain in the world-secret, as in a flood a tree remains, lonely, with mad green eyes, which do not recognise time, or the old familiar landscape. Ways and paths towards a ĳield of corn – do not exist. Only in the upside down of my reflection there appears my own face… 122 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ " ‫לקט‬ In Sutzkever ’ s ghetto- and later poetry, he often creates a dark atmosphere by turning normally positive images of nature into their opposite, making of them something disturbing or grotesque.38 These could be called “ images of reversal. ” Two of Sutzkever ’ s key images of nature are trees and sunsets. Here suns from the past 39 flow out of his heart and devour all outer reality. The tree, the only discernible feature in this inner universe, has reversed its normal Sutzkeverian function as an image of life and regeneration, to become a symbol of the poet ’ s isolation and disorientation : it has attributes of human madness ( ‫) משוגע – גרינע אויגן‬. The motif of the flood, used with reference to the suns and the tree, has resonances of the biblical Flood with its connotations of guilt and punishment. This reversal of all normal reality is conveyed by the repeated word ‫קאפּויערקייט‬ ַ ( “ topsy-turvyness ” ), which introduces the idea of the ‫ איך‬as an anti-Narcissus who sees in his reflection an image of horror rather than of beauty. The abbreviated line ‫ ( אייגן פּנים‬my own face ) – the only irregular line in the whole poem – conveys the shock of seeing the face, which is ageing before his eyes : 40 ,‫וואליע‬ ָ ‫פּא‬ ַ ,‫קאפּויערקייט‬ ַ ‫ בלויז אין דער‬.‫גארנישט זע איך‬ ָ ‫ עלעהיי אין אורטרוים‬,‫מײן פּנים‬ ַ ‫רונצלט קדמונדיק‬ .‫מײן שפּעטער‬ ַ ‫מאסקע ון‬ ַ ‫וואלט איך אים געזען שוין ווי ַא‬ ָ Nothing I see. Only in this topsy-turvyness, slowly my face wrinkles like the oldest human being, as if in a primordial dream I was looking at a mask of my later self. Thus the surreal landscape of the ĳirst section evokes the isolation of the ‫ איך‬from the outer world : His past reality is obliterated, his present is a flooded landscape without recognizable topographical or human features, and the ancient wrinkled face of a future without hope already exists within him. The ĳirst section ends with a colon, the normal function of which is to suggest that what follows will explain or elaborate on what goes before it. The message given by this colon is that his state of mind in the opening section is to be explained by what is about to be described. Thus the expectation of a nihilistic ending is aroused. Sutzkever ’ s achievement, however, is that in the course of the poem – that is, by means of the act of poetic creation itself – he reaches a resolution of the conflict. 38 See footnote 30. 39 The reader is confronted here with a Sutzkeverian neologism, ‫ ָאפּגעוועלטיקט‬. Since the separable preĳix ‫ ָאפּ‬can mean a ĳinishing or departing, the phrase suggests suns which have disappeared from the world before this sunset – all the suns of the poet ’ s past. 40 Sutzkever 1952 : 115. Heather Valencia : From Der tsirk to Erev mayn farbrenung 123 The poem moves from the inner landscape to a dramatic recreation of the incident. As in ‫ דער צירק‬, the poet ’ s reluctance to confront the trauma makes him use retarding techniques : in this case a description of nature, a real environment this time, which begins as a serene evocation of an autumn evening : 41 ,‫שטאן‬ ָ ‫ געשפּונען ון די זעלבע‬.‫הארבסט‬ ַ ‫בלאיער‬ ָ ‫ָאט — ַא‬ ‫שאונג‬ ַ ‫בא‬ ַ ‫ שפּינט און העקלט די‬,‫ מסתּמא‬,‫וואס ון זיי‬ ָ ‫ — ול מיט צער‬,‫בלא געבליץ ון קינדעראויגן‬ ָ .‫צארטקייט‬ ַ ‫און‬ And now – a blue autumn. Spun from the same stuff with which, probably, Creation spins and crochets the blue gleam of children’s eyes – full of sad tenderness. This gentle romantic description, with its image of children ’ s eyes, suggests innocence and beauty ; a serene world, created by a transcendental presence. The poet ’ s own emotions, however, do not permit him to sustain this vision of an ordered universe, and elements of surrealism creep in, until gradually nature again reflects his own distressed self : 42 ,‫פּאמעלעך מיט די ליגל‬ ַ ‫הײנט‬ ַ ‫פּאטשן‬ ַ ‫און די ייגל‬ .‫פּאר ליגל‬ ָ ‫פּאטשט מיט צוויי‬ ַ ‫ַאז מע זעט ווי יעדער ויגל‬ ‫וואקסן ון די שטיינער‬ ַ ‫וואלטן‬ ָ ‫זאנגען‬ ַ ‫ ווי‬.‫גאס‬ ַ ‫פּוסט די‬ .‫וואס ָאפּגעשניטן ַאלע‬ ָ ‫נאר ־‬ ָ ‫וואלט זיי‬ ָ ‫קאסע‬ ָ ‫און ַא‬ ‫פּאסטקעס‬ ַ ‫לאזן אין דער לוטן‬ ָ ‫ און זיי‬,‫גלעקער קלינגען‬ .‫פּאר ליגל‬ ָ ‫אר די שווימענדיקע ייגל מיט די צוויי‬ ַ And today the birds flap slowly with their wings and one can see that each bird flaps with two pairs of wings. The street is empty. As if cornstalks had grown up from the paving stones and a scythe had just cut down every one. Bells ring out, leaving traps in the air for the floating birds with two pairs of wings. The allusion to four-winged birds evokes Ezekiel ’ s vision of living creatures with four faces and four wings.43 The evening bells are a malignant force, setting traps in the air for the birds – perhaps a forewarning of the malice of the Christian neighbors. The image of the empty street is created through another of Sutzkever ’ s ‘ images of reversal. ’ The initial neutral statement : ‫גאס‬ ַ ‫ פּוסט די‬assumes symbolic coloring through the metaphor by which the poet extends it : elsewhere in Sutzkever ’ s poetry a symbol of life, cornstalks are a sign of emptiness and death when they are growing between the paving stones of a town. Only in a town where people do not walk on pavements does grass grow between the stones.44 The poet then imagines these cornstalks themselves as having been ob41 Ibid. : 115. 42 Ibid. 43 Ezekiel 1 : 4 – 6. 44 The same reversal of a normally positive metapoetic image is seen in the negative image of grass in the sixth poem of ‫ ( ָאדע צו דער טויב‬Ode to the Dove ) : ‫גראז‬ ָ ‫באשימלט מיט‬ ַ [. . . ] ‫מײן מדינה‬ ַ — ( [ … ] grass covers my country like mould ). Sutzkever 1955 : 12. 124 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ " ‫לקט‬ literated by a scythe, an image suggesting Death the Reaper. With this multi-layered image, Sutzkever suggests the foreboding of death. So the apparently serene ‘ real ’ landscape, the ‫הארבסט‬ ַ ‫בלויער‬, has gradually turned into a vision no less disturbing than that of the ĳirst section. Now, however, the poet must confront the central episode, which he does with a further moment of hesitation reminiscent of the earlier poem : ( ‫ [ ) דער צירק‬. . . ] ‫נאכט‬ ַ ‫הײנט — — ער‬ ַ ‫און‬ ( ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ [ ) ער‬. . . ] ‫און — מע ירט אונדז‬ And today – – before night [ … ] ( Der tsirk ) And – they lead us [ … ] ( Erev mayn farbrenung ) In the depiction of the ordeal, there are signiĳicant differences between the two poems. The malice of the neighbors, dwelt on in painful detail in the earlier poem, is here reduced to three lines, and the poet ’ s scornful attitude is conveyed merely by the quotation marks round “ ‫ „שכנים‬: 45 ‫ און ַאנטקעגן אויף די ווילדע‬.‫נאקעט‬ ַ .‫נאקעט‬ ַ .‫נאקעט‬ ַ ,“ ‫מײנע „שכנים‬ ַ ‫עקלדיקע עפּלביימער זיצן‬ .‫יאגן ָאפּ די ליִ ענדיקע ונקען‬ ָ ,‫בײסן עפּל‬ ַ Naked. Naked. Naked. And opposite on the wild disgusting apple trees sit my “ neighbours, ” bite into apples, chase away the flying sparks. The speaker ’ s humiliation is eloquently conveyed by the threefold ‫נאקעט‬ ַ , in contrast to the more direct description of the neighbors ’ taunts in ‫דער צירק‬, and the message of the ironic “ ‫ „שכנים‬is further intensiĳied by the transferred epithet of the ‫ עקלדיקע עפּלביימער‬,‫ווילדע‬, whose apples they are enjoying as they watch. The economy of these images enables the poet to focus all attention on the central issue which forms the climactic ĳinal section. Also for this reason, the ĳigure of the boy has been omitted. The essence of the poem is the dialogue between the ‫ איך‬and the old man, and the symbolic importance of the parchment ; the whole focus of the poem is the conflict between good and evil. This also explains the devil on the church spire, ringing the malevolent bells ; he is the counterpoint to the old rabbi, who is transformed and elevated in this later poem. We have seen that in both the prose version and the earlier poem he was a human ĳigure, albeit with an aura of sanctity, but here Sutzkever raises him above the purely human sphere : he is described as having a ‫ ( לייבן ־ גריווע‬lion ’ s mane ); like Moses, he carries the scroll as ‫געשאנק‬ ַ ‫ַא‬ ‫ ( ון סיני‬a gift from Sinai ), and he is able to walk on the glowing coals 45 Ibid. : 116. Heather Valencia : From Der tsirk to Erev mayn farbrenung 125 as if on grass. When he goes into the ĳire, his body is transformed into a ‫ ( בלענדנדיקן גוף‬dazzling body ). His answers to the speaker ’ s questions therefore have absolute authority. The questions in ‫ דער צירק‬were about the suffering of the Jewish people throughout history ; in the ĳinal section of this poem the question is an urgent personal appeal about the speaker ’ s own young life : 46 ‫באלוינונג‬ ַ ‫דאס איז די‬ ָ ,‫מײנע ליפּן‬ ַ ‫ שעפּטשען‬,‫— „ זיידע‬ “ ? ‫האט עס ַאלץ ַא זינען‬ ָ ? ‫מײן ניט דערלעבטן לעבן‬ ַ ‫אר‬ ַ – Grandfather, whisper my lips, is this the reward for my life not yet lived? Does this all have a meaning ? The old man ’ s answer draws the ‫ איך‬out of his private agony into the ‫גאלדענע קייט‬ ָ , into the collective ‫ מיר‬of the victims, who have an ethical framework for their actions, in contrast to the evil oppressors : 47 ‫זײן ווי י ע נ ע‬ ַ ‫וואלטסטו וועלן‬ ָ „ [...] ? ‫ ָאדער ווי די שלעגער‬,‫אוין עפּלבוים ַאנטקעגן‬ ,‫זײן שטענדיק גרייט אויף ַא נסיון‬ ַ : ‫טײט‬ ַ ‫בא‬ ַ ‫זײן ַא ייִ ד‬ ַ [ . . . ] “.‫אויף נסיון און אויף נס‬ Would you like to be like those people on the apple tree opposite, or like the persecutors? To be a Jew means: always to be prepared for a trial, for a trial and a miracle. [ … ] In the earlier poem the ‫ איך‬gave in to the temptation of saving his life at the price of his honor, and thus forfeited being part of the miracle of the ever-regenerating ‫גאלדענע קייט‬ ָ . But in this poem the conflict is resolved through the symbolism of the scroll : in ‫ דער צירק‬the ‫ איך‬was guilty of destroying the scroll, but in ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ער‬, the moral damage is repaired and the way shown towards the redemption of the ‫ איך‬: it is through the scroll that the key motif of the poet ’ s word is introduced as the essential factor in his salvation. As the prophet-ĳigure of the old man is consumed by ĳire, the word ‫ ָאנכי‬leaps from the parchment, as in ‫ ; דער צירק‬this time, however, the sacred word is not annihilated but gives the speaker the moment of illumination necessary to complete his redemption : 48 — ,‫פּארמעט דער ָא נ כ י‬ ַ ‫יאגט ון‬ ָ ‫צוזאמען‬ ַ ‫מיט ַא ונק‬ .‫לײב און לעבן איז צו זען אים‬ ַ ‫ָאבער אינעם זקנס‬ ‫באצווינגען‬ ַ ‫זאל‬ ָ ‫ ַאז ער‬,‫אנגען מ ַײ ן ָאנכי‬ ַ ‫וויל איך‬ ,‫לאקער‬ ַ ‫סאמע‬ ַ ‫אל איך אונטער אים אין‬ ַ — ,‫פּײנען‬ ַ ‫ַאלע‬ 46 Ibid. 47 Ibid. 48 Ibid. : 116 f. Together with a spark the onoykhi leaps from the parchment, but it can be seen in the old man’s body and life. I want to catch my onoykhi, so that it conquers all my sufferings – so I fall under him, into the heart of the flames, 126 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ " ‫לקט‬ ,‫אומבײט ון די ה ַײ נ ט ן‬ ַ ‫ווארט אין‬ ָ ‫מײן‬ ַ ‫שאן איז‬ ַ ‫בא‬ ַ ‫ווײל‬ ַ .‫האט אים אויסגעברענט ון צונג מיר‬ ָ ‫נאריש לעמל‬ ַ ‫און ַא‬ ‫נעם איך מיט די ליפּן די צעביסענע ון ווייטיק‬ ,‫טראף די פּסוקים ונעם זקן‬ ַ ‫נאך‬ ָ ‫טראף‬ ַ ‫איבערזאגן‬ ָ ‫פּסוקים ַאלט געבוירענע אין אייביקע ַא מ ָא ל ן‬ .‫פּאנצער‬ ַ ‫נגעטאן אין זינגענדיקן‬ ָ ‫לײב ווערט ָא‬ ַ ‫מײן‬ ַ ‫און‬ For my word is fashioned from the changing todays, and a stupid flame has burned it off my tongue. With my lips that are bitten in agony, I begin to whisper syllable for syllable the verses of the old man, ancient verses born in eternal yesterdays and my body becomes clothed in singing armour. This is the climactic moment of the poem : the old man is the embodiment of the immutable ‫ ָאנכי‬, of the essential Word, and this leads the poet to consider the difference between his word and the ‫ ָאנכי‬. The difference is epitomized by the two accentuated words ‫הײנטן‬ ַ and ‫מאלן‬ ָ ‫ ַא‬: the ‫הײנטן‬ ַ of the poet ’ s word represents transience and change, in contrast to the ‫מאלן‬ ָ ‫ אייביקע ַא‬of the words of the Torah, embodied in the rabbi, which constitute the eternal ‫גאלדענע קייט‬ ָ . Only through the transformation of his word into something eternal and sacred ( ‫מײן ָאנכי‬ ַ ‫אנגען‬ ַ [ catch my onoykhi ] ) can he become part of that continuity which eluded him in ‫דער צירק‬. This is why he throws himself under the rabbi, into the ĳire. This striking image suggests a mystical union with the ‫ ָאנכי‬, and the transĳiguration of the ‫ איך‬is achieved by his reciting the words of the ‫מאלן‬ ָ ‫ אייביקע ַא‬of the Torah verses. It is signiĳicant that his ĳinal triumph is conveyed by what is clearly an echo of the armor metaphor of the earlier poem – there the symbol of his guilt was the loss of his shield : 49 ‫דײן ַאלטע שילד‬ ַ ‫רשאלטענער ! וווּ איז‬ ָ ‫א‬ ַ ? ‫האט צעבויגן עלקערלעכע שפּיזן‬ ָ ‫וואס‬ ָ Accursed one! where is your ancient shield which bent the spears of nations? Now that the poet has found his ‫ ָאנכי‬, that is, his word, which has achieved the status of eternity and continuity which the sacred verses embody, he is protected by a ‫פּאנצער‬ ַ ‫זינגענדיקן‬. The attribute ‫ זינגענדיק‬is an allusion to the poetic word : the verb ‫ ( זינגען‬to sing ) is always used by Sutzkever in a metapoetic context.50 So the ‫ איך‬has now emerged, protected by his poetic word, which has achieved the eternity of the 49 The words of God to Abraham ( Genesis 15 : 1 ) read like an answer to this question in ‫דער‬ ‫צירק‬, and a bridge to the ‫ ָאנכי‬of the later poem : ‫אל תּירא אברם אנכי מגן לך שׂכרך הרבה מאד‬ ( Fear not, Abram : I am thy shield and thy exceeding great reward ). The ‫ ָאנכי‬which springs from the parchment could well be part of this verse, answering the question of ‫דער צירק‬. 50 For example in the poem ‫ ( איך ליג אין ַאן ָארון‬I lie in a cofĳin ): ‫ ווי‬/ ‫ [ און איצט אין ַאן ָארון‬. . . ] ‫ווארט‬ ָ ‫מײן‬ ַ ‫נאך‬ ָ ‫ זינגט ַאלץ‬/ ,‫ ] … [ ( אין הילצערנע קליידער‬and now in a cofĳin, / as in clothes made of wood, / still my word sings ). Sutzkever 1963 : 249. Heather Valencia : From Der tsirk to Erev mayn farbrenung 127 ‫ [ צו די שטערנדלעך די רישע‬... ] ,‫ שוועבט ווי אליהו‬,‫וואגן‬ ָ ‫ײער ־‬ ַ ‫שוועבט ער אין ַא‬ .‫מאל אלישע‬ ָ ‫מאנטל ווי ַא‬ ַ ‫שאטן ־‬ ָ ‫זײן‬ ַ ‫און איך הייב‬ [ … ] To the fresh new stars he soars up in a ĳiery chariot, soars up like Elijah, and I pick up his shadow-mantle, as did once Elisha. ‫ ָאנכי‬. This idea is cemented in the ĳinal lines of the poem, depicting the death of the rabbi: Elisha took up Elijah ’ s mantle and carried on his work ; by using this image, the ‫ איך‬is afĳirming his place within Jewish tradition, not rejected and isolated, but a link in the ‫גאלדענע קייט‬ ָ . The two rhymes in the last three lines of the otherwise unrhymed poem give a sense of completion. The movement of ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ ער‬is the reverse of ‫ דער צירק‬: the earlier poem begins with the attempt of the ‫ איך‬to be part of the ‫מיר‬ of the Jewish people and ends with the isolated ‫איך‬, cut off from the ‫ ( כּלל‬community ) ; the second poem begins with the isolation of the ‫איך‬, and ends with his integration and a clear vision of his role within the community of the Jewish people. ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ ער‬is the ‫ תּיקון‬of the earlier poem, and it is here, not in ‫דער צירק‬, that he ĳinds the poetic word. The two poems, considered together, are the ĳirst example in Sutzkever ’ s work of a process which was to continue throughout his creative life : the constant poetic reworking and transĳiguration of the ‫חורבן‬ within his monumental oeuvre. They are a conĳirmation of the transformative power of the poetic word itself. From the agony and guilt of the poem written just after the ordeal itself, Sutzkever is able to change the experience into a source of inspiration for his creative life. This happens during the course of the second poem itself : the disturbing imagery at the beginning of ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ ער‬evokes the poet ’ s frame of mind as he begins the poem, and his bleak view of the future is conveyed through the image of the wrinkled face as a ‫מײן שפּעטער‬ ַ ‫מאסקע ון‬ ַ . But by the end of the poem this despairing vision has been transformed through the process of creating the poem : the Nazi bonĳire, which was the cause of his degradation and isolation from the ‫גאלדענע קייט‬ ָ in ‫דער‬ ‫צירק‬, has become a symbol of puriĳication in ‫ארברענונג‬ ַ ‫מײן‬ ַ ‫ער‬, exemplifying Sutzkever ’ s conviction, expressed two years earlier in the epic ‫געהיימשטאט‬ ָ ( Clandestine City ), that a central function of his poetic mission is to transform pain into beauty : 51 ‫זײן‬ ַ ‫באשערט געווען צו‬ ַ ‫איך לעב ! מיר איז‬ ‫לאקערדיקער עדות‬ ָ ‫ַא גרויזיק ־ שטילער‬ ‫שײן‬ ַ ‫רוואנדלען זיך אין‬ ַ ‫א‬ ַ ‫וואס מוז‬ ָ ,‫פּײן‬ ַ ‫ון‬ 51 Sutzkever 1963 : 443. I live ! I have been destined to be a cruelly silent watchful witness of pain, which must transform itself into light. 128 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ " ‫לקט‬ Bibliography Novershtern, Avrom, 1983 : Avrom Sutskever. Tsum vern a ben-shivim. Jerusalem. Szeintuch, Yechiel, 1983 : “ Di biografye fun lid ‘ Der tsirk.’” In : Dov Sadan, Yeshayahu Avrekh, Chava Turniansky, Chone Shmeruk, eds., 1983 : Yikhes fun lid / Yikhuso shel shir. Lekoved Avrom Sutskever. Tel Aviv : Yoyvl-komitet, 258-279. Sutzkever, Avrom, 1945 : Di festung. New York : Ikuf farlag. – 1947 : Vilner geto. Buenos Aires : Ikuf farlag. – 1952 : In fayer-vogn. Tel Aviv : Di goldene keyt. – 1955 : Ode tsu der toyb. Tel Aviv : Di goldene keyt. – 1963 : Poetishe verk. vol. 1. Tel Aviv : Yoyvl-komitet. – 1979 : Di ershte nakht in geto. Tel Aviv : Di goldene keyt. Valencia, Heather, 2004 : “ ‘Farvandlen vil ikh toyt in lebn ’ : Transformations of the Holocaust in the Post-War Poetry of Abraham Sutzkever. ” In : Joseph Sherman, ed., Yiddish after the Holocaust. Oxford : Boulevard / The Oxford Centre for Hebrew and Jewish Studies. Yanasovitsh, Yitskhok, 1981 : Avrom Sutskever – zayn lid un zayn proze. Tel Aviv : Farlag Yisroel-bukh. Jeffrey A. Grossman The Invention of Love ? Or How Moyshe Leyb Halpern Read Heinrich Heine Introduction : Star-Crossed Lovers – Heinrich Heine and Moyshe Leyb Halpern In 1918, the publisher Farlag Yidish produced an eight-volume edition of ‫הײנע אין ַאכט בענד‬ ַ ‫הײנריך‬ ַ ‫ די ווערק ון‬,1 translated by a list of Yiddish writers that included Y. L. Perets, H. N. Bialik, D. Frishman, D. Edelshtat, Avrom Reyzen, Reuven Ayzland, Y. Y. Shvarts, Y. Rolnik, Mani Leyb, Moyshe Leyb Halpern, and other lesser-known writers – that is, a list numbering some of the most important Yiddish writers of the time. Although two worked primarily in Hebrew ( Bialik, Frishman ), the list also includes the most avant-garde of the three ‘ classical ’ writers ( Peretz ), a Sweatshop Poet ( Edelshtat ), and especially a range of writers associated with the American-based movement ‫ “ ( די יונגע‬The Young Ones ” or “ Young Generation ” ). Indeed, the scope of this project, together with the involvement of such writers, makes the Heine edition into a veritable event in Yiddish literature, one that clearly attests to his importance – especially, though not solely, in the American context. Yet it also prompts the question of how one is to account, more generally, for Heine ’ s presence in Yiddish literature – a question that invites various responses – in terms, for instance, of how Heine was translated, of book publishing, production, and distribution, of audience and reception, of literary influence. Within the space of this essay, I seek to delimit the question by focusing on one poet for whom Heine played a central role and who translated various of his works : Moyshe Leyb Halpern ( 1886 – 1932 ). Speciĳically, this essay argues that Halpern ’ s own reading and translation of Heine led to a creative appropriation that constitutes a key moment in his own development as a writer. In particular, this analysis argues that that relationship, somewhat unexpectedly, plays a key role in a poetic shift that, as Chana Kronfeld has shown, Halpern initiated.2 Halpern moved from the initial poetic inFor their helpful comments on earlier versions of this essay, I would like to thank David Roskies, Jeremy Dauber, and Walter Grünzweig. 1 2 Heine 1918. Kronfeld 1996 : 165 – 184. 130 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ novations of ‫ – די יונגע‬who, in their attempt to broaden the forms of Yiddish poetry, introduced a stronger sense of individual subjectivity and pushed the Yiddish language to new levels of emotional depth and complexity – to a new level of irony and self-reflectivity, and to a new conception of poetry ’ s relationship to the world. This new conception found its strongest expression in the poets associated with the movement and journal known as ‫ ( אין זיך‬literally, ‘ Within Oneself ’ ) and the circle of poets often referred to as ‫ אינזיכיסטן‬or “ Introspectivists, ” but Halpern initiated the shift. Halpern ’ s own centrality in modern Yiddish poetry means, in turn, that the complexly positioned ĳigure of Heinrich Heine – cosmopolitan, Jewish apostate ( but publicly identiĳied as a Jew ), exile in France, provocateur, Saint Simonian celebrator of the flesh and its liberation, political critic, consort of Lasalle, Marx and Engels – also ultimately played a central role in modern Yiddish literature. To be sure, Halpern is represented in ‫הײנע‬ ַ ‫הײנריך‬ ַ ‫ די ווערק ון‬with only one translation, his version of Deutschland, ein Wintermärchen.3 But he also helped pave the way for this edition with the series of translations he published ( under the pseudonym Hel-Pen ) in the New Yorkbased satirical journal ‫ ‘ ( דער גרויסער קונדעס‬The Big Stick ’ or ‘ The Big Prankster ’ ) in 1913, including, besides Deutschland, selections from Buch der Lieder, the Neue Gedichte, Atta Troll, “ Das Sklavenschiff ” and “ Der Apollogott. ” 4 Indeed, ‫הײנע‬ ַ ‫הײנריך‬ ַ ‫ די ווערק ון‬needs to be seen not as the endpoint of Heine translation in Yiddish, but as a pinnacle within a continuum : this continuum includes, e. g., Bialik ’ s translation of Prinzessin Sabbat, reprinted in this collection, but ĳirst published in Russia in 1907, as part of a protest against a law that would require Jews to close their businesses on Sundays ; 5 at least two earlier versions of Heine ’ s anti-religious poem “ Disputazion ”, the third of his Hebräische Melodien ( 1851 ), which, in satirizing this medieval institution, set in this case in Spain, targets both rabbi and monk, and ends with the declaration that “ alle beide stinken ” ; 6 a selection of Heine ’ s works translated by one “ Leon ” in New York in 1909 ; Zalman Reyzen ’ s translation of Die 3 Heine 1918 ( viii . 2 ) : 1 – 106 ; Reuven Ayzland translated much of the prose, including Der Rabbi von Bacherach and Die Reisbilder, as well as the epic poem Atta Troll, while Avrom Reyzen, Zishe Landoy, Mani Leyb, Liliput, and Naftali Gros translated much of the lyric poetry. 4 Heine 1913 a : 5 ( 5 ) : 7 ; 1913 b : 5 ( 12 ) : 7 ; 1913 c : 5 ( 14 ) : 7 ; 1913 d ; 1913 e : 5 ( 20 ) : 7 ; 1913 f : 5 ( 21 ) : 7, 5 ( 22 ) : 7, 5 ( 23 ) : 7, 5 ( 24 ) : 7, 5 ( 25 ) : 7, 5 ( 26 ) : 7, 5 ( 27 ) : 7, 5 ( 29 ) : 7, 5 ( 30 ) : 7, 5 ( 31 ) : 7, 5 ( 32 ) : 7, 5 ( 33 ) : 7, 5 ( 34 ) : 7, 5 ( 35 ) : 7 ; 1913 g : 5 ( 43 ) : 9, 5 ( 44 ) : 7 ; 1913 h : 5 ( 45 ) : 7 ; 1913 i : 5 ( 46 ) : 7, 5 ( 47 ) : 7 ; 1913 j : 5 ( 48 ) : 7, 5 ( 49 ) : 7 ; 1913 k : 5 ( 49 ) : 7. 5 Shmeruk 1988 : 379 – 389. 6 Heine 1973 – 1997 ( iii . 2 ) : 172 ( hereafter abbreviated to dha ) ; Sol Liptzin discusses Shimen Frug ’ s ‘ softening ’ of the dispute in his version of the poem ; Liptzin 1992 : 69 f. Jeffrey A. Grossman : The Invention of Love ? 131 Harzreise ( Warsaw, 1911 ) ; B. Shimin ’ s version of Der Rabbi von Bacherach ( New York, 1913 ) ; a one-volume edition ( 160 pages ) calling itself Heine ’ s ‫געזאמלטע שריטן‬ ַ ( 1915 ) ; collections of the lyric poetry translated by S. J. Imber ( Vienna, 1920 ) and Ezra Korman ( Kiev, 1929 ) ; and a 1936 translation of Deutschland, ein Wintermärchen, published in Moscow.7 All of this raises the question of what drove the enthusiasm for Heine, an enthusiasm often cited but only rarely explored in any detail.8 The obvious answer is that Heine was internationally the mostly highly regarded and visible European writer of Jewish extraction and hence acquired eo ipso the status of literary model.9 Indeed, the introduction to the 1918 Heine edition would seem to conĳirm this view when its author, Socialist-Zionist Nahman Syrkin, argues that despite his baptism Heine “ is at the root of his soul Jewish, exclusively Jewish. ” 10 This claim, to be sure, runs up against Heine ’ s own writing and actions – his immersion in German and European culture and society, his complex relationship to Jews and Judaism, as well as his conflicted set of afĳiliations – personal, ideological, and otherwise.11 Yet, this claim also shows, those seeking to promote Heine in Yiddish as model Jewish writer had little trouble dispensing with such inconvenient details as Heine ’ s apostasy or conflicting cultural afĳiliations. Still, whatever purposes it may have served – ideological, rehabilitatory, and so on – Syrkin ’ s account ultimately remains unsatisfactory. It does so because it fails to explain speciĳically what Yiddish writers as writers responded to in Heine ’ s work ; what, for instance, about Heine mattered for them in terms of poetics and cultural repertoire – of language, form, meter, style, use of metaphor and irony, or motifs and cultural references. By focusing on the speciĳic case of Moyshe Leyb Halpern, I hope to begin a mapping of this response. To be sure, as the 1918 edition suggests, others responded in signiĳicant ways to Heine, however provisionally.12 7 This list draws in part on the bibliography compiled by Amy Blau in her dissertation, “ Afterlives : Translations of German Weltliteratur into Yiddish ” ; Blau 2005 : 294 f. 8 Detailed treatments include : Shmeruk 1988 ; Liptzin 1992 ; Levinson 2008 : 121 – 130 ; Pareigis 2008, focusing speciĳically on the translation of Heine ’ s Hebräische Meolodien in the 1918 Yiddish edition ; Gruschka 2011. On Heine and Halpern, see : Steinberg 1930 : 205 f ; Greenberg 1942 : 17 ; Hellerstein 1980 : 625 – 627 ; Wisse 1988 : 76, 84. 9 Liptzin 1992 : 67. 10 Syrkin 1918 ( i ) : 8, “ ‫ אויסשליסלעך ייִ דיש‬,‫זײן נשמה ייִ דיש‬ ַ ‫הײנע איז אין דעם שורש ון‬ ַ „. 11 There is a minor industry focused on the question of Heine and Judaism/Jewish culture. One can begin to gain a sense of the debates if one consults the following : Rosenthal 1973 ; Robertson 1988 ; Gelber 1992 ; Holub 2002 ; Briegleb 2005. 12 Besides Perets and Edelstadt, whose poem ‫צוואה‬ ָ ‫מײן‬ ַ ( “ My Last Will and Testament ” ) recast Heine ’ s paean to Napoleon as liberator, “ Die Grenadiere, ” as an international working-class protest song, Sol Liptzin notes, for instance, Sh. Frug and Sweatshop Poet Joseph Bovshover ; from ‫ די יונגע‬he cites only Moyshe Nadir, who, Liptzin claims, learned from Heine “ ‘Weltschmerz, ’ sweet melancholy, and sentimental love for all mankind, ” as well as 132 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Yet Halpern represents an especially important case, both because of his peculiar relationship to Heine and because of his unique position in Yiddish literature. Halpern ’ s response went beyond a question of mere influence or emulation, and seems to have consisted in a personal, even uncanny afĳinity. In ‫ ( יונג ַאמעריקע‬1917 ), his critical essays on writers associated with ‫די יונגע‬, Noah Steinberg stresses that Halpern, who knew Heine by heart and “ quoted him at every opportunity, ” learned much about poetry ( perhaps too much, in Steinberg ’ s view ) from Heine.13 Eliezer Greenberg further suggests how this afĳiliation operated at the affective level, suggesting that Halpern ( and Morris Rosenfeld ) had Heine “ in their blood ” ( ‫) אין זייער בלוט‬, something expressed in their “ biting tones and hot temperaments ” ( ‫טעמפּעראמענט‬ ַ ‫בײסיקייט און היציקן‬ ַ ). Later critics, like Ruth Wisse and Kathryn Hellerstein, similarly suggest Heine ’ s importance for Halpern.14 Additionally, as noted above – Halpern ’ s sometime association with ‫ די יונגע‬notwithstanding – he occupies a transitional position in modern Yiddish poetry : something that makes Halpern ’ s attachment to Heine, likewise a transitional ĳigure in nineteenth-century German literature, all the more signiĳicant. It suggests that one key to tracing Heine ’ s impact on Yiddish consists of tracing his impact on Halpern. Or, in asking : What did Moyshe Leyb Halpern learn from Heine ? In the following, I will seek to show that Halpern ’ s relationship to Heine operates on two levels – he exerted on Halpern a personal pull ( the uncanny afĳinity ) and he served for Halpern as a model to respond to and indeed to appropriate from productively. It is almost as if something about Heine beyond the printed word might inform and shape Halpern ’ s writing and relationship to poetry, and that ‘ something ’ also ĳinds expression elsewhere in Halpern ’ s life. To make this case, however, we must ĳirst briefly consider the ĳigure and poetry of Heinrich Heine. Excursus on H. Heine Until three decades ago, Heinrich Heine – who was born Harry and who always signed his name to his works as H. Heine – was one of the most controversial ĳigures in German literature, a status he has sometimes occupied for many Jewish readers as well. It was a status that Heine himself at times seems, to have intentionally cultivated. This controverthe “ sobering irony ” needed to subvert the sentimentality ; Liptzin 1992 : 75. 13 Steinberg 1930 : 205. 14 Greenberg 1942 : 17 ; Hellerstein 1980 : 625 – 627 ; Wisse 1988 : 76, 84. Jeffrey A. Grossman : The Invention of Love ? 133 sial status derived from several factors, but if one were to try to deĳine the source of it, one might begin with Heine ’ s complex relationship to both power and writing. In a recent three-volume documentation of Heine reception, for instance, the editors note that if Heine is internationally known mainly as a poet, responses to him in Germany and Austria always revolved around “ allgemeine literarische, kultur- und gesellschaftspolitische Fragen, ” and that even literary debates – about romanticism and realism, for instance – are “ nicht selten bereits zu Lebzeiten politisiert, Heines Schreibweise mit seinen Verhältnissen zum Französischen und zum Jüdischen erklärt und identiĳiziert, ” with the result that “ Nationalismus und Antisemitismus ” become “ Kernzonen der Heine Kritik. ” 15 From the outset, for instance, Heine expressed sympathy in his poetry and prose for the common people, even as he antagonized both German nationalists and the Prussian state with his biting satire. That satire found its perhaps most famous expression in his narrative poem, Deutschland, ein Wintermärchen ( 1844 ), in which the speaker, like Heine, returns to Germany for a visit after many years abroad, and reflects on conditions there as he travels through its cities and towns. Eventually, he arrives in Hamburg – where Heine himself had once lived and, as a young man, failed in business – and encounters the ĳigure of Hammonia, a mix of lady of the night and prophetess, who offers to provide the speaker with a view of Germany ’ s future, to be glimpsed in her chamber pot. Refusing to share this vision with his readers, the speaker does go on to describe emphatically its putrid smell. While representing Heine's most sustained satire of German nationalism, Deutschland, ein Wintermärchen was by no means the only one ; nor was German nationalism the only object of Heine ’ s satire – indeed, he also targeted the middle classes, poetic movements, the objects of his own desire, and even the emotional states he would evoke in his own poetry. On several occasions, Heine also managed to overshoot the mark – doing it so drastically that even his adherents found it difĳicult to defend him, as, for instance, when he attacked for his homosexuality the poet August von Platen, who had disparaged Heine with an anti-Semitic remark.16 The scandals notwithstanding, Heine ’ s early, partly ĳictionalized travel narratives, Die Reisebilder ( 1826 – 1831 ) and, with its second 1837 edition, the Buch der Lieder ( 1827 ), made him immensely popular in Germany and abroad. While often striving to achieve a ‘ folk tone, ’ Heine ’ s poetry also appealed to a largely middle- and upper-class read15 Goltschnigg and Steinecke 2006 ( i ) : 6. 16 For two different accounts of this scandal, see Hermand 1993 : 51 – 63 and Mayer 1977 : 207 – 223 ; on the logic of such attacks by Heine, see Holub 1981. 134 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ing public, his satires of such classes notwithstanding.17 Poem 50 of the Lyrisches Intermezzo cycle ( “ Sie saßen und tranken am Theetisch ” ), for instance, depicts a desiccated upper-crust salon culture in which everyone speaks effusively of love, while all passion is suppressed for the sake of good form and the adornments of wealth and reĳinement.18 Many of the details of Heine ’ s life are now well known.19 Beyond his baptism in 1825 at age twenty-seven, in the hope of attaining a professorship – a civil service position at that time barred to Jews – Heine ’ s move to Paris in 1831, following the July Revolution of 1830, was a signal event. In Paris in the 1830s, he turned increasingly to prose – journalism and essays that sought to mediate between France and Germany. Having failed to secure an income by other means, Heine became in this context one of the ĳirst German writers to earn his living from writing, an income supplemented by support he ultimately received from his Uncle Salomon, a self-made millionaire, with whom he had a complex, but important, relationship. Known for his radical politics, Heine also upset progressive colleagues when he challenged received views or satirized a ĳigure like Ludwig Börne in Ludwig Börne : Eine Denkschrift ( 1840 ), whose ascetic view of politics Heine attacked, even while implicating Börne in a ménage à trois with Börne ’ s friend Jeanette Wohl and her husband. In that same work, Heine distinguished between pleasure-seeking, sensuously oriented Hellenes ( like himself ) and austere, ascetic Nazarenes ( like Börne ), a distinction opposing traditional monotheism, but which Heine grasped primarily in conceptual terms ( there could be Hellene Jews or Christians, Nazarene atheists ).20 In 1848, before the revolution, Heine was struck by a mysterious paralyzing illness that would soon conĳine him to what he called his “ mattress grave ” for the last eight years of his life. Although in the 1840s Heine had published his collection of lyric poetry, Neue Gedichte, and the satirical epic poems Deutschland, ein Wintermärchen and Atta Troll, his poetry after 1848 acquired a new quality – published during his lifetime in the volume Romanzero ( 1851 ), containing the three Hebräische Melodien, and in Gedichte 1853 und 1854 ( 1854 ), and posthumously. While some of the late poetry, which often dwells on death and, later, physical decay, has repelled some critics, others ĳind it to be among his strongest work.21 In his Geständnisse ( 1854 ), Heine declared his belief in God and rejection of atheism, claims that upset some readers and con17 Klusen 1973 : 43 – 60. 18 dha i . 1 : 183 f. 19 See the biographies by Hauschild and Werner ( 1997 ) in German, and by Sammons ( 1979 ) in English. 20 dha xi : 17 – 19, 31 f. 21 Kruse 2002 : 315 – 341. Jeffrey A. Grossman : The Invention of Love ? 135 fused others, since he seems to have held pantheistic beliefs earlier and because he ascribed his return to religion to his reading of the Bible, though he had long held it to be important. Heine ’ s religious turn has prompted some to view it as a return to Judaism ; it seems just as likely that, whatever his beliefs in a personal God, Heine continued to reject organized religion.22 A signiĳicant point in Heine ’ s poetic development came with his declaration of the “ end of the period of art ” ( “ das Ende der Kunstperiode ” ), a term he applied to Weimar Classicism and German Romanticism, which, by adhering to ideals of aesthetic harmony or, in the case of Romanticism, withdrawing into the Middle Ages, stood in contradiction to the present from which they isolated themselves.23 Along similar lines, Heine declared himself both the last of the Romantic writers and the onset of something new, a point that, beyond showing Heine ’ s capacity for immodesty, also suggests a view of poetry ’ s embeddedness in problems of the everyday and of power, however complex the connection may be. Heine thus often took up the imagery and motifs of the Romantics – for example, the interest in love as an uplifting experience, the fascination with irony, with exotic imagery, medieval knights and maidens, and with folk poetry – only to undermine the Romantics ’ poetic strategies and attitudes. In this way, Heine set out both to renew German poetry and to challenge Romantic poetics and ideologies. One can glimpse this practice in his famous “ Loreley ” poem, “ Ich weiß nicht, was soll es bedeuten ” : 24 Ich weiß nicht, was soll es bedeuten, Daß ich so traurig bin; Ein Mährchen aus alten Zeiten, Das kommt mir nicht aus dem Sinn. I do not know what it means that I am so sadly inclined; There is an old tale and its scenes that Will not depart from my mind. Die Luft ist kühl und es dunkelt, Und ruhig fließt der Rhein; Der Gipfel des Berges funkelt Im Abendsonnenschein. The air is cold and darkling, And peaceful flows the Rhine; The mountain top is sparkling, The setting sunbeams shine. Die schönste Jungfrau sitzet Dort oben wunderbar, Ihr gold ’nes Geschmeide blitzet, Sie kämmt ihr goldenes Haar. The fairest maid is reclining In wondrous beauty there; Her golden jewels are shining, She combs her golden hair. 22 See, e. g., Sammons 1979 : 305 – 310. 23 dha xii . 1 : 47. 24 dha i . 1 : 209 ( Heine 1982 a : 76 f ). 136 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Sie kämmt es mit goldenem Kamme, Und singt ein Lied dabei; Das hat eine wundersame, Gewaltige Melodei. With a golden comb she is combing, And sings a song so free, It casts a spell on the gloaming, A magical melody. Den Schiffer im kleinen Schiffe Ergreift es mit wildem Weh; Er schaut nicht die Felsenriffe, Er schaut nur hinauf in die Höh.’ The boatman listens, and o ’er him Wild-aching passions roll; He sees but the maiden before him, He sees not reef or shoal. Ich glaube, die Wellen verschlingen Am Ende Schiffer und Kahn; Und das hat mit ihrem Singen Die Lore-Ley gethan. I think, at last the wave swallows The boat and boatman ’ s cry; And this is the fate that follows The song of the Lorelei. The poem contains all the elements of a typical German Romantic poem – the use of folktale, the rocky cliffs along the Rhine possessed by a spirit, the longing of the lover, the Rhine itself – but it combines them in such a way as to result in complete disaster for the boatman, driven mad by erotic desire, and to suggest as well the speaker ’ s own troubled sense at the scene he has placed before us.25 While these features, together with its musicality, gained for the “ Loreley ” its status as popular folk song, other poems, to be discussed later, point even more to Heine ’ s modernity, his marking the advent of something new and beyond the Romantic movement. Halpern and Heine : An Uncanny Afĳinity In 1915, nearly a century after Heine declared the end of the Kunstperiode, Moyshe Leyb Halpern sought to defend the new poetry of ‫ די יונגע‬with a critique of the older Sweatshop Poet Morris Rosenfeld ( 1862 – 1923 ). Responding to both Rosenfeld ’ s ‫ ( בוך ון ליבע‬1914 ) and to other critics ’ responses to that volume, Halpern agreed that Morris Rosenfeld ’ s recent attempts to write love poetry had failed ; he disagreed with other critics about the reasons.26 Where they wondered what had become of the “ old ” Morris Rosenfeld, worrying that he had “ broken down ” or “ been destroyed ” ( ‫געווארן‬ ָ ‫קאליע‬ ַ ), Halpern maintained that he was alive and well. Rather, he argued, the love poems failed because Morris Rosenfeld ’ s métier was the protest poem, and while he had 25 Altenhofer 1982 : 22. 26 Halpern 1915 : 100 – 105. The title of Rosenfeld ’ s volume seems calculated to evoke Heine ’ s Buch der Lieder, see Rosenfeld 1914. Jeffrey A. Grossman : The Invention of Love ? 137 long mastered the versiĳied form of political protest and hammered out poems like a blacksmith, he lacked the receptive capacities, sensitivity to language, and emotional complexity of a poet like Heine, a point Halpern reinforces by citing the opening lines of “ Die Loreley. ” 27 Rather than recover his old self, Rosenfeld would truly need to destroy – or overcome – that self if he wanted to write good love poetry. Beyond the Heine reference, Halpern supports his criticism by comparing Rosenfeld ’ s love poems to those of such poets as Mani Leyb, Zishe Landau and Joseph Rolnik, thus suggesting his effort to deĳine a poetics for ‫די‬ ‫יונגע‬, one that emphasized the qualities Rosenfeld lacked. Additionally, the metaphors of breakdown, self-destruction and self-overcoming signal in quasi-Nietzschean terms the desire for a poetry that will project a new sense of subjectivity. They signal Halpern's desire for an expanded repertoire of tropes, motifs, and poetic strategies that would in turn expand the capacities of the Yiddish language itself. Harsh as it was, Halpern ’ s criticism here was nonetheless far tamer than his earlier attack on Rosenfeld – one that in its excess, if not in its speciĳic content, evokes Heine ’ s attacks on opponents like August von Platen and Ludwig Börne. Responding to a satirical jibe that Rosenfeld directed at the poets of ‫די יונגע‬, Halpern likened Rosenfeld to a tin clown in the Wurstelprater, an amusement park in Vienna. The clown, in Ruth Wisse ’ s account of this barb, “ would roll on the ground and squeal like a pig when you fed it a coin and pushed the ‘pig ’ button. ” 28 At a later date, “ the button has turned rusty, and though the clown still rolls on the ground when you put in your penny, he can no longer squeal. ” 29 In other respects, Halpern ’ s persona also seems to recall Heine – for example, his reputed provocations of friends and colleagues, his struggles with ĳinding gainful employment, his resentment at having to ask others for money, especially when he felt it due him as a writer, and the criticism of his poetry for its “ crude language. ” 30 Like many Yiddish writers, and Heine himself, Halpern also parodied religious orthodoxy, a point indicated, for instance, by his translation of Deutschland, ein Wintermärchen. When, for instance, in the poem ’ s thirteenth chapter, the poet-persona comes across the image of Jesus nailed to the cross, he declares : 31 27 28 29 30 31 Halpern 1915 : 103. Wisse 1988 : 91 f. Ibid. : 91. Ibid. : 75, 81 f, 98 f, 104. dha iv : 118. 138 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Sie haben dir übel mitgespielt, Die Herren vom hohen Rathe. Wer hieß dich auch reden so rücksichtlos Von der Kirche und vom Staate. Halpern rewrites the strophe thus : 32 ‫לײט‬ ַ ‫לײטיש די‬ ַ ‫האבן דיר אויגעשפּילט‬ ָ ‫עס‬ : “ ‫ארנומען דעם „ אויבן‬ ַ ‫האבן‬ ָ ‫וואס‬ ָ ‫רײ‬ ַ ‫רדאמט ַאזוי‬ ַ ‫א‬ ַ ‫האסטו‬ ַ ‫וואס‬ ָ ,‫טאקע‬ ַ ,‫נו‬ ? . . .‫די איידעלע היטער ון גלויבן‬ [ They ] played mischief with you respectably, the people Who occupied the “ top place ” Now, really, why did you damn so freely The noble protectors of faith … ? – hence allowing the criticism to be directed at religious Jews.33 Yet whatever criticism or even contempt he directed at the Jewish world, Halpern, like Heine, vigorously opposed anti-Semitism, just as they both subjected to criticism not just Jewish tradition, but also lapsed Jews.34 Additionally, Halpern, like Heine, had the capacity to vacillate between political gravity and sensual lightness; after penning a poem on a worker ’ s strike in Montreal, he soon wrote again about the same place, but dwelt instead on sexual exploits there.35 Such instances from Halpern ’ s critical writing and biography would indeed seem to suggest what I have called an uncanny afĳinity, conscious or unconscious, with Heine, one that manifested itself in various ways. To be sure, such an afĳinity would have little relevance here if it did not also bear on Halpern ’ s writing itself. In exploring that question, one might begin by turning to Halpern ’ s ĳirst volume of poetry, ‫אין‬ ‫יארק‬ ָ ‫ניו ־‬. Halpern ’ s Innovations Reconsidered Halpern ’ s publication of ‫ אין ניו ־ ָיארק‬in 1919, one year after the Heine edition, constitutes in itself a veritable event in Yiddish literature, a point suggested by Seth Wolitz ’ s penetrating analysis of the text.36 Taken to32 Heine 1918 ( viii ) : 48. 33 dha iv : 118 ; Heine 1918 ( viii ) : 48. 34 Wisse 1988 : 78 f, 88. 35 Ibid. : 89 f. 36 Wolitz cites, e. g., literary critic A. Tabachnik, who called ‫ אין ניו ־ יאָרק‬an “ epoch-making ” book, and poet Itsik Manger, who described it as “ one of the great books of poems in modern poetry whatsoever ” ( ‫פּאעזיע בכלל‬ ָ ‫מאדערנער‬ ָ ‫ ; ) איינס ון די גרויסע ביכער ון דער‬Wolitz 1977 – 1978 : 56. Jeffrey A. Grossman : The Invention of Love ? 139 gether, Wolitz argues, the poems of ‫ אין ניו ־ ָיארק‬present a dark world view, one in which the poetic voice “ wanders … endlessly … between walls of stone and iron, ” among circling streets peopled by “ human wrecks surrounded by flora and fauna. ” 37 New York City becomes in this view a “ labyrinthine wasteland, ironically called the Golden Land, ” a world of “ alienation and deformation ” from which there is no escape.38 Yet this initial view is spatial and static ; Halpern, as Wolitz goes on to show, took great care when collecting his poems to arrange them in ĳive sections or cycles, which, as such, offer a response to this initial view “ on the temporal level. ” 39 Their arrangement thus allows Halpern to offer an alternative “ programmatic expression, ” in which In Nyu-york becomes an epic journey that launches a protest – however tragic – against the predicament of the wanderer and his universe, one that culminates in the apocalyptic vision of the concluding ĳifth section, the long narrative poem ‫נאכט‬ ַ ‫ ַא‬. 40 Whatever other influences and creative impulses Halpern ’ s poetry displays – Chana Kronfeld emphasizes expressionistic ones, while Abraham Novershtern locates ‫נאכט‬ ַ ‫ ַא‬within the context of modern apocalyptic Yiddish writing ( e. g. of Bialik, Y. L. Perets and Perets Markish ) – the importance of In Nyu-york ’ s arrangement as an aesthetic construct charting the journey of a poet persona recalls in signiĳicant ways Heine ’ s poetic practice.41 It evokes, for instance, writing strategies found in Heine ’ s Buch der Lieder ( 1827 ), perhaps most overtly in the cycles Lyrisches Intermezzo and Die Heimkehr – though the arrangement of the poems plays in important role in the later collections – Neue Gedichte ( 1844 ), Romanzero ( 1851 ), and the Gedichte 1853 und 1854 ( 1854 ) – as well.42 37 Wolitz 1977 – 1978 : 62. 38 Ibid. 39 Ibid. 40 Wolitz 1977 – 1978 : 64 f. 41 Kronfeld 1996 : 33, 173 ; Novershtern 1993 : 124. 42 To be sure, one might point to other similarities : the depiction of disillusioned love in the ‫בלאנד און בלוי‬ ָ ( Blonde and Blue ) cycle of In Nyu-york ; the sense of an indifferent nature in Heine ’ s Nordsee cycles as reiterated in Halpern, though now set against the urban space of New York City ; even the dark apocalyptic vision of “ A nakht, ” which for all its expressionist imagery suffused with death and destruction, also recalls aspects of Heine, the late poetry – as in the “ Lazarus ” sub-cycles of both Romanzero and the Gedichte 1853 und 1854, or in poems like “ Schlachtfeld bei Hastings ” and “ Vitzliputzli, ” among others – with its own abundance of ghostly ĳigures, death imagery and destructive moments, not to mention the general presence of ghostly knights in much of Heine – who perhaps provided the model for the messianic white knight of ‫נאכט‬ ַ ‫ – ַא‬all of which is not to suggest that Heine constitutes Halpern ’ s sole source or inspiration. 140 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ This “ aesthetics of arrangement ” is one whose importance for Heine the late Norbert Altenhofer, among others, has lucidly analyzed.43 Its source, Altenhofer contends, resided for Heine in two conflicting desires : ĳirst, to document his own poetic development, and, second, to respond to the urging of friends ( so Heine claimed ) that he give in his collection a “ psychological-chronological portrait of the author ” – an act that for Heine brought the danger of lapsing into crude biographism, a charge that Friedrich Schiller had notably laid against a popular collection of poems by G. A. Bürger ( 1747 – 1794 ).44 Heine ’ s “ aesthetics of arrangement ” provides a response to this conflict, allowing him to undertake a self-reflective “ literary historical ” situating “ of his own production. ” 45 Perhaps more to the point is how this aesthetics expressed itself in the Buch der Lieder, Heine ’ s internationally most influential collection, and how it ĳinds parallels in In Nyu-york. On the one hand, Heine shapes the poems of Buch der Lieder into cycles that themselves contain narrative trajectories – Wolitz ’ s central point about In Nyu-york ; on the other hand, Heine also introduces ironic ruptures that allow for reflection and retrospection on the poems, together with a reworking of the motifs – both serving to historicize his literary production. Thus, for instance, to the Lyrisches Intermezzo Heine appended a prologue that, in depicting a knight who succumbs to a revivifying love fantasy, ultimately exposes that fantasy for the illusion it is. Thus exposed, it becomes a reflection on literary conceits prevalent, for example, among the German Romantics, and something to which Heine ’ s own early poetry was prone. The prologue additionally sets up a frame for the Lyrisches Intermezzo, more generally, which charts the poet persona ’ s movement from the opening hopefulness of “ Im wunderschönen Monat Mai ” across a series of embittering encounters, and which concludes with a poem that retrospectively reinterprets the whole project – aesthetic and psychological – of writing such poetry, a project that can now be laid to rest : 46 Die alten, bösen Lieder, Die Träume schlimm und arg, Die laßt uns jetzt begraben, Holt einen großen Sarg. … 43 44 45 46 The old songs ĳilled with anger, The bad dreams ĳilled with woe, Let ’ s bury them now – get hold of A mighty cofĳin, ho ! … See Altenhofer 1982 ; also Prawer 1960 : 46 – 53 ; Perraudin 1989 : 51 – 60. Altenhofer 1982 : 20. Ibid. : 21. dha i . 1 : 201 f ( Heine 1982 a : 75 ). Jeffrey A. Grossman : The Invention of Love ? 141 Wißt Ihr warum der Sarg wohl So groß und schwer mag seyn ? Ich legt ’ auch meine Liebe Und meinen Schmerzen hinein. Do you know why it ’ s so heavy, So great and long and wide ? I put my love and sorrow And all my pain inside. Although in a different vocabulary, Wolitz ’ s argument about Halpern similarly points to the importance of an aesthetics of arrangement, one in which Halpern ’ s “ programmatic expression ” follows a “ sequential flow of time, ” serving as a “ poetic organizing principle. ” As such, it “ increases the power of the repeated central metaphors weaving them into the general fabric, ” so that “ [ what ] appears static in one poem [ … ] is but the preparation for the coming peripeteia in the next. ” 47 The term peripeteia, deriving from the Greek for “ sudden turning, ” suggests, in turn, a writing practice central to Heine ’ s aesthetics of arrangement with its repeated ironic ruptures, and which manifests itself throughout In Nyu-york as well. One need only think of the motifs in the ĳirst cycle, ‫גארטן‬ ָ ‫ ( אונדזער‬Our Garden ), of “ gold, ” the “ golden land, ” and “ toiling ” ( in poems like ‫ [ צווישן קוימענרויכן‬Between Smoking Chimneys ],48 ‫קנעכ־‬ ‫ [ טיש בלוט‬Servile Blood ], “ Watch Your Step !, ” ‫לאנד‬ ַ ‫גאלדענעם‬ ָ ‫ [ אין‬In the Golden Land ], up to the long, concluding poem “ Pan Jablowski ” ), or of “ birds ” and “ flight ” ( as both physical act and escape ), that similarly recur there : hence, one can follow the “ bird ” of the opening title poem of that section, which flies off and ‫ארגעסט ַזײנע קינדערלעך אין נעסט‬ ַ ( forgets its birdlings in the nest ), to the various reworkings of these motifs 49 in “ Tsvishn koymenroykhn ” (/ ‫ וועל איך ווי געבונדען‬/ ,‫ ַאז דו וועסט ליגל געבן‬,‫מיר‬ ‫געהאקטע וווּנדן‬ ַ ‫ אין‬/ ‫אײזן‬ ַ ‫שטײג ון‬ ַ ‫)זיצן אין ַא‬,50 “ Ot-azoy-o … ” (That ’ s Life ; ‫ַא‬ ‫וואס שטייען אוין‬ ָ ,‫ ון קענדלעך מיסט‬/ ‫פּאפּיר ַארויף‬ ַ ‫טראגט ַא שטיק‬ ָ ‫וואס‬ ָ ,‫ווינט‬ ‫ [ הויף‬A wind lifting a paper scrap/ By trash cans in the yard out back ] ), to “ Der gasnpoyker ” ( ‫טראן‬ ָ ‫זײן‬ ַ ‫ ציטערט אויף‬/ ,‫רײ און ריילעך‬ ַ ‫זינגט דער ויגל‬ ‫רײ‬ ַ ,‫ ווי דער ויגל‬,‫ זינג איך‬/ ,‫כּדאי‬ ַ ‫ ציטערן איז ניט‬/ ,‫ [ דער מלך‬Freely, happily the bird sings./ Trembling on their thrones sit kings./ Trembling isn't worth a thing/ I sing, free as a bird ] ),51 to the poet-speaker of — ‫ָזאג איך צו מיר‬ ( Talking to Myself ) dreaming of escape into a natural world beyond the city, or the ironic ‫טאג‬ ָ ‫ דער ערשטער רילינג ־‬which recasts earlier references in the cycle : 52 47 Wolitz 1977 – 1978 : 63 ; cf Perraudin ( 1989 : 60 ), who makes a similar point about the subcycle of Heine ’ s “ Fischer ” poems in Die Heimkehr. 48 Translations of ‫יארק‬ ָ ‫ אין ניו ־‬from Hellerstein 1980. 49 Halpern 1954 : 14, 16, 17, 35, 19, 21. 50 “ Give wings to me, and I ’ ll stay/ Gagged and bound/ In an iron cage,/ Nursing my wounds ” ( Ibid. : 25 ). 51 Hellerstein 1980 : 65; translation modiĳied. 52 Halpern 1954 : 22. Translation from Hellerstein 1980 : 38. 142 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ‫שרײבן‬ ַ ‫ מוזן‬,‫ במחילה‬,‫ וועט ער שוין‬,‫נו‬ ‫נאך ַא רילינגליד‬ ָ ,‫אר אונדזער וווּנדערלעכער וועלט‬ ַ ‫וואס בליט‬ ָ ‫גארט ַאזוי צו הערן ון ַא בלום‬ ַ ‫וואס‬ ָ ‫וואס טרעלט און טרעלט‬ ָ ‫און ון ַא געלן ייגעלע‬ .‫נאך ַא ביסל‬ ָ ‫און טרעלט‬ So sorry – he will need to write One more spring song For this our marvelous world Craving to hear about a flower blooming, About a yellow bird that trills and trills And trills a little more. Yet In Nyu-york recalls Heine in more speciĳic ways, as suggested, for instance, by Halpern ’ s poem ‫ה‬$‫מאדנע מחש‬ ָ ‫ “ ( ַא‬A Strange Thought ” ), which bears more than thematic resemblance to a poem like Heine ’ s Lyrical Intermezzo 51, “ Vergiftet sind meine Lieder ” ( “ Envenomed are my songs ” ) : 53 Vergiftet sind meine Lieder ; – Wie könnt es anders sein ? Du hast mir ja Gift gegossen Ins blühende Leben hinein. Envenomed are my songs, How could it be otherwise, tell ? Since you trickled poison Into my life ’ s clear well. Vergiftet sind meine Lieder ; – Wie könnt es anders sein ? Ich trage im Herzen viel Schlangen, Und dich, Geliebte mein. Envenomed are my songs, How could it be otherwise, tell ? My heart holds many serpents, And you, my love, as well. ‫ה‬$‫מאדנע מחש‬ ָ ‫ַא‬ ‫ איך קוק אויף דער פּען‬:‫ה‬$‫מאדנע מחש‬ ָ ‫ַא‬ ,‫דאכט‬ ַ ‫ און מיר‬,‫שרײבט‬ ַ ‫ ווי זי‬,‫האנט‬ ַ ‫מײן‬ ַ ‫און קוק אויף‬ .‫נאכט‬ ַ ‫הײנטיקער‬ ַ ‫געשטארבן אין‬ ָ ‫ַאז איך בין‬ ,‫בײ דער גויע אין הויז‬ ַ ‫דא‬ ָ ‫געשטארבן ָאט ־‬ ָ ,‫און מער ניט ־ די פּען איז געבליבן ון מיר‬ .‫פּאפּיר‬ ַ ‫ַא פּען און ַא ליד אויף ַא שטיקל‬ ,‫ילײכט נישט דערענדיקט געווען‬ ַ ‫דאס ליד איז‬ ָ ,‫ארן הויז‬ ַ ‫וווּ איז עס? עס ליגט אויף דער שוועל‬ .‫עס איז מיטן ווינט דורכן ענצטער ַארויס‬ ‫ דו וועסט קומען צו גיין‬,‫זײן‬ ַ ‫מארגן — קען‬ ָ ‫און‬ ,‫דײן וס‬ ַ ‫מײן ליד מיט‬ ַ ‫און טרעטן וועסטו אויף‬ .‫מײן גרוס‬ ַ ‫זאל קומען‬ ָ ‫ווארטן ון ענצטער‬ ַ ‫און‬ A strange thought : I look at my pen And it seems to me, as I watch my hand write, That I died last night. Died right here, in the house with the landlady And only this pen is left of me, A pen and a poem-scrap. The poem was not ĳinished, perhaps, And it lies on the front steps Where the wind carried it. And maybe you ’ll come by tomorrow And with your foot will step on the poem. And wait for my greeting to come from the window. 53 dha i . 1 : 185 ( Heine 1995 : 25 ). Halpern 1954 : 123. Translation modiĳied, based on Hellerstein 1980 : 280. Jeffrey A. Grossman : The Invention of Love ? 143 ,‫ילײכט‬ ַ ‫און בייז ווערן וועסטו און שילטן‬ ,‫לאזן מיר וועסטו ַא צעטל אין טיר‬ ָ ‫און‬ .‫מאל ניט קומען צו מיר‬ ָ ‫ַאז דו וועסט שוין קיין‬ And you ’ ll get angry and maybe you ’ ll swear And leave me a note on the door Say you ’ ll never come to me again. In both cases, the poems address themselves to the subject of disillusioned love as it relates to the writing of poetry, and present instances of the object of the poet ’ s love going beyond the act of rejection to that of destroying the poetry itself. Such images contain multiple levels of irony, as destruction of an illusion, or of exposing an illusion to be indeed nothing other than that, as in the Lyrisches Intermezzo prologue. On one level, the irony here consists of the fact that the speaker maintains the illusion that in somehow reaching poetically toward the desired love object, his poems might have some positive effect, an illusion that is exposed as such when it turns out that it is she who will affect his poetry – by poisoning or treading on it, even stamping it out. At another level, however, both poems treat the traditional notion of the poetic muse ironically – subverting the notion that the love of this feminized form inspires the male poet to compose his lyrics – even while they recuperate the muse in a kind of negative image of herself : rather than her love inspiring the poet to write, it is her contempt that “ inspires ” his pen.54 The Halpern – Heine intertextuality suggested here could be extended further – additional examples, for instance, would show Halpern ’ s emulation of Heine ’ s trochaic meter, which helps Halpern to achieve an idiosyncratic musicality not unlike Heine ’ s – as in such poems as ‫ און דו ַא רעמדנס רוי‬or ‫ראזן‬ ַ ‫ ַאלבום ־‬, both to be found in the volume In Nyu-york. Or one could cite Halpern ’ s free-verse poem ‫מא־‬ ַ — ‫דאם‬ ַ , which bears multiple intertextual relations to Heine ’ s work, and ultimately expression of debt to Heine ’ s Nordsee ( or North Sea ) poems, especially to Heine ’ s poem “ Seegespenst ” ( “ Sea Apparition ” ), although the anonymous addressee – “ Madame ” – recalls what many consider to be Heine ’ s most innovative prose work, the partly ĳictionalized, partly autobiographical travel narrative Ideen : Das Buch Le Grand ( 1827 ).55 It is, however, to two other poems by Heine and Halpern that we must turn if we want to understand the depth of Halpern ’ s poetic response to Heine. The ĳirst is Heine ’ s Lyrisches Intermezzo 37 ( “ Philister in Sonntagsröcklein ” ) : 56 54 That such depictions of a feminine object of love invite feminist criticisms of both Heine and Halpern goes without saying. 55 For a translation, see Ideas – Book Le Grand, in Heine 1982 b : 174 – 228. 56 dha i . 1 : 169. See the translation ( modiĳied ) by Hal Draper in Heine 1982 a : 63 f. 144 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Philister in Sonntagsröcklein Spazieren durch Wald und Flur ; Sie jauchzen, sie hüpfen wie Böcklein, Begrüßen die schöne Natur. Burghers in Sunday clothes strolling Through meadow and wood and lane, Like frisky young goats caracoling, Salute nature ’s beauties again. Betrachten mit blinzelnden Augen, Wie alles romantisch blüht, Mit langen Ohren saugen Sie ein der Spatzen Lied. Their bleary owl-eyes blink in The romantically blooming spring ; They cock long ears to drink in The song the sparrows sing. Ich aber verhänge die Fenster Des Zimmers mit schwarzem Tuch ; Es machen mir meine Gespenster Sogar einen Tagesbesuch But I – I am draping and glooming My windows with black like a pall The ghosts of the past are looming To pay me a daylight call. Die alte Liebe erscheinet, Sie stieg aus dem Totenreich. Sie setzt sich zu mir und weinet, Und macht das Herz mir weich. From the realm of the dead where ’ s she ’ s sleeping My old love shining appears ; She sits by my side and, weeping, She melts my heart in tears. The ĳirst two strophes of the poem introduce a Romantic motif, adopting the perspective of the artist alienated from the world of philistine burghers, evoking romantic imagery of forest, flora and sparrow song, all “ painted, ” as it were, under the radiant light suggested by the “ blinzelnden Augen ” and blossoming world. While the misunderstood artist commands the language and vision to generate this imagery of an idyllic setting, the irony of the poem enters from the outset in terms of the satirical light the speakers casts on the setting – the image of the philistine burghers sprightly hopping about like little goats and lacking the speaker ’ s profound emotional sensitivity.57 Yet beginning with the third strophe the poem adopts another perspective, one that self-reflectively turns the observing speaker into the object of his own observation. Oscillating between the subject and object of the poem, the speaker now casts his gaze upon himself, as he consciously adopts the position of the sensitive poet of authentic feeling alienated from the philistine burghers. His gesture of “ draping ” the windows in black cloth and exaggeratedly deĳiant use of the words “ ich aber ” ( “ but I – I ” ), however, point to his own emotional posturing, 57 Cf. Prawer ’ s ( 1960 : 37, 44 ) apposite comments on Die Heimkehr 20 as a poem depicting “ the dilemma of a post-Romantic poet who has lost even the naiveté of suffering, ” and about Heine ’ s “ tenderness ” toward the philistines in holiday mood. Jeffrey A. Grossman : The Invention of Love ? 145 his desire to stage a mournful emotional state while cultivating an aura of death – in spite of and perhaps also to spite – the burghers happily frolicking in the sunshine. The ĳinal evocation of the “ alte Liebe ” climbing out of the realm of the dead, recalling again a classical motif – one thinks of Eurydice, whom Orpheus must retrieve from the realm of the dead – reinforces the literariness, the staging, of the speaker ’ s emotional state. Even more explicitly than in his “ Loreley ” poem, Heine seeks here to invoke and adopt the language, imagery, and motifs of German Romanticism, even as he moves radically beyond it into a modern literary discourse and sensibility – one that ironizes the speaker ’ s impressionistic style, his own ostensibly special “ receptive powers ” to the natural world. Rather than one who merely experiences and records that world, the speaker becomes an active producer of it, one who generates its imagery and the “ reality ” of his emotional experience from within his own mind and language. Moreover, he reflects critically – at one remove, as it were – on the purposes, which are both artistic and social, for which he generates that world. Although set in the context of a New York beach ( presumably Coney Island ), Halpern ’ s “ Memento Mori ” proceeds along similar lines : 58 ,‫ וועט דערציילן‬,‫פּאעט‬ ָ ‫ דער‬,‫און ַאז משה ־ לייב‬ ,‫כוואליעס געזען‬ ַ ‫האט דעם טויט אויף די‬ ָ ‫ַאז ער‬ ,‫ַאזוי ווי מען זעט זיך ַאליין אין ַא שפּיגל‬ — ‫ ַאזוי ַארום צען‬,‫גאר‬ ָ ‫דאס אין דער רי‬ ָ ‫און‬ ? ‫דאס גלייבן משה ־ לייבן‬ ָ ‫צי וועט מען‬ And if Moyshe-Leyb, Poet, recounted how He ’ s glimpsed Death in the breaking waves, the way You catch that sight of yourself in the mirror At about 10 a.m. on some actual day, Who would be able to believe Moyshe-Leybl ? ‫ווײטן‬ ַ ‫האט דעם טויט ון דער‬ ָ ‫און ַאז משה ־ לייב‬ ? ‫האנט און גערעגט ווי עס גייט‬ ַ ‫באגריסט מיט ַא‬ ַ ‫האבן מענטשן יל טויזנט‬ ָ ‘ ‫און דווקא בעת ס‬ — ‫וואסער זיך ווילד מיט דעם לעבן גערייט‬ ַ ‫אין‬ ? ‫דאס גלייבן משה ־ לייבן‬ ָ ‫צי וועט מען‬ And if Moyshe-Leyb greeted Death from afar, With a wave of his hand, asking, “ Things all right ? At the moment when many a thousand people Lived there in the water, wild with delight, Who would be able to believe Moyshe-Leybl ? ,‫און ַאז משה ־ לייב וועט מיט טרערן זיך שווערן‬ ,‫האט צו דעם טויט אים געצויגן ַאזוי‬ ָ ’ ‫ַאז ס‬ ‫ארבענקטן אין ָאוונט‬ ַ ‫ַאזוי ווי עס ציט ַא‬ — ‫ארהייליקטער רוי‬ ַ ‫זײנס ַא‬ ַ ‫צום ענצטער ון‬ ? ‫דאס גלייבן משה ־ לייבן‬ ָ ‫צי וועט מען‬ And if Moyshe-Leyb were to swear That he was drawn to Death in the way An exiled lover is to the casement Of his worshipped one, at the end of the day, Who would be able to believe Moyshe-Leybl ? 58 See the translation by John Hollander ( Halpern 1987 : 174 ). 146 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ‫מאלן‬ ָ ‫אר זיי‬ ַ ‫און ַאז משה ־ לייב וועט דעם טויט‬ ,‫רײך שיין‬ ַ ‫ארבן ־‬ ַ ‫גאר‬ ָ ,‫ניט גרוי און ניט ינצטער‬ ‫באוויזן‬ ַ ‫האט ַארום צען זיך‬ ָ ‫ַאזוי ווי ער‬ — — ‫כוואליעס ַאליין‬ ַ ‫ווײט צווישן הימל און‬ ַ ‫דארט‬ ָ ? ‫דאס גלייבן משה ־ לייבן‬ ָ ‫צי וועט מען‬ And if Moyshe-Leyb were to paint them Death Not gray, dark, but colored-drenched, as it shone At around 10 a.m. there, distantly, Between the sky and the breakers, alone. Who would be able to believe Moyshe-Leybl ? The similarities between the two poems is something one need hardly rehearse. The self-reflectivity whereby the speaker functions as both subject of the observation and observed object – here, the poet Moyshe-Leyb – amidst the waves ; the preoccupation with death and indeed attraction to it as a lover to a worshiped woman ; the poet ’ s desire to remove himself from the people caught up in mundane pleasures – the multitudes wildly frolicking about in the water ; and the poet ’ s incessant asking about the credibility of the experience itself – all recall aspects of Heine ’ s “ Philister in Sonntagsröcklein. ” There is, though, an important difference, signaled by the two poems ’ different structures and trajectories. Whereas Heine ’ s “ Philister ” begins with the image of the philistines in the park and then redirects focus onto the solitary speaker staging the encounter with death, not least as a means of undermining the idealized image of artist versus philistine, “ Memento Mori ” stages from the outset the allegorical encounter with Death. It thus also situates the ensuing encounter with the everyday – the ‫וואסער זיך ווילד מיט דעם לעבן גערייט‬ ַ ‫ אין‬/ ‫– מענטשן יל טויזנט‬ within this allegorical framework, hence underscoring from the outset the text as a staged alternative world and foregrounding its status as poetic construct. The difference from Heine ’ s “ Philister ” is one of degree, not of quality or essence – since both depict the poet-persona ’ s break with the world and overt staging of the death encounter – but it does suggest that Halpern stands more ĳirmly within the aesthetics of the modern in contrast to Heine, who stands at its threshold and who, indeed, helps initiate it. One might make a similar point about the focus in ‫ה‬$‫מאדנע מחש‬ ָ ‫ ( ַא‬A Strange Thought ) on “ the pen, ” a form of reference absent from “ Vergiftet sind meine Lieder, ” but that amounts to a laying bare of the apparatus ( or device ) of text production, something that recalls, for instance, Russian formalist aesthetics, among other modern movements. What, though, was the nature of Halpern ’ s modernity, and how, if at all, did Heine ĳigure in it ? Chana Kronfeld proposes a response in her incisive treatment of Halpern ’ s innovations in Yiddish poetry, where she underscores Halpern ’ s modernity, in particular.59 Her analysis relies 59 Kronfeld 1996 : 165 – 184. Jeffrey A. Grossman : The Invention of Love ? 147 ,‫רגאנג אויף ביימער‬ ַ ‫זונא‬ ַ .‫הימל‬ ,‫באצירט‬ ַ ‫און ווינט און פּחד מיט טרויער‬ ‫דאס ייִ נגל אין מיר דעם מענטש דעם גרויען‬ ָ ‫און‬ ‫וואס ירט‬ ָ ‫האנט‬ ַ ‫הארכט צו זען די‬ ָ .‫שטארבן‬ ַ ‫זאל זיך לייגן‬ ָ ,‫די זון‬ ‫ארבן‬ ַ ‫זײנע‬ ַ ‫און דער קינסטלער אין מיר קוקט אויף‬ - - ‫גאלדיק און בלוי און רויט‬ ָ ‫וואס זענען‬ ַ ‫זײן לעבן וויינט ווי דער אייביקער טויט‬ ַ ‫און‬ ,‫וונטשײן‬ ַ ‫וואס איז שיין און ליכטיק אין ָא‬ ָ .‫אײן‬ ַ ‫מאמע וויגט עס‬ ַ ‫ווי ַא קינד ווען די‬ - ‫קאפּ דער גרויער‬ ָ ‫מײן‬ ַ ‫זאל זיך בויגן‬ ָ .‫קאפּ דער גרויער‬ ָ ‫מײן‬ ַ ‫זאל זיך בויגן‬ ָ Sky. Sunset on trees, and wind and dread decked out with grief, and the little boy in me to the man the gray one listens to see the hand that leads the sun, to lie down and die. And the artist in me looks at his paints which are golden and blue and red – and his life weeps like the eternal death that is beautiful and bright in the evening shine like a child when his mother rocks it to sleep. Let my gray head bend down – let my gray head bend down. considerably on a discussion of the ĳirst half of the late poem by Halpern, ‫רגאנג אויף ביימער‬ ַ ‫זונא‬ ַ ( “ Sunset on Trees ” ) : 60 For Kronfeld, “ Zunfargang oyf beymer, ” like the apocalyptic narrative poem “ A nakht, ” reveals the distinctions among ‫די יונגע‬, i. e. between the “ ironic faction ” of Halpern ( and Nadir ), the “ poetics of quietude ” of a Mani Leyb and his adherents, and the “ sober faction, ” with Leyvik as its foremost proponent.61 Kronfeld shows, moreover, that though the Introspectivist poets Yankev Glatshteyn, Aaron Glantz-Leyeles, and Nokhem B. Minkov criticized Halpern, a poem like “ Zunfargang oyf beymer ” reveals that Halpern had already begun to introduce poetic practices that the Introspectivists themselves would take up in their poetry. The poem, Kronfeld notes, begins by painting a stock impressionist image – or, as she calls it, “ one of the most conventional scenes of poetic and artistic impression : ‘sunset on trees ’ ” – which the speaker initially freezes as a static image.62 Impressionism, in this context, refers to a presumably modernist poetic technique that views the artist ’ s mind as that of a passive observer, who, as a detached spectator, receives the images of the world as sensory impression recorded on his or her retina, so that the poetic consciousness does not mediate through interpretation. Its activity consists only of organizing those impressions into a sensible image.63 Yet Kronfeld goes on to argue that the rhetorical structure of the second line of “ Zunfargang oyf beymer ” begins to call into question this impressionist structure. The expression of “ dread and grief ” in the second line could, for instance, still be viewed as impressionist, since it voices an “ impersonal objectiĳication of a Stimmung [ or mood ]. ”64 But 60 61 62 63 64 Halpern 1934 ( ii ) : 130 f. Translated by Chana Kronfeld ( 1996 : 182 ). Kronfeld 1996 : 174. Ibid. : 181. Ibid. : 178 f. Ibid. : 182. 148 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ she adds, in an argument that I cite here at length, both because of its incisiveness and its centrality to my point : 65 the equivalence of emotional and meteorological entities in the zeugma “ and wind and dread … with grief, ” especially the near-oxymoronic personiĳication of batsirt ( “ decked out, ” “ adorned ” ) when combined with “ grief ” or “ sadness ” ( troyer ), begins to call into question the possibility of being a detached spectator of a natural scene. In the third line the poem turns inward to a self-conscious contemplation of the lyrical “ I ” and with it to a total rejection of impressionism. Abandoning an impressionist rendition of a sunset, Halpern makes the possibility of such an artistic rendering a topic of his introspection. Through this thematization of poetic technique and artistic afĳiliation, the mind of the dramatized observer rather than being a passive, reflective medium becomes the only measure of reality. In building up to this point, Kronfeld stresses the model for Halpern of German Expressionism and its propensity to cast the work as an alternative world or reality, and indeed, Halpern ’ s play with syntax and his repertoire of imagery here do suggest Expressionism. Yet her discussion also helps explain what Halpern does adopt from Heine, even as he transforms it for his own purposes. Signiĳicantly, Kronfeld goes on to note the increasing intricacy of the interplay between visual perspective and poetic point of view in this poem, something aided by the complex syntax, the shift of focus onto the little boy inside the speaker who listens to the aging adult listening, but whom, as “ an outer, objectiĳied self, ” the boy fails to recognize as his own self.66 That aging persona had come to the sunset with a ready-made symbolic reading of aging and death that the boy still lacks. In other words, the “ I ” of the poem does not just passively receive the image of the sunset, but rather, as the poem itself suggests, actively constructs it. In this regard, Kronfeld argues that “ Zunfargang oyf beymer, ” by introducing Expressionist modes of writing, such as this use of irony and the complex syntax, ultimately amounts to an “ ironic critique of impressionism as veiled romanticism. ” 67 As with “ Memento Mori, ” though now enlisting a more overt Expressionist style and more overtly reflecting on the creative process, Halpern projects his poem as an alternative reality, or rather suggests how the painter and poet ( and, indeed, the human mind more generally ) shaped the world it imagines itself to be merely perceiving or registering. Yet as the discussion of Heine ’ s Lyrisches Intermezzo 50 ( “ Philister ” ) suggests, this is a form of irony 65 Kronfeld 1996 : 182. 66 Cf. Ibid. : 183. 67 Ibid. Jeffrey A. Grossman : The Invention of Love ? 149 that Heine himself had already come to and that Halpern had already responded to earlier in In Nyu-york.68 In other words, whatever else Halpern adopted from Expressionism – the more fundamental insight and practice of ironizing the received image and received tradition, an insight and practice central to his innovations in Yiddish poetry and one that, Chana Kronfeld shows, helped make the transition to the Introspectivism – this insight is something, I am arguing, that Halpern came to through his reading of Heine – of works, beyond “ Philister in Sonntagsröcklein, ” like “ Vergiftet sind meine Lieder, ” “ Seegespenst, ” and such prose works as Ideen : Das Buch Le Grand. In light of the centrality that Halpern ’ s innovations meant for the development of Yiddish poetry, it might then open up new perspectives on Yiddish poetry and Yiddish culture to give more attention to the role that a German Jewish apostate named Harry /Heinrich Heine played in this development as well. Bibliography Altenhofer, Norbert, 1982 : “ Ästhetik des Arrangements : Zu Heines Buch der Lieder. ” In : Text und Kritik 18 / 19 : 16 – 32. Blau, Amy, 2005 : “ Afterlives : Translations of German Weltliteratur into Yiddish. ” Ph. D. diss. University of Illinois, Urbana-Champaign. Briegleb, Klaus, 2005 [ 1997 ] : Heinrich Heine, jüdischer Schriftsteller in der Moderne : Bei den Wassern Babels. Wiesbaden : Marix. Gelber, Mark H., ed., 1992 : The Jewish Reception of Heinrich Heine. Tübingen : Niemeyer. Goltschnigg, Dietmar and Steinecke, Hartmut, eds., 2006 – 2011 : Heine und die Nachwelt. Geschichte seiner Wirkung in den deutschsprachigen Ländern. Texte und Kontexte, Analysen und Kommentare. 3 vols. Berlin : Erich Schmidt. Greenberg [ Grinberg ], Eliezer, 1942 : Moyshe Leyb Halpern in ram fun zayn dor. New York : Moyshe Leyb Halpern arbeter ring brentsh. Gruschka, Roland, 2011 : “ ‘Ss ’ harz in benken gejt mir ojß ’ : Heinesche Motive im Werk des jiddischen Dichters Oscher Schwarzman. ” In : HeineJahrbuch 50 : 108 – 128. Halpern, Moyshe Leyb, 1915 : “ Der alter un der nayer Moris Rozenfeld. ” In : Literatur un lebn 3 : 100 – 112. 68 Chana Kronfeld does acknowledge such tendencies in Halpern ’ s earlier work ( Kronfeld 1996 : 173 f ). 150 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ – 1934 : Moyshe Leyb Halpern. 2 vols. New York : Moyshe Leyb Halpern Komitet. – [ 1919 ] 1954 : In Nyu-york. New York : Farlag Matones. – 1987 : “ Memento Mori. ” Trans. John Hollander. In : Irving Howe, Ruth R. Wisse, and Khone Shmeruk, eds., The Penguin Book of Modern Yiddish Verse. New York : Viking Penguin, 174. Hauschild, Jan-Christoph and Michael Werner, 1997 : “ Der Zweck des Lebens ist das Leben selbst ” : Heinrich Heine – Eine Biographie. Cologne : Kiepenheuer & Witsch. Heine, Heinrich, 1913 a : “ Tsurik in der heym. ” Trans. Hel-pen [ Moyshe Leyb Halpern ]. In : Der groyser kundes 5 ( 5 ) : 7. – 1913 b : “ Dos hohe lid. ” Trans. Hel-pen [ Moyshe Leyb Halpern ]. In : Der groyser kundes 5.12 : 7. – 1913 c : “ Yolanta un Mariye. ” Trans. Hel-pen [ Moyshe Leyb Halpern ]. In : Der groyser kundes 5 ( 14 ) : 7. – 1913 d : “ Tsvey riter. ” Trans. Hel-pen [ Moyshe Leyb Halpern ]. In : Der groyser kundes 5 ( 19 ) : 7. – 1913 e : “ Lider. ” Trans. Hel-pen [ Moyshe Leyb Halpern ]. In : Der groyser kundes 5 ( 20 ) : 7. – 1913 f : Daytshland. Trans. Hel-pen [ Moyshe Leyb Halpern ]. In : Der groyser kundes 5 ( 21 ) : 7 ; 5 ( 22 ) : 7 ; 5 ( 23 ) : 7 ; 5 ( 24 ) : 7 ; 5 ( 25 ) : 7 ; 5 ( 26 ) : 7 ; 5 ( 27 ) : 7 ; 5 ( 29 ) : 7 ; 5 ( 30 ) : 7 ; 5 ( 31 ) : 7 ; 5 ( 32 ) : 7 ; 5 ( 33 ) : 7 ; 5 ( 34 ) : 7 ; 5 ( 35 ) : 7. – 1913 g : “ Dos shklafnshif. ” Trans. Hel-pen [ Moyshe Leyb Halpern ]. In : Der groyser kundes 5 ( 43 ) : 9 ; 5 ( 44 ) : 7. – 1913 h : “ Untergehert. ” Trans. Hel-pen [ Moyshe Leyb Halpern ]. In : Der groyser kundes 5 ( 45 ) : 7. – 1913 i : “ Der Apollo-got. ” Trans. Hel-pen [ Moyshe Leyb Halpern ]. In : Der groyser kundes 5 ( 46 ) : 7 ; 5 (47 ) : 7. – 1913 j : Atta Troll. Trans. Hel-pen [ Moyshe Leyb Halpern ]. In : Der groyser kundes 5 ( 48 ) : 7 ; 5 ( 49 ) : 7. – 1913 k : “ Lider. ” Trans. Hel-pen [ Moyshe Leyb Halpern ]. In : Der groyser kundes 5 ( 49 ) : 7. – 1918 : Di verk fun Haynrikh Hayne in akht bend mit a biografye fun E. Kalisher [ Kalischer ] un a forvort fun dr. N. Syrkin. Trans. Reuven Ayzland, Chaim Nakhmen Bialik, Zishe Landoy, Moyshe Leyb Halpern et al. New York : Farlag Yiddish. – 1973 – 1997 : Historisch-kritische Gesamtausgabe der Werke, ed. Manfred Windfuhr, 16 vols. Hamburg : Hoffmann und Campe. – 1982 a : The Complete Poems of Heinrich Heine : A Modern English Version. Trans. Hal Draper. Cambridge, ma : Suhrkamp/Insel Publishers Boston. Jeffrey A. Grossman : The Invention of Love ? 151 – 1982 b : Poetry and Prose, ed. Jost Hermand and Robert C. Holub. New York : Continuum. – 1995 : Songs of Love and Grief. A Bilingual Anthology Translated in the Verse Form of the Originals. Trans. Walter W. Arndt. Evanston, il : Northwestern University Press. Hellerstein, Kathryn Ann, 1980 : “ Moyshe Leyb Halpern ’ s In New York : A Modern Yiddish Verse Narrative. ” Ph.D. diss. Stanford University. Hermand, Jost, 1993 : Mehr als ein Liberaler : Über Heinrich Heine. 2nd expanded edition. Frankfurt am Main : P. Lang. Holub, Robert C., 1981 : “ Heine ’ s Sexual Assaults : Towards a Theory of the Total Polemic. ” In : Monatshefte 73 ( 4 ) : 415 – 428. – 2002 : “ Troubled Apostate : Heine ’ s Conversion and Its Consequences. ” In : Roger Cook, ed., A Companion to the Works of Heinrich Heine. Rochester, ny : Camden House, 229 – 250. Klusen, Ernst, 1973 : “ Heinrich Heine und der Volkston. ” In : Zeitschrift für Volkskunde 69 : 43 – 60. Kronfeld, Chana, 1996 : On the Margins of Modernism : Decentering Literary Dynamics. Berkeley : University of California Press. Kruse, Joseph, 2002 : “ Late Thoughts : Reconsiderations from the ‘ Matratzengruft. ’ ” In : Roger Cook, ed., A Companion to the Works of Heinrich Heine. Rochester, ny : Camden House, 315 – 341. Levinson, Julian, 2008 : Exiles On Main Street : Jewish American Writers and American Literary Culture. Bloomington : Indiana University Press. Liptzin, Sol, 1992 : “ Heine and the Yiddish Poets. ” In : Mark H. Gelber, ed., The Jewish Reception of Heinrich Heine. Tübingen : Niemeyer, 67 – 75. Mayer, Hans, 1977 : Außenseiter. Frankfurt am Main : Suhrkamp. Novershtern, Avrom, 1993 : “ Tsvishn morgnzun un akhres-hayomim : tsu der apokaliptisher tematik in der yidisher literatur. ” In : Di goldene keyt 135 : 111 – 135. Pareigis, Christina, 2008 : “ Mein westöstlicher dunkler Spleen : Zwischen zwei Sprachen : Heines Hebräische Melodien auf Jiddisch. ” In : Ulrich Wergin, Karol Sauerland, eds., with the assistance of Daniel Eschkötter, Bilder des Ostens in der deutschen Literatur. Würzburg : Königshausen & Neumann, 93 – 106. Perraudin, Michael, 1989 : Heinrich Heine : Poetry in Context – A Study of Buch der Lieder. Oxford : Berg. Prawer, S. S., 1960 : Buch der Lieder. London : Edward Arnold. Robertson, Ritchie, 1988 : Heine. London : Halban. Rosenfeld, Morris, 1914: Dos bukh fun libe. New York: M. Gurevitsh. 152 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Rosenthal, Ludwig, 1973 : Heinrich Heine als Jude. [ Frankfurt am Main ] : Ullstein. Sammons, Jeffrey, 1979 : Heinrich Heine : A Modern Biography. Princeton, nj : Princeton University Press. Shmeruk, Chone, 1988 : “ ‘Prinzessin Sabbat ’ by H. Heine in a Yiddish Translation by H. N. Bialik. ” In : Ada Rapoport-Albert and Steven J. Zipperstein, eds., Jewish History : Essays in Honour of Chimen Abramsky, London : Halban, 379 – 389. Steinberg [ Shteynberg ], Noah, [ 1917 ] 1930 : Yung Amerike. New York : Farlag Lebn. Syrkin, N[ahman], 1918 : “ Haynrikh Hayne, der tragisher yidisher dikhter. ” In : Heine 1918 ( i ) : 7 – 44. Wisse, Ruth R., 1988 : A Little Love in Big Manhattan. Cambridge, ma : Harvard University Press. Wolitz, Seth L., 1977 – 1978 : “ Structuring the World View in Halpern ’ s In New York. ” Studies in American Jewish Literature 3 ( 2 ) ; joint issue with Yiddish 3 ( 1 ) : 56 – 67. Harriet Murav Marking Time Bergelson and Bergson Born in 1884 in Okhrimovo, Ukraine, Dovid Bergelson achieved acclaim for the innovative style of his ĳirst published work, ‫קזאל‬ ַ ‫ווא‬ ָ ‫ ( ַארום‬At the Depot, 1909 ). He was one of the key ĳigures of the Kiev group, an association of Yiddish writers that also included the poet Dovid Hofshteyn and the Yiddish symbolist Der Nister, and he was one of the founding members of the Kiev Kultur-lige ( an association that promoted Yiddish culture ). Bergelson ’ s temporary exile in Berlin in the 1920s was one of his greatest periods of productivity ; his return to the Soviet Union in 1934 is usually described as heralding his conformity to the government-driven aesthetic of socialist realism. Bergelson ’ s service on the Jewish Anti-Fascist Committee during World War ii led to his murder by Stalin in 1952.1 Reading Bergelson produces the peculiar experience of a world in which all decisions have already been made, and in which, consequently, the present moment is merely the aftereffect of critical but obscure events.2 Failed politics, failed love, failed economic enterprise, and failed aspirations characterize life in the peculiar zone of the aftermath. Indeed the title of Bergelson ’ s novel, ‫נאך ַאלעמען‬ ָ ( alternatively translated as When All Is Said and Done and as The End of Everything ), captures this speciĳic temporal sensibility.3 Most critics therefore interpret Bergelson ’ s works as a realist representation of the decline of the shtetl ; Soviet criticism added the dimension of Marxist dialectics to this general view. I argue, in contrast, that Bergelson ’ s ĳiction is better understood in the context of European and Russian modernism as a new form of Yiddish narrative art. This essay will show that Bergelson used the transformations of the traditional Jewish life-world to craft a new poetics of creative futurity in response to the crisis of modernity itself. By making time ’ s duration palpable – “ marking time ” in the sense of imbuing it with tonality, weight, and rhythm – Bergelson revealed the potentiality of the present. 1 2 3 See Sherman 2007. For a discussion of this temporality in Kafka, see Greenberg 1961 : 266 – 273. See Bergelson 1977 ; Bergelson and Sherman 2010. 154 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ At the beginning of the twentieth century, new explorations of consciousness and perception, new technologies, the spread of capitalist modes of production, Einstein ’ s theory of relativity, the collapse of empires, World War I and the Russian Revolution shattered the continuity of time. In an essay originally published in 1922, Osip Mandelshtam said that the explosive quality of events meant that “ the concept of a unit of time has begun to falter and it is no accident that contemporary mathematics has advanced the principle of relativity. ” 4 The loss of a universal concept of time and the unmooring of the present from the past splintered time into contingent, disconnected moments. Moderns and modernists proclaimed that they had shed the past. Daily life in Berlin in the 1920s, for example, meant living “ on the edge of time, ” as Hans Ulrich Gumbrecht writes, without thought for the past or future.5 For the French philosopher Henri Bergson ( 1859 – 1941 ), however, the past retains its importance in shaping ongoing experience, because the past reaches forward into the future. In Creative Evolution, Bergson describes duration as “ the continuous progress of the past which gnaws into the future and which swells as it advances. ” 6 Duration, the unpredictable infusion of the heterogeneous past in the present, allows for “ creative evolution. ” Memory, for Bergson, is not the dead weight of the past, constricting the future, but rather, a space of potentialities, or, “ virtualities, ” awaiting realization. Habitual, repeated action forecloses possibility, and therefore Bergson values inaction, daydreaming, and art itself for their capacity to activate the unrealized potentialities of the past. This essay offers readings of early Bergelson through the lens of Bergson, who played a crucial role in early twentieth-century theoretical and artistic inquiries about memory, time, and consciousness. I see Bergelson ’ s writing as an artistic transposition of Bergson ’ s philosophy : the concrete realization in literary form of Bergson ’ s argument about the reality of the flow of time. My aim is not to establish Bergson ’ s direct influence on the Yiddish writer, but rather to show the contiguity of their ideas. In developing these parallels, I rely on Dan Miron ’ s concept of ‘ contiguity. ’ In From Continuity to Contiguity : Toward a New Jewish Literary Thinking, Miron rejects traditional models of influence, arguing instead for a more open-ended confluence of thought and artistic practice.7 After discussing Bergson ’ s thought and his reception in Russian and Yiddish, I turn to an analysis of three early works by Bergel4 5 6 7 Mandelshtam 1979 : 117. “ Living on the edge of time ” is the subtitle of Gumbrecht 1997. Bergson 1911 a : 4. Miron 2010. Harriet Murav : Making Time 155 son : ‫קזאל‬ ַ ‫ווא‬ ָ ‫ ַארום‬, ‫שטאט‬ ָ ‫ארגרעבטער‬ ַ ‫ “ ( אין ַא‬In a Backwoods Town, ” 1914 ) and ‫פּגאנג‬ ַ ‫ ( ָא‬Descent, 1920 ). Bergson ’ s importance in intellectual circles in Western Europe and America in the ĳirst part of the twentieth century has long been established, as has his signiĳicance for the major authors of the time, including Proust, Joyce, and Woolf. Françoise Nethercott has demonstrated his influence in Russia as well.8 Bergson ’ s appeal in the ĳin-de-siècle stemmed from his emphasis on a unifying life-force ( the élan vital ), his insistence on freedom and creativity, his proposition of an alternative form of knowledge – intuition, a non-analytic, sympathetic apprehension of the self in the world – and his view of art, which, in its approximation of intuition, transcends the limitations of philosophy.9 Bergson ’ s major writings, including Time and Free Will ( originally published in 1889 ), Matter and Memory ( 1896 ), and Creative Evolution ( 1907 ), and others were translated into Russian ; his study of laughter and his Introduction to Metaphysics were translated into Yiddish.10 Mandelshtam ’ s essay “ On the Nature of the Word, ” quoted earlier, directly refers to Bergson. Viktor Shklovsky and other writers associated with Formalism were deeply influenced by Bergson.11 Shklovsky ’ s “ Art as Device ” argued that the purpose of art was to impede the mere recognition of objects, thereby making perception slow and “ laborious, ” and he showed how estrangement and other devices, such as the “ retardation ” of the plot, achieved this end. The emphasis on perception as opposed to mere recognition echoes Bergson, who afĳirmed that art “ dilates our perception. ” 12 The new cinema of Shklovsky ’ s time was similarly interested in using the sped-up camera to see slowed-down time, as in Dziga Vertov ’ s 1918 experiment. In 1918, Vertov ( who changed his name from Dovid to Denis Kaufman, and then to Dziga Vertov ) had himself ĳilmed as he jumped from the second story of a building. The extreme slow-motion shot of Vertov ’ s leap transformed his rapid descent into an emotional ballet. Vertov wrote : “ Cranking the camera at maximum speed made it possible to see my thoughts during my leap on the screen. ” 13 The kino-eye ( camera ) revealed that what appeared to be a single, uniform action actually consisted of multiple, disparate transformations. Vertov conĳirmed what Bergson described in Matter and Memory as the 8 Nethercott 1995 ; for the Russian translation, see Nethercott 2008. 9 See Bergson 1965 : 135. 10 Bergson 1928 ; Bergson 1923. 11 Shklovsky planned to write a book on Bergson and cinema. For a discussion of Bergson ’ s role in Formalist thought, see Curtis 1976. For a discussion of Bergson and modernism, see Fink 1999. 12 Shklovsky 1990 : 6 ; Bergson 1965 : 157. 13 Vertov 1984 : 131. 156 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ truth of motion : “ real motion is the transference of a state and not a thing. ” 14 Vertov uncontracted or uncondensed the contraction of the past that is the normal work of memory, as it condenses the “ successive heterogeneity of perceptions ” into the single point of movement in the present. As Annette Michelson points out, for Vertov – as for other ĳilm-makers and theoreticians of the time in Western Europe – ĳilm made possible a fresh perception of the world, along the same lines that Shklovsky had argued for in “ Art as Device. ” 15 The elaboration and development of Bergson ’ s ideas, as evidenced in Shklovsky and Vertov, could also be seen in the Yiddish-speaking world. Bergelson ’ s Yiddish-language critics praised ‫קזאל‬ ַ ‫ווא‬ ָ ‫ ַארום‬using Bergsonian terms. For example, in his essay, ‘ ‫קזאל‬ ַ ‫ווא‬ ָ , ‫ ון‬- ‫בערגעלסאן‬ ָ ‫„ דוד‬ ” ‘ ‫פּגאנג‬ ַ ‫ ָא‬, ‫ ביז‬originally published in 1927, Nakhmen Mayzel remarks that the relations between Bergelson ’ s characters “ do not grow from the periphery to the center, but, on the contrary, from the interior to the center, from the artistic center to the periphery. ” 16 Mayzel ’ s use of the terms “ center ” and “ periphery, ” his reference to Bergelson ’ s “ intuition, ” and his emphasis on the “ unĳinished ” quality of Bergelson ’ s characters, his description of the world of ‫פּגאנג‬ ַ ‫ ָא‬as not lived, but “ dreamed ” ( ‫ אויסגעטרוימטע‬,‫ – ) אויסגעחלומטע‬reveal the direct influence of Bergson. In Time and Free Will, Bergson writes that the feeling of intensity is not given the motion of a sensation from the periphery to the center or the other way round, but rather, by the awareness of a multiplicity of states, each one of which ramiĳies into the other.17 In Matter and Memory, he links the capacity to form images with the rejection of activity : “ to call up the past in the form of an image we must be able to withdraw ourselves from the action of the moment, we must [ … ] have the will to dream. ”18 The characters in ‫פּגאנג‬ ַ ‫ ָא‬have nothing but the “ will to dream. ” Mayzel could have gained his familiarity with Bergson from Russian- and Yiddish-language sources. Bergson was broadly discussed in the Yiddish-speaking world. The Yiddish press in New York, Warsaw, and Vilnius carried translations of and commentaries on his work.19 Among them was ‫ ( די ייִ דישע וועלט‬The Jewish World ), a journal that Bergelson edited. Sh. Rudnyanski, whose article, ” ‫בערגסאן וועגן עסטעטיק‬ ָ „ ( “ Bergson on Aesthetics ” ), appeared in ‫ די ייִ דישע וועלט‬in 1913, emphasizes that, according to Bergson, the necessity of living, the round of activity that 14 Bergson 1988 : 202. 15 For a discussion emphasizing the epistemological signiĳicance of cinematic experimentation, see Michelson 1984. 16 Mayzel 1971 : 294. 17 Bergson 1971 : 31. 18 Bergson 1988 : 83. 19 See, for example, Bergson 1913 ; Gliksman 1924 ; Zhitlovski 1924. Harriet Murav : Making Time 157 makes up daily life, determines the images we form of the objects that surround us. We see, hear, and sense objects only in relation to the actions we are about to take : the virtualities to which I referred earlier arise because, as Bergson writes, “ my perception displays the eventual or possible action of my body. ” 20 At the same time, our anticipated response to the object is imbued with memory : “ with the immediate and present date of our sense, we mingle a thousand details of our past experience. ” 21 There is a time lag inherent in the very process of perception. We select those details of our past experience necessary and suitable for the act we are about to perform. In the completion of regular, habitual acts, memory condenses to a single point ; the motor response to the sensation takes place almost immediately, in one smooth motion. It is important to note that in his book on laughter, which was translated into Yiddish and to which Rudnyanski refers, Bergson observed that the comic effect is produced when the body loses the suppleness of its responses to the external world, thereby resembling a machine.22 In the normal course of events, the smooth and efĳicient discharge of action, however, results in an impoverished perception of the world around us, which is reduced to the absolute minimum of information necessary for the performance of the act. In this condition, Bergson writes, we do not see the things themselves, but rather conĳine ourselves to “ reading the labels attached to them. ” 23 Rudnyanski ’ s article reiterates this point in virtually identical language. The abstraction, generalization, and categorization necessary for daily-life activity lead to this impoverished response of merely “ reading labels, ” instead of experiencing objects in the surrounding world in the fullness of what they are independently of our need to use them.24 The seamless performance of routinized acts prevents us from forming representations of them. In Creative Evolution, Bergson writes, “ representation is stopped up by action. ” 25 When something thwarts the accomplishment of an act, however, “ consciousness may appear. ” He continues : “ the obstacle creates nothing positive ; it simply makes a void, removes a stopper. ” 26 The entirety of the past, which we trail behind ourselves, and which “ swells as it advances, ” but is cut off from us in the completion of the action, condensed to a single point, expands when the action is impeded, becoming available to us in the form of 20 21 22 23 24 25 26 Bergson 1988 : 22. Ibid. : 33. Bergson 1911 b : 29. Ibid. : 153. Rudnyanski 1913 : 83. Bergson 1911 a : 140. Ibid. : 144. 158 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ images. This multitude of recollections can now mingle with the impressions we form of the surrounding world, no longer merely the object of the limited, utilitarian view of it created by our need to act. The prolongation of a series of successive states into the present was what Bergson called “ duration. ” There is no discrete instant of now ; there is instead continuous flow, the bulging out of the past into now. Duration, the unpredictable infusion of the heterogeneous past into the present allows for something new to emerge. For Bergson, duration is what gives rise to “ creative evolution. ” What for Bergson constitutes the wellspring of potentiality – including inaction, dreaminess, sleep, and immobility – corresponds to the leitmotifs of Bergelson ’ s early ĳiction. ‫קזאל‬ ַ ‫ווא‬ ָ ‫ ַארום‬uses the image of the train, the symbol of mobility and modernity, to indicate utter stasis and immobility. The train station itself is asleep, as if under the spell of an evil magician. The brokers and go-betweens who are its denizens never board the train ; on the contrary, departure takes the form of downward mobility : the protagonist Beynish Rubinshteyn returns to his shtetl to take up the traditional Jewish profession of teaching Hebrew. Mirl Hurvits, the protagonist of The End of Everything, similarly fails to take advantage of the new economic opportunities of the time ; unlike other young women, she does not pursue an education, but agrees to an unwanted marriage to save her father from bankruptcy. The central theme of the novella is the cessation of action. Mirl spends her time trying to “ put an end ” to the marriage ; she terminates her pregnancy. To make everything “ null and void ” ( as in the Yiddish ‫ ) מטל ַזײן‬is the goal of all her undertakings.27 The hero of “ In a Backwoods Town ” is similarly removed from action ; he is aware that somewhere else “ there were great noisy cities. ” 28 Like Mirl Hurvits, Burman misses opportunities for mobility. In Irving Howe and Eliezer Greenberg ’ s translation, he is perpetually “ drowsy ” and has “ let his chance to ĳinish the university go by forever. ” 29 A more literal translation reveals the paradoxical time structure that Bergelson uses here : “ he was forever too late to ĳinish his university studies ” ( “ ‫ארשפּעטיקט דעם אוניווערסיטעט‬ ַ ‫האט אויף אייביק‬ ָ „) – as if being too late was a perpetual and repeated act.30 Most of Bergelson ’ s characters are always ( already ) too late. Living in the present means being left behind, trailing in the aftermath of something else, always missing the forward motion of progress. This 27 For example, Mirl wants to “ nullify ” her second engagement ; see Bergelson 1929 ( ii ) : 153. 28 Bergelson 1929 ( iii ) : 9. 29 Howe and Greenberg 1989 : 471. 30 Bergelson 1929 ( iii ) : 7. Harriet Murav : Making Time 159 state of belatedness corresponds to Bergson ’ s condition of heightened receptivity to the surrounding world. According to Bergson, to be able to call up the past in the form of an image, “ we must be able to withdraw ourselves from the action of the moment. ” Bergelson ’ s work explores the consequences of this withdrawal, both negative and positive. Missing the chair you are about to sit on can revive the body ’ s otherwise mechanized, habitual relation to the world ; missing a longedfor meeting can reflect time that is out of joint. Missing the scene of progress – whether in the form of Zionism, socialism, communism, or opportunities for economic mobility – can activate other, unrealized potentials hidden in the obsolete past. The failed meetings and unfulĳilled longings that typify the lives of Bergelson ’ s characters reveal the disjuncture of time itself. Durative time in ‫קזאל‬ ַ ‫ווא‬ ָ ‫ַארום‬ In a letter of 1910, Bergelson wrote that his method of creating stories began with the creation of the atmosphere : 31 ‫צום ָאנהייב ווערט געבוירן די שטימונג ון דער‬ ‫מאדנע‬ ָ ‫זא‬ ַ ‫ [ ַא‬. . . ] .‫דערציילונג מיטן הויפּטטיפּ‬ ‫בענקשאט ווערט מיט ָאט דער שטימונג‬ ַ ‫לאריט ון‬ ָ ‫קא‬ ָ ‫אייגנארטיקן‬ ַ ‫געבוירן צו יענעם‬ ‫טראגט זיך ַארום דעם‬ ָ ‫ וועלכע‬,‫דער וועלט‬ ‫גאנצער‬ ַ ‫מײן‬ ַ .‫הויפּטטיפּ און אין דער שטימונג‬ ‫נאר אויף ַארויסצוגעבן‬ ָ ‫נאך דעם‬ ָ ‫ציל איז שוין‬ ‫צוזאמענגעבונדן מיטן לעבן און‬ ַ ‫ָאט די שטימונג‬ ‫אר ַארום‬ ָ ‫ וועלכע קומען‬,‫מיט די געשעענישן‬ ‫זאגן ( אין‬ ָ ‫אים און ) אויב ס ׳ איז ַאזוי מעגלעך צו‬ .‫אים‬ First to be born is the atmosphere of the story, together with its main character. [ … ] Together with this atmosphere, such a strange longing comes into being for every nuance peculiar to the world transmitted by the chief character and by this atmosphere. Thereafter, my entire aim is to give expression to this atmosphere, together with the life and the occurrences that take place around and ( and if it is possible to say this ) within it. Bergelson ’ s description of his own creative process suggests parallels with Bergson. The term ‫שטימונג‬, translated here as “ atmosphere, ” is also synonymous with “ melody ” ( ‫מעלאדיע‬ ָ ).32 The “ atmosphere ” or “ melody ” of the work differentiates itself into the ĳictitious personae and events of the story. According to Bergson, the real is pure continuity, our perception of clean-cut objects and states is the product of our need to move and react. Perception cuts out of the real that which is necessary for hu31 Letter to Shmuel Niger, 8 July 1910, cited by Mantovan 2007 : 89 f. 32 Stuchkoff 1991 : 252. 160 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ man activity ; we artiĳicially decompose the world for the convenience of our intelligence. Evolution, according to Bergson, is a movement akin to the motion of an individual ’ s arm and hand through iron ĳilings ; wherever the hand stops, the ĳilings will ĳill in the negative spaces it leaves behind, which correspond to the forms of life that evolution creates. But the whole is the movement of the hand and not its stopping places.33 The real is pure continuity and not the clean-cut states cut out of the real by our perception and our knowledge. The analogy that Bergson turns to again and again to describe this continuity is music : duration is the interpenetration of one quality by another, as in the example of one note in a musical composition “ leaning over ” into the next one.34 Bergson ’ s duration can provide a gloss on Bergelson ’ s creative method, and in its concrete realization such works as ‫קזאל‬ ַ ‫ווא‬ ָ ‫ ַארום‬. More like a musical composition than anything Bergelson subsequently wrote, ‫קזאל‬ ַ ‫ווא‬ ָ ‫ ַארום‬transposes a single theme into multiple registers. The wind, the moon, the darkness of night, the world of nature, the buildings and objects created by human beings, and the thoughts, imaginings, and memories of the protagonists – all sound the same melody of unfulĳilled longing ( ‫בענקשאט‬ ַ ) and sorrow ( ‫) טרויער‬.35 In the opening of the work, for example, the train station seeks, but does not ĳind renewal from the distance itself ( ‫ווײטקייט‬ ַ ‫) די‬. The “ dead ” and “ frozen ” ( ‫ארגליווערטער‬ ַ ) station looks with longing into the depth of the distance that surrounds it, as if from the distance itself would arise a “ helper ” who would return everything to life, but there is no help forthcoming.36 The twilight, the wind, the hammering of the blacksmith, the sound of train as it passes the station, and the leaves that fall from the trees all tell the story of something that has ended, passed, and cannot return. The phrase “ ‫ געענדיקט‬,‫ “ ( „ געענדיקט‬it is done, done ” ) suggests the rhythmic echo of a passing train.37 Beynish, the main character, does not live in the present, but rather remembers the past and imagines possible futures. He pictures visiting his wife, a sickly woman with a greenish face ; this anticipation of what would happen intermingles with other pictures, his imagined future with another man ’ s wife, which is intermingled with the memory of his childhood, and the kindly way the rabbi used to look at him when he was a boy in school. The atmosphere of ‫קזאל‬ ַ ‫ווא‬ ָ ‫ ַארום‬, which conveys the end of something and the expectation of something else, may re33 34 35 36 37 Bergson and Mitchell 1911a : 94 f. See, for example, Bergson 1965 : 147. Bergelson 1929 ( i ) : 81. Ibid. : 7. Ibid. : 13. Harriet Murav : Making Time 161 flect the disappointment after the failed Russian revolution of 1905, as Nakhmen Mayzel argues, but it also reveals a new form of art that overcomes the separation between thought, feeling, and the surrounding world of other people and objects, and in so doing creates what Bergson would call a moment of “ duration. ” The mutual interpenetration of human being and thing in Bergelson is distinct from the more traditional poetic device of personiĳication. Personiĳication works to enchant the world ; interpenetration rejects the easy dividend of enhanced meaning that results. The action of the narrative – to the extent that there is action – is born of the immobility with which the narrative begins and ends ( the “ frozen ” and “ dead ” station looking into the distance ). The term “ frozen ” ( ‫ארגליווערט‬ ַ ), one of Bergelson ’ s favorite and repeated words, can also be translated as “ congealed, ” suggesting the cessation of movement, a kind of temporary immobility, not necessarily born of stagnation or a moribund state, but rather the fleeting cessation of movement into the discreet images necessary for language. To the greatest extent possible in prose ĳiction, Bergelson “ unmakes ” the cut, or separation, of people, things, and nature, making it difĳicult to tell who is speaking or feeling a particular emotion, but also making it poetic and musical. It is no wonder that Bergelson ’ s ĳirst critic, A. Vayter, writing in 1909, described the “ unexpected joy ” that ‫קזאל‬ ַ ‫ווא‬ ָ ‫ ַארום‬created in him.38 Slow motion The atmosphere of suspended animation that permeates ‫קזאל‬ ַ ‫ווא‬ ָ ‫ ַארום‬is also central to ‫שטאט‬ ָ ‫ארגרעבטער‬ ַ ‫ אין ַא‬. First published in 1914 in ‫די ייִ דישע‬ ‫וועלט‬, the same journal in which Rudnyanski ’ s article on Bergson had appeared a year earlier, the story describes the corruption, kickbacks, adultery, and violence of “ a backwoods town. ” Its leitmotif is : ‫„ די וועלט‬ ” ‫בלאטע‬ ָ ‫ “ ( איז‬the world stinks ). ” 39 Elishe has brought his new wife from Medzhibozh, and everyone has come to have a look : 40 ‫קאפּ העכער ון‬ ָ ‫גאנצן‬ ַ ‫זי איז געווען מיט ַא‬ ‫שמאלן‬ ָ ‫שווארצן‬ ַ ‫האט אין‬ ָ ‫ [ און ַאז זי‬. . . ] ‫אלישען‬ ‫שפּאן צו‬ ַ ‫קליידל ָאנגעשטעלט ַא וס אויף ַא‬ ‫ראפּ־‬ ָ ‫האבן זיך צו אים נישט ־ ווילנדיק ַא‬ ָ ,‫טאן‬ ָ ‫גלײך‬ ַ ;‫מאנסבילשע אויגן‬ ַ ‫געלאזן ַאלע ַארומיקע‬ ָ She was a whole head taller than Elishe [ … ] and when, clad in her tight black dress lifted her foot to take a step, all of the surrounding male eyes unwillingly focused on it ; as if in this slender foot 38 Vayter 1971 : 293. 39 Bergelson 1929 ( iii ) : 59. 40 Ibid. : 14. All translations in this article are by the author, unless otherwise noted. 162 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ‫שלאנקן וס ליגט עפּעס‬ ַ ‫אין ָאט דעם היפּשן און‬ ‫כּדאי‬ ַ ‫ און ס ׳ איז‬,‫גאנצער מעזשביזשער קונץ‬ ַ ‫ַא‬ ‫ארקומען מיט אים און מיט‬ ָ ‫וואס וועט‬ ָ ‫צו זען‬ ‫ בשעת זי וועט‬,‫גאנצער וווּקסיקער יגור‬ ַ ‫איר‬ ‫טאן און וועט אים‬ ָ ‫מאל ַא הייב‬ ָ ‫נאך ַא‬ ָ ‫דעם וס‬ .‫ראפּשטעלן‬ ָ ‫מאל אויף דער ערד ַא‬ ָ ‫נאך ַא‬ ָ lay some particular Medzhibozh art, and it was worthwhile seeing what would happen to it, and to her entire tall ĳigure, when she would once again lift it and again place it on the ground. This is one of many instances of delayed action in Bergelson in which it takes longer to describe an action than for the action to take place. Time is not divisible into objective, measurable units in this instance. Time slows down and nearly stops altogether. What dilates time in this scene from ‫שטאט‬ ָ ‫ארגרעבטער‬ ַ ‫ אין ַא‬is male desire. It is the male eyes that ĳixate on and ĳix the pointing, lifting, and placing of the woman ’ s leg and foot. The longer the delay, the more pleasurable is their experience. The men ’ s eyes keep the foot in the air, the intensity of their lust freezing the action, as if in the cinematic freeze-frame that Vertov experimented with in Man with a Movie Camera. Bergelson returns to the motif of the eroticized foot in a subsequent scene in which Elishe ’ s wife and her lover, Burman, play “ footsies ” ( ‫גאנץ ערנסטער שמועס אויף‬ ַ ‫ַא‬ ‫) יס ־ לשון‬.41 Burman walks past Elishe ’ s house and notices that the curtains have already been hung : 42 ‫ ַאן אונטערגע־‬,‫ון הינטער איינעם ון זיי‬ ‫רווארענעם ַא ביסל‬ ָ ‫א‬ ַ ‫הויבענעם און ַא‬ ‫האבן זיך געהערט די קלעפּ ון ַא‬ ָ ,‫זײט‬ ַ ‫ָאן ַא‬ ‫געמאלט‬ ָ ‫האט זיך‬ ָ ‫האנט ־ העמערל ; ס ׳‬ ַ ‫קליינעם‬ ‫ די‬,‫ אין חדר‬,‫וואס אינווייניק‬ ָ ,‫די קילקייט‬ ‫וואס אין די ריש ָאנגעצויגענע‬ ָ ,‫הויכע שטולן‬ ‫ זי איז‬.‫ווײב ַאליין‬ ַ ‫ אלישעס‬,‫ און זי‬,‫טשעכאלן‬ ָ ‫ וועלכע‬,‫געשטאנען לעבן דינסטמיידל‬ ַ ‫דארטן‬ ָ ‫רויגעקראכן אויף ַא קליין צוגעשטעלט‬ ָ ‫איז ַא‬ ‫באוויזן ׃‬ ַ ‫האט איר‬ ָ ‫ און‬,‫טישל‬ ,‫ ַא ביסל העכער‬,‫זײט מוחל‬ ַ ,‫שלאגט אים‬ ָ „ .“ ‫נאך העכער‬ ָ . . .‫טשוואק‬ ָ ‫דעם‬ From behind one of them, which had been raised and thrown back a bit toward the side, the hammering of a small hammer could be heard ; the chill inside the room could be pictured, and the tall chairs, in their newly made covers, and she herself, Elishe ’ s wife. She was standing there near the maid, who had climbed up a table that had been placed there, and ordered her : Please put the nail in a little higher … higher. The delay and deferral of desire create this scene, just as in the earlier scene with the foot. Burman wants Elishe ’ s wife, Fradotshke, and his desire transfers back and forth across the metonymic chain, from the sound of the hammer, to the nail, the hammer itself, the maid ham41 Ibid. : 30. 42 Ibid. : 15. Harriet Murav : Making Time 163 mering, the table, the chairs, and, as the text emphasizes, “ she herself, Elishe ’ s wife. ” All that Burman actually sees are the newly hung curtains. He imagines everything else, including the maid, the table, the nail, the hammer, Fradotshke ’ s voice, and Fradotshke herself. Note the use of the passive in the phrases ‫האבן זיך געהערט די קלעפּ ון ַא קליינעם‬ ָ „ “ ‫ אין חדר‬,‫וואס אינווייניק‬ ָ ,‫געמאלט די קילקייט‬ ָ ‫האט זיך‬ ָ ‫ „ ס ׳‬,“ ‫האנט ־ העמערל‬ ַ ( “ the hammering of a small hammer could be heard, ” “ the chill inside the room could be pictured ” ). The passive obscures the agent of the action ; who is hammering and who is picturing the interior of the house remain blurred. The scene corresponds to what Bergson in Matter and Memory describes as the dream state, the state of pure imagination devoid of action. Since perception, according to Bergson, is geared to the action we are about to perform, our memory selects recollections that are pertinent to that particular action, similar to it. But when consciousness is detached from action, “ a multitude of events contiguous to the memory are thereby fastened onto the perception [ … ] anything can be associated with anything. ” 43 In the episode from ‫שטאט‬ ָ ‫ארגרעבטער‬ ַ ‫אין ַא‬, Bergelson sets in motion the association of the hammer ’ s sound with the hammer, the maid holding it, the table supporting the maid, and the woman standing next to the table instructing the maid to hammer the nail “ a little higher. ” Burman ’ s imagination of the interior of the room is signiĳicant in light of Bergson ’ s linkage of sensation and spatiality. In Creative Evolution, he describes what happens when action stops : “ Suppose we let ourselves go and instead of acting dream [ … ] our past is broken up into a thousand recollections made external to one another [ … ] Our personality thus descends in the direction of space. It coasts around it continually in sensation. ” 44 It is precisely Burman ’ s awakened desire that carries him afloat in the inside of Fradotshke ’ s house ; it is from Burman ’ s perspective that ‫וואס‬ ָ ,‫געמאלט די קילקייט‬ ָ ‫האט זיך‬ ָ ‫„ס׳‬ “ ‫ אין חדר‬,‫ ; אינווייניק‬Burman ’ s sensation is extended into a set of objects in a space – the scene of chairs, table, maid, hammer, all arranged and set in motion by the object of his passion, “ ‫ווײב ַאליין‬ ַ ‫ אלישעס‬,‫ “ ( „ זי‬she, Elishe ’ s wife herself ” ). This scene, although different in tone from the mood of ‫קזאל‬ ַ ‫ווא‬ ָ ‫ ַארום‬, nonetheless reveals certain parallels to it. It is another example of the diffusion of a single emotion into a series of things, thereby conforming to Bergelson ’ s description of his creative method, which begins from the atmosphere and moves to the characters of the story. 43 Bergson 1988 : 167 f. 44 Bergson 1911a : 201. 164 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ The beautiful miniature is set against the backdrop of the vile backwoods town, mired in its feudal economy and deadly rivalries. The tax on kosher meat and the system of kickbacks that enforce it lead to Elishe ’ s brutal beating and death by the town ’ s butchers. The adulterer Burman wastes time and lags behind everyone else ; however, in the image of perpetual delay that Bergelson creates with the character Burman, the author reveals the possibility for creative duration, in Bergson ’ s sense of the term. Bergelson ’ s innovative narrative artistry, no less than Vertov ’ s “ kino-eye, ” makes the “ acted unacted, ” and uncontracts motion into the metonymic chain. In so doing, he makes time palpable ; he reveals the inner workings of now. The search for time past in ‫פּגאנג‬ ַ ‫ָא‬ In ‫פּגאנג‬ ַ ‫ ָא‬, Bergelson does not use an omniscient narrator and does not string together plot episodes along a single linear line. The novella opens with Meylekh ’ s funeral and works back toward the past in an attempted reconstruction of what happened to him. There is no one single past external to the multitudes of individuals who lived it ; hence, there is no single account of Meylekh, who was many things to many people : lover to Etl Kadis, Khave Poyzner, Khanke Lyuber, son to his disappointed mother, would-be son to Yitskhok-Ber, friend and alterego to Khayim-Moyshe. The intensive focus on the past in ‫פּגאנג‬ ַ ‫ ָא‬resonates with Bergson ’ s major point about the survival of the past in the present, his argument in Matter and Memory. Our entire interaction with the world is the insertion of our past ( which is a heterogeneous, ever-changing process ) into our present. Time as already ĳilled, the orientation of “ now ” as “ after ” – a key feature of Bergelson ’ s entire oeuvre – corresponds to Bergson ’ s idea of duration, “ the continuous progress of the past which gnaws into the future and swells as it advances. ” 45 Bergelson carries out artistically what Bergson proposes abstractly : we exist in a stream of ongoing impressions mingled with our memories, in which every moment “ durates, ” or bulges out from “ now ” into the past and future. For Bergson, the image of well-organized, purposeful human action is a falsehood concealing a fluid inner heterogeneity, a “ heap of co-existing psychic states. ” 46 In ‫פּגאנג‬ ַ ‫ ָא‬, there is no one central character who 45 Ibid. : 4. 46 Bergson 1971 : 10. Harriet Murav : Making Time 165 focalizes and organizes the action, description, and emotion ; instead, we move from center to center to center, from the absent Meylekh to his unnamed sister, to Yitskhok-Ber, Khayim-Moyshe, Khanke Lyuber, Khave Poyzner, Preger, Zaynvl, and Zalker, the Singer sewing machine agent – this is not the full list. Each commands his or her narrative focus, and these distinct and overlapping points coalesce into the entirety of the narrative of ‫פּגאנג‬ ַ ‫ ָא‬. Reading Bergelson is like looking through a kaleidoscope of constantly changing narrative elements. In Matter and Memory, Bergson describes the human body moving through space in similar terms. My body, an image among other images, is for me the center conditioning all other images ; “ at each of its movements everything changes, as if by a turn of the kaleidoscope. ” 47 This line of analysis, however, which emphasizes dreaminess and subjectivity, merely reiterates and draws out what Mayzel and other critics hinted at. I turn now to another set of features characteristic of Bergelson ’ s style that have received less attention. This set includes deliberate ugliness, the “ ‫ ( „ גליטש‬Bergelson ’ s term ), the mistake, or misĳire in the performance of an action, an interest in disability and what could be called de-evolution, the moments in the text lacking in flow and continuity, a reorganization of the body into the instruments it uses ( the extension of the body into tools ), de-textualization ( words functioning as sounds ), and, ĳinally, the staging of musical performances in the text and Bergelson ’ s own textual musicality. These features, far from representing metonymically the death of a life-world, produce an opening for new forms of being in the world and for creating art. Both Bergson and Bergelson are interested in returning to life, to the body, to physicality – in an effort to overcome the separation between the self and the world. In the opening of ‫פּגאנג‬ ַ ‫ ָא‬, Meylekh ’ s sister has a problem seating herself in the carriage : 48 ,‫קאדיס — די קורסיסטין‬ ַ ‫געוואלט העלן חנקע ליובער און עטל‬ ָ ‫האבן‬ ָ ‫ַאז איר‬ ‫האט זי זיך ון זייער הילף‬ ָ — ‫אר מלך‬ ַ ‫געזאלט ַא כּלה ווערן‬ ָ ‫האט אין גיכן‬ ָ ‫וואס‬ ָ ‫ נישט קיין זיכערע תּנועות און זיך‬,‫ארעקשנטע‬ ַ ‫פּאר‬ ָ ‫געמאכט ַא‬ ַ ‫פּגעזאגט ׃‬ ָ ‫ָא‬ ‫וואס זעצט‬ ָ ,‫ ווי איינער‬,‫רײן מיטן בויך‬ ַ ‫נגעווארן אין בריטשקע ַא‬ ָ ‫רײ‬ ַ ‫סוף ־ כּל ־ סוף ַא‬ ‫ווארטן אויף איר‬ ַ ‫נאר בשעת די מיידלעך זענען געבליבן‬ ָ .‫רײטן אויף ַא ערד‬ ַ ‫זיך‬ .‫האנט‬ ַ ‫האט זיך פּלוצעם ַארויסגעגליטשט דער שירעם ון איר‬ ָ ,‫ווארט‬ ָ ‫לעצטן‬ ‫רײן דעם‬ ַ ‫מאל געגעבן ַא צי ַא‬ ָ ‫האט זי מיט ַא‬ ָ ,‫ אוין ָאנגענעצטן קישעלע‬,‫אויבן ָאן‬ ‫האט גענומען אויס־‬ ָ ‫ ַאזוי ַאז די בורקע‬,‫רײנגעהויקערט‬ ַ ‫ זיך ַא‬,‫קאפּ אין די ַאקסלען‬ ָ ‫אויסגעשאסן מיט ַא משונה‬ ָ ‫האט‬ ָ ‫ און זי‬,‫שמאטעס‬ ַ ‫זען ווי ָאנגעילט מיט ַא בינטל‬ ‫ייִ אושדיקן קוויטש ׃‬ ”. . . ! ‫ מלך‬. . . ! ‫ מלך‬,‫„אוי‬ 47 Bergson 1988 : 24. 48 Bergelson 1999 : 7. 166 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Joseph Sherman translates this as follows : 49 When she was offered assistance by Hanke Lyber and by Ethel Kadis, the university student who should soon have been married to Meylekh, she refused their help, made a few stubborn, uncertain movements, and ĳinally threw herself forward into the britzka like someone mounting a horse. While the other young women waited for her last word, the umbrella suddenly slipped from her grasp. Up above, on the sodden driver ’ s seat, she abruptly jerked her head into her shoulders, hunched herself up so that the felt coat took on the appearance of being stuffed with a bundle of rags, and emitted a wildly despairing shriek : “ Oh, Meylekh ! … Meylekh ! … ” I note in passing that the translation omits the ugly detail that Meylekh ’ s sister throws herself into the carriage “ ‫ “ ( „ מיטן בויך‬belly ĳirst ” ). There are at least two other occasions when a character miscalculates how to carry out a physical act. Khayim-Moyshe turns back to have a look at Khanke Poyzner and makes a strange movement, “ as if he had forgotten to bring something with him ” ; the movement is abrupt and is cut off midstream ( “ ‫באוועגונג‬ ַ ‫) „ ַאן ָאפּגעריסענע און געשווינדע‬.50 Later, when Khayim-Moyshe visits Khanke Lyuber for the ĳirst time, he sits ‫„ אין ַא ַזא‬ ‫ראפּ ונעם‬ ָ ‫מאל ַא גליטש ַא‬ ָ ‫גלײך ָאט ־ ָאט ־ ָאט טוט ער זיך מיט ַא‬ ַ ,‫פּאזע‬ ָ ‫משונהדיקער‬ “.‫וואס אונטערן טיש‬ ָ ,‫קאברעץ‬ ָ ‫גלאטן‬ ַ ‫סאמעט‬ ַ ‫בלײבט זיצן מיט ַאלע יר אוין‬ ַ ‫בענקל און‬ ( in “ such a strange posture as if he were about to suddenly and by mistake fall off the bench to end up on all fours on the smooth velvet carpet under the table ” ).51 What is surprising about episodes such as these is their ugliness and dehumanization, which serve a comedic effect. Meylekh ’ s sister scrunched up in her felt coat looks like a bundle of rags, and the otherwise sophisticated Khayim-Moyshe suddenly and inexplicably does not know how to sit in a chair properly. In his study of laughter, Bergson describes these mistakes as the product of habit : repeated action prevents us from seeing what is right in front of us. Hilary Fink argues that this characterization of the dulling effect of repetition found its way into Viktor Shklovsky ’ s well-known formulation that the purpose of art is to “ lead to a knowledge of a thing through the organ of sight instead of recognition. ” 52 Bergson and Shklovsky shed light on Bergelson ’ s characteristic technique. 49 50 51 52 Bergelson and Sherman 1999 : 7 f. Bergelson 1999 : 28. Ibid. : 53. Fink 1999 ; Shklovsky 1990 : 6. Harriet Murav : Making Time 167 In the episode of Meylekh ’ s sister and the uncooperative carriage and umbrella, as well as in the scene when Khayim-Moyshe almost slides from his seat, Bergelson ’ s narrative technique heightens the vividness of the physical gesture for the reader. It is tempting to say the viewer, because the image Bergelson creates is so cinematic. In other works, the dissection of physical motion in order to reveal its inner workings serves a similar purpose. Bergelson ’ s emphasis on delayed, discontinuous, and disaggregated movement resonates with the embodiment characteristic of early cinema, and the experimental photography of Étienne-Jules Marey and Eadweard Muybridge, which similarly analyzed motion into its component parts.53 It is as if the ĳilm had been slowed down, and instead of seeing the action as we normally would, without interruption, the action is jerky and abrupt ; both passages use “ ‫מאל‬ ָ ‫ „ מיט ַא‬and “ ‫ ( „ פּלוצעם‬both mean “ suddenly ” ). There is nothing to motivate the abrupt motions that Meylekh ’ s sister and her umbrella make ; the use of “ suddenly ” serves only to impede the action. The act of seating oneself in a carriage is broken down into three distinct motions, with no connection between them : the belly forward, followed by a pause, created by the young women “ waiting to hear ” Meylekh ’ s sister ’ s “ last word, ” then the umbrella slipping from her hand, and then the ĳinal motion of hunching the head into the shoulders, which takes place in a seemingly different location, above, on the driver ’ s seat. A separate body part performs each motion : belly, hand, head, and shoulders. The forward motion of Meylekh ’ s sister ’ s departure cannot take place in the way it normally would. The breakdown of the action into its constituent parts, and other means of retarding the action – including the parenthetical description of Etl Kadis as Meylekh ’ s bride-to-be – serve another, related, purpose. My hunch is that it takes longer to read the passage than to perform the action it describes of seating oneself in a britzka ; the particular structure of the narrative itself slows down time. Bergelson retards the forward motion of the action. What Bergelson depicts and the technique he uses to depict it reinforce each other. The cause of the sensory-motor breakdown on the psychological level is, presumably, the sister ’ s overwhelming grief, although Bergelson does not make this explicit. The temporary disability extends the present moment beyond its normal boundaries. In this and in countless other instances in the novella, the past – Meylekh ’ s death – enters the present. According to Bergson, we are all always stopping time : the universe comes at us in sheet after sheet of onrushing events ; we each, 53 For a discussion, see Auerbach 2007 : 10 f. 168 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ in innumerable ways, slow down this onrush by mingling our multiple pasts with the present. To be able to call up the past in the form of an image, Bergson writes, in a passage I have already quoted, “ we must be able to withdraw ourselves from the action of the moment ” – a capability that Bergelson has created in the entirety of ‫פּגאנג‬ ַ ‫ ָא‬in general, and in the carriage scene in particular. Bergelson is working artistically on concepts that Bergson developed philosophically. The motions that Meylekh ’ s sister performs, thrusting herself forward, belly ĳirst, and hunching her head down into her shoulders – suggest a kind of limbless form of locomotion, something far more primitive than we would expect from upright homo sapiens. Bergelson uses the phrase “ ‫ “ ( „ תּוהו ־ ווהו‬without form and void ” ) elsewhere in the work, suggesting primordial chaos.54 In Matter and Memory, Bergson describes learning how to perform a physical exercise as requiring a necessary analysis of its component parts, because the movement is “ compound and made up of a multitude of muscular contractions and tensions. ” 55 The initial attempt to imitate the movement is “ already its virtual decomposition, it bears without itself, so to speak, its own analysis. ” As learners gain facility with the movement to be executed, they are increasingly able both to preserve each separate part and to physically link one part of the motion with the next. The body understands and performs this interpenetration of one act with another. In the britzka scene in ‫פּגאנג‬ ַ ‫ ָא‬, the action, on the contrary, is shown in its decomposition, having been unlearned. We see the component parts, but their mutual relation is impeded. The passage leaves the reader no choice but to visualize gesture and motion ; the “ last word ” that we and the two young women, Khanke Lyuber and Etl Kadis, expect to hear never comes. Instead, the bereaved sister “ lets loose with a squeal, ‘ Oy, Meylekh ! ’ ” I suggest this alternative, less elegant translation for the purpose of showing the motif of devolution in the scene. The sound that the sister emits cannot be described as a deliberate, articulate utterance. There are other passages like this one in ‫נאך ַאלעמען‬ ָ , ‫פּגאנג‬ ַ ‫ ָא‬, and ‫דער‬ ‫טויבער‬. Indeed, ‫ דער טויבער‬as a whole proceeds from the perspective of a deaf-mute, whose impeded hearing and speech estrange language and narration, shifting the narrative focus away from meaning and thought toward gesture and sound. The deliberate primitivization of action and utterance in this passage and others like it, what might be called “ creative de-evolution, ” reveals the separation of the body from the world. 54 Bergelson 1999 : 17. 55 Bergson 1988 : 111. Harriet Murav : Making Time 169 Bergelson ’ s play with sound in this and other works serves to heighten the acoustic effects of language, forming a kind of rhythmic undergirding distinct from the meaning of the text. Sound-play serves to heighten the connection between one part of a text and another ; it impedes the forward extension of a narrative, instead introducing qualitative modulations of a single theme. Bergelson ’ s text is musical, as I argued earlier with regard to ‫קזאל‬ ַ ‫ווא‬ ָ ‫ ַארום‬. Musical performance is also part of the story. In ‫פּגאנג‬ ַ ‫ ָא‬, the accordion-player ĳills the room with sounds that “ somersault after one another, like joyous mocking clown acrobats ” ( “ ‫מעדיאנטלעך‬ ַ ‫קא‬ ָ ‫ ווי די קליינע ריילעך שפּעטנדיקע‬,‫) „ קוליען זיך‬.56 The narrator refers to the musician by using the term “ der gilgul, ” which Joseph Sherman translates as the “ transmigratory soul. ” 57 The term can also be read as a gloss on Bergelson ’ s own narrative technique, which transforms one quality into another, as in the example of musical notes metamorphosing into acrobats. This and other, similar moments of transformation help to make the argument that Bergelson ’ s aesthetic, at least before World War II, was not based on a poetics of despair, or twilight, as is so often claimed. The very features that make his writing so difĳicult, as if we had lost our ability to see the world, serve precisely the opposite purpose, as a way back into the world, which requires detextualization along the way. Bergelson is not simply rejecting Sholem Aleichem ’ s verbosity ( ‫בארעדעוודיקייט‬ ַ ), but rather he is experimenting, together with his contemporaries in Russian and other languages, with verbality itself. By returning to Bergson, Bergelson ’ s contemporary, we gain access to what was new, creative, and joyful in Bergelson ’ s writing before the catastrophes of the twentieth century, before, in other, more Bergsonian words, the insertion of the past into the present radically changed. Instead of seeing the past dominating the present through the lens of trauma, Bergson ’ s theories permit an alternative optics important for understanding Bergelson ’ s early work : the interpenetration of the past and the present in a creative light, as the continual opening up of something new by means of art itself. 56 Bergelson 1999 : 174. 57 Bergelson and Sherman 1999 : 177. 170 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Bibliography Auerbach, Jonathan, 2007 : Body Shots : Early Cinema ’ s Incarnations. Berkeley : University of California Press. Bergelson, Dovid, 1929 : Geklibene verk, 8 vols. Vilna : Vilner farlag fun B. Kletskin. – 1977 : When All Is Said and Done. Trans. Bernard Martin. Athens, oh : Ohio University Press. – 1999 : Opgang ( Texts and Translations, 7 ). New York : Modern Language Association of America. Bergelson, Dovid and Sherman, Joseph, 1999 : Descent ( Texts and Translations, 7 ). New York : Modern Language Association of America. – 2010 : The End of Everything ( New Yiddish Library ). New Haven : Yale University Press. Bergson, Henri, 1911 a : Creative Evolution. Trans. Arthur Mitchell. New York : H. Holt and Company. – 1911 b : Laughter : An Essay on the Meaning of the Comic. New York : Macmillan Company. – 1913 : “ Dos geheymnis fun shafn. ” In : Di literarishe velt 1 ( 12 ) : 3 – 4. – 1923 : Araynĳir in der metaĳizik. Trans. William Nathanson. Warsaw : n. p. – 1928 : Der gelekhter, an ophandlung vegn der badaytung fun komizm ( Populer-visnshaftlekhe biblyotek ). Trans. Y. Rapoport. Warsaw – New York : Y. Yatshkovski. – 1965 : An Introduction to Metaphysics : The Creative Mind. Trans. Mabelle L. Andison. Totowa, nj : Littleĳield, Adams, and Company. – 1971 : Time and Free Will : An Essay on the Immediate Data of Consciousness ( Muirhead Library of Philosophy ). Trans. F. L. Pogson. London and New York : G. Allen & Unwin and Humanities Press. – 1988 : Matter and Memory. Trans. Nancy Margaret Paul and W. Scott Palmer. New York : Zone Books. Curtis, James, 1976 : “ Bergson and Russian Formalism. ” In : Comparative Literature 28 ( 2 ) : 109 – 121. Fink, Hilary L., 1999 : Bergson and Russian Modernism, 1900 – 1930 ( Studies in Russian Literature and Theory ). Evanston, il : Northwestern University Press. Gliksman, Avraham, 1924 : “ V. Natanson, Shpinoza un Bergson. ” In : Bikhervelt 3 ( 1 – 2 ) : 38 – 40. Greenberg, Clement, 1961 : Art and Culture : Critical Essays. Boston : Beacon Press. Gumbrecht, Hans Ulrich, 1997 : In 1926 : Living at the Edge of Time. Cambridge, ma : Harvard University Press. Harriet Murav : Making Time 171 Howe, Irving and Greenberg, Eliezer, eds., 1989 : A Treasury of Yiddish Stories. New York : Penguin Books. Mandelshtam, Osip, 1979 : The Complete Critical Prose and Letters. Trans. Jane Gary Harris and Constance Link. Ann Arbor, mi : Ardis. Mantovan, Daniela, 2007 : “ Language and Style in Nokh alemen ( 1913 ) : Bergelson ’ s Debt to Flaubert. ” In : Joseph Sherman and Gennady Estraikh, eds., David Bergelson : From Modernism to Socialist Realism. Oxford : Legenda. Mayzel, Nakhmen, 1971 : “ Dovid Bergelson – fun ‘ Vokzal ’ biz ‘ Opgang.’” In : Shmuel Rozhanski, ed., Dovid Bergelson : Oysgeklibene shriftn. Buenos Aires : Ateneo literario en el iwo. Michelson, Annette, 1984 : “ Introduction. ” In : Annette Michelson, ed., Kino-Eye : The Writings of Dziga Vertov. Berkeley : University of California Press. Miron, Dan, 2010 : From Continuity to Contiguity : Toward a New Jewish Literary Thinking. Stanford : Stanford University Press. Nethercott, Frances, 1995 : Une rencontre philosophique : Bergson en Russie, 1907 – 1917 ( La philosophie en commun ). Paris : L ’ Harmattan. – 2008 : Filosofskaia vstrecha : Bergson v Rossii ( 1907 – 1917 ). Moscow : Modest Kolerov. Rudnyanski, Sh. [ Stefan ], 1913 : “ Henri Bergson vegn estetik. ” In : Di yidishe velt 8 : 82 – 86. Sherman, Joseph, 2007 : “ David Bergelson ( 1884 – 1952 ) : A Biography. ” In : Joseph Sherman and Gennady Estraikh, eds., David Bergelson : From Modernism to Socialist Realism. Oxford : Legenda. Shklovsky, Viktor, 1990 : Theory of Prose. Trans. Benjamin Sher. Normal : Dalkey Archive Press. Stuchkoff, Nahum, 1991 : Der oytser fun der yidisher shprakh. New York : yivo Institute for Jewish Research. Vayter, A., 1971 : “ Dovid Bergelsons ‘ Arum vokzal.’” In : Shmuel Rozhanski, ed., Oysgeklibene shriftn. Buenos Aires : Literatur-gezelshaft baym yivo in Argentine. Vertov, Dziga, 1984 : Kino-Eye : The Writings of Dziga Vertov. Ed. Annette Michelson. Berkeley : University of California Press. Zhitlovski, Khaim, 1924 : “ Anri Bergson : Araynĳir in der metaĳizik. ” In : Bikher-velt 3 ( 1 – 2 ) : 14 – 17. Ken Frieden Yiddish in Abramovitsh ’ s Literary Revival of Hebrew It is impossible to justify the wide-ranging disregard for the role of Yiddish in the creation of secular Hebrew literature during the nineteenth century. Only ideological bias can account for the failure to acknowledge the centrality of Yiddish in “ the invention of modern Hebrew prose. ” 1 By examining S. Y. Abramovitsh ’ s Hebrew translations of his Yiddish ĳiction, this article illustrates how the spoken language directly influenced modern Hebrew style. Based on the implicit presence of Yiddish in Hebrew writing, one may say that “ Yiddish, like a dybbuk, haunted the evolution of modern Hebrew. ” 2 In his seminal study The Invention of Hebrew Prose, Robert Alter retraces the rise of a new Hebrew style and points out that “ this literary revolution was brought about by writers whose native language was Yiddish. ” 3 He goes on to write that Abramovitsh “ sought, against all historical logic, to make Hebrew sound as though it were the living language of the Jews about whom he wrote. ” Moreover, Abramovitsh “ worked to give it the suppleness, the colloquial vigor, and the nuanced referential precision of the Yiddish he had fashioned during his years of growth to artistic maturity. ” 4 Yet like most other critics of Hebrew literature, Alter minimizes the direct influence of Yiddish on Hebrew writing in the twentieth century, instead emphasizing Abramovitsh ’ s use of post-biblical Hebrew.5 According to a century-old premise, Abramovitsh began a new era in Hebrew writing when he developed his so-called ‫נוסח‬. Most scholars agree that his earliest Hebrew writing ( 1857 – 1862 ) was stiff, influThis article is revised and expanded from a paper given at the conference on “ The Place and Displacement of Yiddish ” at the Frankel Institute, University of Michigan, Ann Arbor, in April 2007. For their helpful comments, the author thanks Benjamin Harshav, Anita Norich, Shachar Pinsker, Seth Wolitz, and several other scholars who participated in this event. 1 Alluding to the title of Robert Alter ’ s book The Invention of Hebrew Prose ( 1988 ), which provides the best and clearest statement of the version of Hebrew literary history that was accepted throughout most of the twentieth century. 2 Frieden 2008. 3 Alter 1988 : 17. 4 Ibid. : 29. 5 Ibid. : 30. 174 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ enced by the prevailing Haskala style, and that his innovative nussāḥ crystallized around 1886, when he began to publish Hebrew short stories.6 In the intervening years between his early and late Hebrew works, Abramovitsh wrote his ĳive Yiddish novels.7 Having produced such compelling ĳiction in ‫מאמע ־ לשון‬ ַ , he attempted to achieve the same kind of success in Hebrew.8 That was impossible, however, because even Abramovitsh could not make nineteenth-century Hebrew sound like an everyday vernacular. Yiddish and Yiddish-inflected Hebrew played an indispensible role in what Haim Nahman Bialik dubbed “ Mendele ’ s nussāḥ. ” 9 Only by emulating Yiddish could Abramovitsh create the illusion that Hebrew was a spoken language. Bialik ’ s essays show his scorn for Yiddish, his mother tongue, while also acknowledging the importance of translations from Yiddish in the Hebrew revival. After translating his Yiddish novel ‫קיצור מסעות בנימין‬ ‫ ( השלישי‬The Brief Travels of Benjamin the Third, 1878 ) in 1896, Abramovitsh began reworking ‫דאס ווינטשינגערל‬ ָ ( The Wishing-Ring ) into the Hebrew version ‫ ( בעמק הבכא‬In the Valley of Tears ) ; this led Bialik to write sardonically, in a letter to Y. H. Ravnitzky dated 2 Elul 5659 ( 27 July 1899 ) : 10 ‫ור’ מנדלי שכתב ז’ רגון — תמיהני אם תהא‬ ‫ הלואי שתועיל לו התשו־‬.‫לו כפרה עולמית‬ ‫בה שהוא שב בתרגמו עתה את כתביו עברית‬ .( ‫) בעמק הבכא‬ And Reb Mendele, who wrote zhargon – I wonder whether he will ĳind forgiveness eternally [ in the World to Come ]. May it help him that he has now atoned by translating his writings into Hebrew ( Bě-‘ ēmeq ha-bākhā ’ ). ָ was printAbramovitsh’s massive Hebrew rewriting of ‫דאס ווינטשינגערל‬ ed serially under the title ‫ בעמק הבכא‬in Aḥad Ha ‘ am ’ s seminal Odessa journal of the so-called Hebrew ‫ ‘ ( תחיה‬revival, ’ ‘ rebirth, ’ ‘ renewal ’ ).11 6 A diverging perspective is that of Reuven Merkin, who used statistical computer analysis to show that the translation ‫ ( ספר תולדות הטבע‬The Book of Natural History ), based on Harald Othmar Lenz ’ s German work, served as Abramovitsh ’ s language laboratory in 1862 – 1872 ; he notes the presence of foreign words from European languages ( Merkin 1978 ( i ) : 88 ) and Aramaic ( Merkin 1978 ( i ) : 92 ), arguing that this interim phase anticipated Abramovitsh ’ s later accomplishments in Hebrew (cf. n. 44). 7 Frieden 1995 : chapters 1 – 3. 8 Alter 1988 : chapter 1. 9 Bialik 1911 ; see also Bialik 1965 : 245 – 246. The Yiddish version of this essay was published in the collection of essays entitled ‫ ( קריטיק איבער מענדעלע מוכר ־ סרים‬Abramovitsh 1911 : 151 – 155 ). See Bialik 1912 : v ; Bialik 1965 : 242 – 245. 10 Bialik 1937 ( i ) : 127, letter 57. 11 See Ha-šilōaḥ 1 – 4 (1896–1899), 7 – 8 (1901–1902), and 17 – 19 (1907 – 1909), as listed in Abramovitsh 1965 : 12. For an English translation of the novel by Michael Wex, based on the Ken Frieden : Yiddish in Abramovitsh ’ s Literary Revival of Hebrew 175 In Bialik’s sarcastic formulation, this helped to atone for the guilt he had incurred by writing his earlier Yiddish novels. At about this time, Bialik also began his own Hebrew translation of the ĳirst eight chapters of Abramovitsh’s expanded ‫ ( ישקע דער קרומער‬Fishke the Lame, 1888 ), making efforts to diminish the traces of Yiddish in the Hebrew. While those opening chapters were published under the title ‫ספר הקב־‬ ‫ ( צנים‬The Book of Beggars ) in 1901, Bialik had originally preferred what became the subtitle of that ĳirst printing, ‫ ( נון כפופה‬Crooked [ letter ] Nun ). Abramovitsh was unenthusiastic about this representation of the lame Fishke as a crooked Hebrew letter, and the subtitle was dropped in subsequent editions. In his translation, Bialik used exalted Hebrew – which, according to Yosef Klauzner, led Abramovitsh to comment that ‫די כּלה איז צו שיין‬.12 Bialik especially rejected hasidic influences on the new style. In his essay ‫ “ ( הספר העברי‬The Hebrew Book, ” 1913 ), Bialik lists hasidic stories as item 11 b in his ambitious plan for a full library of the Hebrew literary tradition. But he suppresses the Yiddish connection and emphasizes the importance of Aramaic.13 Although he wrote his essays in the aftermath of Martin Buber ’ s popular retellings of hasidic tales, he was clearly not an admirer of their Hebrew and Yiddish sources. Bialik and Y. H. Ravnitzky both argued that Abramovitsh superseded the quasi-biblical Haskala style – by creating a new, synthetic style. According to their interpretation of Hebrew literary history, Abramovitsh ’ s nussāḥ brought together the many historical layers of biblical, mishnaic, and medieval Hebrew along with an Aramaic component.14 At the same time, they neglected to acknowledge that hasidic Hebrew had been doing this effectively since the start of the nineteenth century.15 Past articles have brought to light some problems associated with Abramovitsh ’ s Hebrew synthesis.16 The present analysis shows how Yiddish was essentially excluded from discussions of this synthetic style, expanded Yiddish version, see Abramovitsh 1996. 12 Cf. Frieden 2007–2008: 173. 13 See Kōl kitvēy Ḥ. N. Bialik, pp. 204 – 211 ; for example, he states that the influence of Aramaic “ on the soul of the people ” was “ a hundred times greater than that of all the Jewish jargons ( ‫ ) הז’ רגונים היהודיים‬put together ” ( 208 ). 14 For Y. H. Ravnitzky ’ s discussion, which preceded Bialik ’ s, see Ravnitzky 1922 : 166 – 175. The essay was ĳirst published ( on the occasion of Abramovitsh ’ s authorial Jubilee and seventieth birthday celebration ) in Ha-‘ōmer, book 1, part 2 ( 1907 ) : 23 – 31. 15 Lewis Glinert discusses the signiĳicance of hasidic Hebrew writing in Glinert 2005 : xiii – xxvi. 16 See Frieden 2006, arguing that Aramaic introduces a high register that runs counter to the effect that Abramovitsh was seeking ; he and Bialik sometimes tried to use Aramaic to suggest a folksy element, but this effect was viable only for ( male ) readers who had a traditional Talmudic education ; and cf. Frieden 2007 – 2008. 176 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ and how it nevertheless played a major role in Abramovitsh ’ s Hebrew nussāḥ. This is precisely what Haskala authors feared and tried to avoid : the scorned ‘ contamination ’ of their supposedly pure biblical Hebrew by post-biblical elements. Incidentally, linguists have demonstrated that maskilic Hebrew writing was never as ‘ pure ’ as the maskilim claimed.17 The most undesirable of the ‘ impure ’ elements was Yiddish,18 and calques from Yiddish reminded educated Hebrew readers of ‘ low ’ hasidic Hebrew and of Joseph Perl ’ s notorious parody ‫ ( מגלה ־ טמירין‬Revealer of Secrets ). The most prominent hasidic exemplars are the Hebrew versions of ‫חי‬#‫ש‬ ‫ ( הבעש ׳׳ ט‬In Praise of the Ba‘ al Shem Tov ) and Nahman ’ s ‫סיפּורי ־ מעשׂיות‬ ( Tales ), both of which incorporate many Yiddish words and expressions.19 Abramovitsh, tacitly at odds with Bialik, embraced the “ contamination ” of his nussāḥ by Yiddish – but without openly admitting it. Even Abramovitsh ’ s adoption of Aramaic phrases embodied a veiled Yiddish connection, since most of the Aramaic he used was present in erudite Yiddish speech, when ‫ ( דרך הש ׳׳ ס‬the way of the Talmud ) was embodied in Yeshiva studies.20 In other instances, using Aramaic in his Hebrew ĳiction enabled Abramovitsh to create a higher register, sometimes paralleling the use of a higher-register Hebrew within Yiddish. As Menahem Perry has shown, Abramovitsh ’ s Hebrew writings often include Hebrew words or phrases that had taken on new meanings in Yiddish.21 Abramovitsh wrote Hebrew for Yiddish speakers, and sometimes we can understand his Hebrew only if we think in Yiddish. For ideological reasons, literary historians have usually underestimated the role of Yiddish in Abramovitsh ’ s Hebrew innovations. The opening chapters of ‫ ( קיצור מסעות בנימין השלישי‬The Brief Travels of Benjamin the Third ) are among Abramovitsh ’ s earliest selftranslations from Yiddish into Hebrew. After spending a decade writing new Hebrew stories, in 1896 he started transferring his Yiddish classics into Hebrew.22 While Benjamin the Third is a parody of Don Quixote, Abramovitsh ’ s 1878 Yiddish novel is also a parody of hasidic descrip17 Cf. Frieden 2009 : 4, note 4, which quotes Rabin 1985. See also Shakhevitch 1967 : 236 – 242. 18 On the surface, Bialik states that Abramovitsh “ broke down the wall between the two languages, spoken Yiddish and Hebrew. ” But his formulation indicates only that there was cross-fertilization between Abramovitsh ’ s use of Yiddish and Hebrew. See Bialik 1965 : 244. 19 See Unger 1961 : 65 – 73, which provides a list of more than 100 entries. 20 Cf. Weinreich 2008 ( i ) : chapter 3. 21 Perry 1968 : section 7. 22 A few years later Bialik translated the ĳirst eight chapters of ‫ ; ישקע דער קרומער‬unlike this partial rendering of ‫ ישקע דער קרומער‬into ‫ספר הקבצנים‬, the translations of ‫קיצור מסעות‬ ָ were apparently the work of Abramovitsh alone. Start‫ בנימין השלישי‬and ‫דאס ווינטשינגערל‬ ing in 1896, they were printed in the journals ‫פרדס‬, ‫השלח‬, and ‫הדור‬, under the editorship of Ravnitzky, Aḥad Ha ‘ am, and David Frishman. Ken Frieden : Yiddish in Abramovitsh ’ s Literary Revival of Hebrew 177 tions of journeys to the Holy Land. Among other intertexts, the author was responding to speciĳic, posthumously published works by Nathan Sternharz : ‫ ( חיי מוהר ” ן‬The Life of Rabbi Nahman, 1874 ) and ‫ימי מוהרנ ” ת‬ ( The Days of Rabbi Nathan, 1876 ). These two works, which include vivid travel narratives, made a serious – but seldom acknowledged – contribution to nineteenth-century Hebrew writing.23 In Warsaw, I. L. Peretz openly drew inspiration from hasidic narrative for his neo-hasidic stories,24 while Bialik and Dubnov were among the many Odessa authors who were skeptical of the Hebrew written by hasidim. Dubnov describes the Hebrew style of Nahman ’ s tales as “ vulgar and ugly, and the language – a bad translation from spoken Yiddish ” ( ,‫גס ומכוער‬ ‫) והלשון — תרגום עברי גרוע מיהודית המדוברת‬.25 Dubnov later recalled that in 1891 he and Sholem Aleichem had jokingly exchanged letters in the mock-hasidic ‫ ( מגלה ־ טמירין ־ לשון‬Megale tmirin idiom ), following Joseph Perl ’ s example.26 That style came easily to them, since it was basically translated from Yiddish. Although Dubnov scorned hasidic Hebrew, he recognized – referring to the translation from ‫דאס ווינטשינגערל‬ ָ to ‫בעמק‬ ‫ – הבכא‬that Abramovitsh wrote Hebrew best when he was translating from a prior Yiddish original.27 When Abramovitsh transferred ‫ קיצור מסעות בנימין השלישי‬from mame-loshn into modern Hebrew, he further developed his emerging Hebrew nussāḥ. The versions of Benjamin the Third are easier to study than ‫דאס ווינטשינגערל‬ ָ and its Hebrew counterpart ‫ בעמק הבכא‬, which Abramovitsh kept revising and expanding in successive editions ( Yiddish, 1865 and 1888 – ; Hebrew, 1896 – ). Benjamin the Third is also a unique case because, as part of its ĳictional pretense, the 1878 Yiddish novel already purports to be a translation from another European language. Starting with his ‫ הקדמה‬to the 1896 Hebrew version of Benjamin the Third, Mendele Moykher Sforim ( that is, the ĳictional persona who appears as editor and translator ) frequently uses the same Hebrew words and phrases that were present in the Yiddish original.28 Apart from the 23 Cf. Frieden 2005, 2009. 24 See Jacobson 1987 : 30 – 41, which analyzes one instance in which Peretz reworks a dream narrative by Nahman of Bratslav from ‫חיי מוהר ” ן‬. See also Frieden 2002. 25 Dubnov 1975 : 307. 26 Dubnov wrote that he and Sholem Aleichem “ corresponded in the language of Megale tmirin – the comic Yiddishized [ ‫רגאנישן‬ ָ ‫זשא‬ ַ ] Hebrew of two hasidim, which one cannot read without laughing ” ( Dubnov 1929 : 40 and cp. 59 ). David Assaf questions whether there is anything hasidic in the style of their Hebrew letters, which he published ( Assaf 1999 : 67 ). While they are not necessarily “ hasidic ” in character, they do exemplify the tacit influence of Yiddish on Hebrew writing of the time. 27 Dubnov 1929 : 46. 28 References are to the Hebrew edition of ‫ קיצור מסעות בנימין השלישי‬that was included as 178 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ identical title, one minor initial observation is that the Hebrew rendering approximates the Yiddish spelling of many names, such as ‫חייקעלי‬ and ‫ איציקיל הכלבוני‬for ‫ ( איציקל כּל ־ בוניק‬h 3 / y 3 ). In the Hebrew version Abramovitsh also often preserves the Yiddish spellings of names that include the ‫ל‬- diminutive, or ‫לע‬- / ‫לי‬-, as in the name of his character and persona Mendele.29 Words in the Hebrew version are often borrowed back from Hebrew loan words used in the Yiddish. In Benjamin the Third, Abramovitsh ’ s Yiddish is more Hebraized than in other novels he wrote, and Benjamin ’ s Hebrew, when quoted by the narrator, sounds pompous. The imbedded Hebrew dimension enables Abramovitsh to foster his pretense that the book has been translated from some other, unspeciĳied language. For example, the second chapter opens with what is supposed to be a direct quotation from Benjamin ’ s travel narrative. As Anita Norich and Dan Miron note in their essay on the Yiddish version of Benjamin the Third, when the Hebrew ‫ נתגדלתי‬is glossed by the Yiddish ‫געווארן‬ ָ ‫בין איך נתגדל‬, it takes on a different character ; they comment that “ bilingual discrepancies are made to turn Benjamin ’ s pomposity on itself. [ … ] The short paragraph is therefore full of contradictions which are accentuated through its bilingualism. ” 30 In Mendele ’ s opening ‫ הקדמה‬to the Hebrew edition, many Hebrew phrases are taken from the Yiddish, some with slight grammatical variation. These interlinguistic borrowings include : ‫ פה‬,‫ הנוסע האמתי‬,‫ אדם הראשון‬,‫ לפחות מאה כתות מלאכים‬,‫ כלי ־ זין‬,‫מכל שכן‬ .‫ הקטן מענדעלי‬,‫ לא עליכם‬,‫ כונתי תמיד‬,‫ ואני מענדעלי‬,‫ לשון קודש‬,‫אחד‬ (y 3–5 / h 3–4) In the subsequent chapter, other Hebrew phrases of this kind include : ,‫ כל מלכי מזרח ומערב‬,‫ לשם שמים‬,‫ הצנועה מרת זעלדה תחיה‬,‫כל ימי נתגדלתי‬ ,‫ קוממיות‬. . .‫ תוליכנו‬,‫ מאכל מלכים‬,‫ רחמים בני רחמים‬,‫ השם יתברך‬,‫בעל ־ בטחון‬ ‫ עד‬,‫ היד רמה‬,‫ הר הזיתים‬,‫ חמי טבריא‬,‫ כותל מערבי‬,‫ קבר רחל‬,‫מערת המכפלה‬ ,‫ מצורף לזה‬,‫ חרטומי מצרים‬,‫ על עשרת השבטים‬,‫ שר של ישראל שולט‬,‫מתי‬ .‫ חדושים ונפלאות‬,‫ שבע החכמות‬,‫ניצוץ של נוסע‬ ( y 6 – 11 / h 5 – 9 ) a supplement to the journal Pardes ( Odessa : Belinson, 1896 ). in the examples that follow, page references to this edition are listed as “ h, ” while references to the 1878 Yiddish version are listed as “ y”. Abramovitsh made many small changes for the ĳinal version published in his collected works ( 1909 – 1912 ) ; if we are interested in understanding his development, it is worthwhile to focus on the state of his art in 1896. 29 On “ Mendele ” as a persona rather than a pseudonym, see Miron 1996. 30 Miron and Norich 1980 : 45, 47. Ken Frieden : Yiddish in Abramovitsh ’ s Literary Revival of Hebrew 179 In just the opening two pages of Benjamin the Third, moreover, Abramovitsh transfers the following Hebrew words directly from the Yiddish version : .‫ שכל‬,‫ כח‬,‫ ארצות‬,‫ נסיעה‬,‫ מקומות‬,‫ רבותי‬,‫ קבצנים‬,‫ סחורה‬,‫ הגלגלים‬,‫הבורא‬ And in the next chapter there are many more Hebrew words taken directly from the Yiddish, such as : ‫ שי־‬,‫ מלאכה‬,‫ אביונים‬,‫ תוגר‬,‫ שלימות‬,‫ מפקיר‬,‫ גזרות‬,‫ ענין‬,‫ סברות‬,‫שכנו \ שכנים‬ ,‫ הלבנה‬,‫ דוחק‬,‫ כלל‬,‫ מומחה‬,‫ גבורה‬,‫ פאה‬,‫ תמר‬,‫ פירות‬,‫ הלבשה‬,‫ שבח‬,‫ חוץ‬,‫דוך‬ .‫ נתפעל‬,‫ פשוט‬,‫ הוספות‬,‫ מסוגל‬,‫נלכד‬ ( y 6 – 11 / h 5 – 9 ) Then there are interesting cases of Hebrew verbal roots, already used in the Yiddish version, that shift from their Yiddish grammatical forms in returning to Hebrew : ‫זײן‬ ַ ‫ משׂיג‬becomes ‫להשיג‬ ‫זײן‬ ַ ‫ מליג צו‬becomes ‫להפליג‬ ‫ [ קונה ־ שם געווען‬. . . ] ‫האט‬ ָ becomes ‫קנה לו שם‬ ‫זײן חכמה‬ ַ ‫רויסווײזן‬ ַ ‫ ַא‬becomes ‫נתחכמה‬ ‫ ( ווי ַאזוי ער איז זיך מרנס‬y 6 – 7 ) becomes ‫ פרנסה‬. . .‫ ( איזו‬h 5 – 6 ) As suggested earlier, however, some of the most interesting cases involve a shift in meaning. The Yiddish usage of khevre in ‫רה‬#‫גאנצע ח‬ ַ ‫ די‬is a deĳinite shift away from Hebrew usage, so Abramovitsh preserves the root noun and gives us a very different phrase, “ the rest of ḥavērāw, ” which changes the meaning ( y 4 / h 4 ). One might argue that Abramovitsh ’ s embedding of Yiddish meanings in Hebrew phrases anticipates the ongoing developments over the subsequent century. Several authors have noted the implicit presence of Yiddish in modern Hebrew.31 An especially pertinent case is that of idiomatic Yiddish phrases that Abramovitsh chooses to transfer directly into Hebrew.32 For instance, in Benjamin the Third, the conversation about a certain matter 31 See, for instance, Chanoch 1930 : 89 ; Rubin 1945 : 308 ; Chomsky 1957 : 193 – 197 ; and Blanc 1965 : 189. More recently, linguists such as Ghil‘ad Zuckermann ( 2003 ) have emphasized the influence of Yiddish and other languages on modern Hebrew. 32 Y. H. Brenner ’ s and Benjamin Harshav ’ s Hebrew translations of Sholem Aleichem ’ s Tevye stories are signiĳicant precisely because they use direct transfers of this kind and preserve the Yiddish idioms in Hebrew. See Brenner 1972 and Harshav 1983. Moreover, Brenner follows Abramovitsh ’ s example by using the word ‫ קבצן‬to translate Tevye ’ s Yiddish ‫רעמאן‬ ַ ‫ָא‬ ( Brenner 1972 : 201 ). 180 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ( ‫ ) ענין‬rolls from house to house ‫ ( ווי ַא קויל ון שניי‬y 6 ) or ‫ ( ככדור של שלג‬h 5 ). Snow may be found in the Hebrew Bible, but neither snowballs nor the derivative metaphor meaning “ to snowball ” were familiar in biblical or post-biblical Hebrew. Some other instances of idiomatic Yiddish similes transferred to Hebrew are : ‫ ( ַאזוי ווי איר קוקט מיך ָאן‬y 7 ) becomes ‫ ( כמו שאתה רואה אותי‬h 6 ) ‫וואס ליגט אין איי‬ ָ ,‫ ( ווי ַא הינדעלע‬y 9 ) becomes ‫ ( כאפרוח זה בתוך ביצה‬h 7 ) ‫וואס ליגט אין כריין‬ ָ ‫ווארעם‬ ָ ‫ ( ווי ַא‬y 9 ) becomes ‫כתולעת זו שקובעת דירתה‬ ‫ ( בתוך החזרת‬h 7 – 8 ) These direct transfers show that Abramovitsh wanted to convey the Yiddish idioms rather than replace them with Hebrew idioms. Three remarkable examples of Yiddish-inflected modern Hebrew usages that were popularized by Abramovitsh are batlen, kabtsn, and nogid ( all used in relatively new senses ). The name of Benjamin ’ s ĳictional shtetl is Tuneyadevke, in the Yiddish, based on the Russian word for ‘ parasite,’ тунеядец. In the Hebrew text, Mendele quotes Benjamin writing about his town named ‫בטלון‬,33 linked to the word ‫בטלן‬. While baṭlān is a word that derives from ancient Hebrew and Aramaic, under the influence of Yiddish it took on a new meaning in modern Hebrew. Hasidic writers and their parodists ( authors like Perl and Abramovitsh ) were conduits, transferring new meanings ( “ new wine in old vessels ” ) from Yiddish to Hebrew. ‫ בטלן‬was based on the ancient Hebrew verbal root b-ṭ-l ( ‫ל‬.‫ט‬.‫) ב‬, meaning ‘ to annul ’ ; hence the Talmud deĳines a village ( ‫ ) כפר‬as a place that has fewer than ten baṭlānīn ( b. Měgillāh 3 b ), referring to unemployed men, or people of leisure.34 In the Middle Ages, the meaning of baṭlān extended to include the meaning ‘ idler ’ and could designate a person who sits all day in the synagogue.35 Abramovitsh ’ s use of ‫ בטלן‬in Benjamin the Third ( h 4 ), referring to an impractical person or beggar, is sufĳiciently original that it is cited as an early example in Even-Shoshan ’ s Hebrew dictionary 36 as well as in the most complete dictionary of loshn-koydesh words in Yiddish.37 Abramovitsh popularized a new Hebrew usage by borrowing it back from Yiddish. So Yiddish gave Hebrew a new kind of ‫בטלן‬. The word ‫ בטלן‬therefore illustrates the general phenomenon analyzed here : a Hebrew root takes on new meaning in Yiddish, and then 33 ,‫„ כל ימי — כך מספר בנימין השלישי בעצמו — כל ימי נתגדלתי בק ״ ק בטלון דמתקריא טונעיאדעווקי‬ ‫ ובה נשאתי למזל ־ טוב את זוגתי הצנועה מרת זעלדה‬,‫ בה למדתי ודעה קניתי‬,‫בה היתה הורתי ולידתי‬ ‫״‬.‫ ( תחיה‬Abramovitsh 1896 : 5 ). 34 35 36 37 Jastrow 1992 : 158. K ’na‘ani 2000 ( i ) : 131. Even-Shoshan 1985 ( i ) : 108 c. Niborski and Neuberg 1999 : 25. Ken Frieden : Yiddish in Abramovitsh ’ s Literary Revival of Hebrew 181 an innovator like Abramovitsh carries over this new meaning into Hebrew writing. This was not self-evident ; Peretz called one of his earliest Yiddish stories ‫ ( דער משוגענער בטלן‬1890 ), but when he translated it into Hebrew he dropped that Yiddish-Hebrew usage and called it ? ‫ מי אנכי‬. In what seems to have been an unauthorized partial translation that was published in 1896, Berdichevsky also effaced the word baṭlān and called it ‫שיודע לשאול‬.38 The word ‫ קבצן‬is even more striking, because it may never have been used as a noun in pre-modern Hebrew ; it appears only in the verbal sense meaning ‫לקבץ אותן‬, following the phrase ‫ ( קבצנו יחד‬from the blessing for the ingathering of the exiles in the Amidah prayer ). Again, this nominal usage originated in Yiddish before Abramovitsh and other writers exported it into Hebrew. In the 1878 Yiddish version of Benjamin the Third, ‫ קבצן‬occurs in a sentence that describes the men of Tuneyadevke as ‫ לוסטיקע קבצנים‬,‫יונים‬#‫ ( ריילעכע א‬y 7 ), where these beggars are characterized by their practice of gathering alms. The word occurs twice in the parallel passage in the 1896 Hebrew version : ‫הם בעצמם רובם‬ .‫ קבצנים טובי לב‬,‫ אביונים שמחים‬. . .‫ ( ככלם אביונים גדולים וקבצנים נוראים‬h 6 ) Hence a few years later, while working with Bialik on the Hebrew translation of ‫ישקע דער קרומער‬, when Abramovitsh did not like Bialik ’ s idea of calling the Hebrew version ‫נון כפופה‬, he chose the title ‫ספר הקבצנים‬.39 The convention of using satiric place names ( like Bitalon or Kabtsansk ) was well-established in Russian literature and influenced Jewish writers, but modern Hebrew ‫ בטלנים‬and ‫ קבצנים‬owe their existence to Yiddish. ( Another ‘ poor ’ example is the word ‫דלפון‬, based on a popular Midrash about the second son of Haman. Yiddish developed the meaning of dalfn as ‘ poor person ’ before it was exported into modern Hebrew. ) At the opposite end of the social hierarchy, ‫ נגיד‬originally means ‘ leader ’ in Hebrew, but it comes to mean ‘ rich man ’ in nineteenth-century Hebrew, under Yiddish influence. Abramovitsh uses the word in both his Yiddish and Hebrew versions of Benjamin the Third ( see, for example, y 6 and h 5 ) ; and in ‫ספר הקבצנים‬, he uses it in quotation marks ( chapter 14 ) ; characters jokingly refer to Fishke as a nogid ( chapter 15 ) ; and the ĳictional character Mendele also uses the word ironically in letters, as when he writes to his low-class relative, addressing her as ‫נגידה‬ ‫ ( המפורסמת‬ch. 12 ). Even-Shoshan cites Abramovitsh ’ s Hebrew usage of ‫ נגיד‬in Benjamin the Third as an early example.40 38 See Berditchevsky 1966: 10. Cf. Avner Holtzman ’ s note in Berditchevsky 1998 ( iii ) : 200, listing the publication data on Berdichevsky ’ s loose translation : “ Še-yōdēa‘ liš ’ ōl ( mě ‘ at f īlōsōfyāh ), ” was written at the end of 1894 – that is, before Abramovitsh ’ s translation of Benjamin the Third was published – and printed in ‫ המליץ‬on 15 December 1896. 39 Cf. Dan Miron ’ s discussion of the title in his afterword to the Hebrew edition ( Abramovitsh 1988 : 203 – 209 ). 40 Even-Shoshan 1985 ( ii ) : 824 c. 182 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Some of the most interesting linguistic innovations from the těḥiyyāh or “ revival ” of Hebrew are, then, neologisms in Hebrew that were inspired by Yiddish usage. For instance, Abramovitsh uses ‫הדס כסף‬ in Hebrew ( h 8 / 8 ) to denote the Yiddish dead metaphor ‫ ( הדסל‬y 9 / 3 ), referring to a spice holder. Moreover, Abramovitsh apparently introduced a word for fraction, ‫ ( תשבורת‬h 8 ), based on Yiddish usage ‫כצאל‬ ָ ‫ברא‬ ָ or ‫בראכטייל‬ ָ .41 In addition, Abramovitsh uses some Yiddish-based words that also appeared previously in hasidic texts, such as ‫ ( מוכסן‬as distinct from the older Hebrew word for tax collector, ‫) מוכס‬.42 In the wake of Abramovitsh ’ s usage, other authors followed suit, as we can easily conĳirm using the website of the Ben Yehuda Project 43 and other databases. Taken together, the Bar Ilan Judaic Library data base, the Ben Yehuda Project, and other emerging databases make it possible to study the linguistic shift of key words in Hebrew writing, and to help determine the influence of Yiddish on the Hebrew revival.44 These resources show that many features of Yiddish gradually became absorbed into the bloodstream of modern Hebrew. The grammatical influences are just as important as the lexical examples. It is also worthwhile to reexamine Abramovitsh ’ s use of Aramaic in his Hebrew works. He resorted to Aramaic for several reasons : 1 ) to suggest a folksy tone ; 2 ) contrariwise, to suggest a higher linguistic register ; 3 ) to parallel the bilingual feel of the Yiddish version ; and 4 ) to mimic Aramaic phrases that were present in Yiddish. Possibly the most original and intriguing uses of Aramaic in Abramovitsh ’ s Hebrew are linked to his effort to recreate the kind of bilingual play that characterizes his Yiddish version of Benjamin the Third. The opening pages of chapter 2 show this, because there Abramovitsh adds several Aramaisms that are not present in the Yiddish : ‫ פור־‬,‫ יתערותא דלעילא‬,‫ איצטבא‬,‫ מילי דבדיחותא‬,‫ לדוגמא‬,‫ בעלמא‬,‫דמתקריא‬ .‫ אנדרולמוסיא‬,‫ מילתא זוטרתא‬,‫ למאי נפקא מינה‬,‫ עינא בישא‬,‫תא‬ (y 5–8) 41 Ibid. ( iv ) : 1482 b. 42 Cf. Sholem Aleichem ’ s use of the word ‫ מוכסן‬in his Hebrew story ‫ ( אורייתא בגלותא‬1976 : 170 ) ; it was ĳirst published in ‫המליץ‬, numbers 159, 161, and 164 in July – August 1890. 43 www.benyehuda.org 44 Reuven Merkin was ahead of his time when he used computer techniques to research his dissertation, The Vocabulary of the Hebrew Writings of Sh. Y. Abramowitz ( Merkin 1987 ). He argues that Abramovitsh was already modifying his Hebrew style in the 1870s ; the dating of his transformation does not, however, change the substance of this argument about the role of Yiddish ( cf. n. 6 ). Ken Frieden : Yiddish in Abramovitsh ’ s Literary Revival of Hebrew 183 While some of these words were common in Yiddish, Abramovitsh did not carry them over from the Yiddish source. Where the Yiddish can suggest a high and pretentious register by incorporating Hebrew, in Hebrew Abramovitsh sometimes achieves a similar differentiation by incorporating Aramaic. This is particularly well-suited to a travelogue by Abramovitsh ’ s pretentious Benjamin, whose narrative is supposed to come across as a feeble imitation of distinguished European travelers and stylists. Much of the humor of the book derives from the clash between Benjamin ’ s pretentious rhetoric and his comic incompetence. The most important use and effect of Aramaic lies, however, in its tacit link to Yiddish. Because hundreds of Aramaic words were commonly used in Yiddish, at least when it was used as the language of instruction in yeshivas, these lexical elements remained active in the Yiddish vernacular. Although the imbedded Aramaic in Benjamin the Third reflects the narrator ’ s pomposity, in other works it signals a low register by suggesting the Yiddish source. Finally, we should note that when writing in Hebrew, Abramovitsh was comfortable incorporating actual Yiddish words such as ‫הקפוטה‬ ( h 6 / 4, ‫פּאטע‬ ָ ‫קא‬ ַ ), ‫ ( פיאטעס‬h 6 / 1, ‫פּיאטעס‬ ַ ), ‫ ( רוסילפלייש‬h 7 / 3, ‫ראסללייש‬ ָ ), ‫ ( טעמביק‬h 8 / 7, ‫) טעמפּיק‬, or ‫ ( ירמולקות‬h 7 / 12, ‫יארמלקעס‬ ַ ). Like other writers in the nineteenth century, Abramovitsh followed an orthographic custom of marking the Yiddish word with a quotation mark before the ĳinal character – as if it were an abbreviation.45 A new horizon is opening up for scholars of literature, as computer resources help to revolutionize our understanding of Hebrew and Yiddish literary and linguistic history.46 Obviously there is no substitute for being well-read, but the databases enable us to make discoveries and conĳirm theories in ways that were not feasible in the past. This methodology will clarify the linked histories of modern Yiddish and Hebrew writing, showing how these languages have undergone such remarkable transformations in relation to one another. 45 Menahem Perry discusses one remarkable instance in which Abramovitsh tried to convey the Yiddish subtext. What was he to do with the Yiddish idioms such as ‫איינריידען זייא‬ ‫ אקינד ] ! [ אין בויך‬or ‫ ( א קוה איז געפלויגען איבערין דאך אונ געלייגט איין איי‬y 8 ; original orthography preserved ) ? He uses Aramaic, word play, and a remarkable innovation. Something that has been fantastically invented, like talking someone into an imaginary pregnancy, becomes the Aramaic ‫עורבא פרח‬, while his rendering of the Chagall-like cow flying over the roof and laying an egg inserts the rare word ‫כוי‬, which is mentioned in the Talmud ( “ a kind of bearded deer or antelope, ” Jastrow [ 1903 ] 1995 : 618f. ), sounds like ‫קו‬, but refers to a different beast : ‫ ( כוי פרח באויר והטיל ביצה‬h 7 ; see Perry 1968 : 93b ). 46 In the early 1980s, as part of my dissertation in comparative literature – which was published as Frieden 1985 – I used key word analysis, associating linguistic word shifts with intellectual history. My goal was to show how key words like ‘ daimon, ’ ‫מלאך‬, and ‘ genius ’ both exerted influence on and reflected changes in cultural and intellectual history. 184 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ In twentieth-century Europe, in pre-state Palestine, and in postHolocaust Israel, as part of the effort to recreate a viable Hebrew vernacular, Yiddish was openly suppressed by Zionist policies.47 Despite this anti-Yiddish bias, in the twentieth century Yiddish words became integral to Israeli speech and writing. As we have seen in the literary realm, early modern Hebrew prose was often translated, explicitly or implicitly, from Yiddish. One may say that at times Yiddish has been concealed – like a palimpsest beneath an old document, or like a dybbuk inside someone possessed – within modern Hebrew writing. Some authors have called themselves “ post-Zionist ” thinkers, but perhaps what is needed in the twenty-ĳirst century, in order to facilitate a reevaluation of the intertwined literary and linguistic history, is a pre-Zionist study of Hebrew and Yiddish. 47 See Yael Chaver ’ s study of this chapter in Hebrew literary history ( Chaver 2004 ). Sholem-Yankev Abramovitsh Courtesy of University of Florida Digital Collections, Isser and Rae Price Library of Judaica http://ufdc.ufl.edu/judaica Ken Frieden : Yiddish in Abramovitsh ’ s Literary Revival of Hebrew 185 Bibliography Abramovitsh, S. Y., 1878 [ abbreviated references to this edition as y ] : Kitser masoes Binyomen ha-shlishi. Vilna : Rom. – 1896 [ abbreviated references to this edition as h ] : Qiẓẓūr massā‘ ōt Benyāmīn ha-šělīšī. Supplement to the journal Pardes. Odessa : Belinson. – 1911: Ale verk fun Mendele Moykher Sforim. Vol. 17. Cracow : Farlag Mendele. – 1965: Mendelī Mōkher Sěfārīm: rěšīmāt kětāvāw wě-’iggrōtāw lě-hatqānat mahadūratām hā-’aqādemīt. Jerusalem: Magnes. – 1988 : Sefer ha-qabẓānīm. Dan Miron, ed. Tel Aviv : Dvir. – 1996 : The Brief Travels of Benjamin the Third. Hillel Halkin, trans. In : Dan Miron and Ken Frieden, eds., Ted Gorelick and Hillel Halkin, trans., Tales of Mendele the Book Peddler : Fishke the Lame and Benjamin the Third. New York : Schocken Books. Alter, Robert, 1988 : The Invention of Hebrew Prose : Modern Fiction and the Language of Realism. Seattle : University of Washington Press. Assaf, David, 1999 : “ ‘ Ahūvī rē‘ ī, ha-maggīd mi-Dūbnō ’ : mikhtěvēy bědiḥōt bě-signōn ‘ Měgalleh ṭěmīrīn ’ še-heḥlīfū bēynēyhem Šālōm ‘Alēykhem wě-Šim ‘ ōn Dūbnōv. ” In : Chulyot 5 : 61 – 107. Berditchevsky, Mihah Yosef, 1966: Kitvēy Mīkhāh Yōsēf Bin-Goryōn [ Berditchevsky ]. Vol. 2 : Ma ’ amārīm. Tel Aviv : Hotza ’ at Dvir. – 1998 : Kitvēy Mīkhāh Yōsēf Berdīẓhevsqī. Ed. Avner Holtzman. Vol. 3 : Běmikhlělōt ha-ma ‘ arāv. Tel Aviv : Hakibbutz Hameuchad. Bialik, H. N., 1911 : “ Nussāḥ Mendelī. ” In : Ha-‘ ōlām 4 ( 50 ) : 6 – 8. – 1912 : “ Mendelī u-šělōšet ha-kěrākhīm. ” In : Kōl kitvēy Mendelī Mōkhēr Sěfārīm. Vol. 3. Odessa : Va‘ ad ha-yovel. – 1937 : ’ Iggěrōt Ḥayyim Naḥmān Běyalīq. Vol. 1. Ed. F. Lachover. Tel Aviv : Dvir. – 1965. Kol kitvēy Ḥ. N. Běyalīq. Tel Aviv : Dvir. Blanc, Haim, 1965 : “ Some Yiddish Influences in Israeli Hebrew. ” In : Uriel Weinreich, ed., The Field of Yiddish : Studies in Language, Folklore, and Literature 2. The Hague : Mouton : 185 – 201. Brenner, Y. H., 1972 : “ ‘ Ṭūvyāh ha-ḥalvān ’ lě-Šālōm ‘Alēykhem bě-targūm ‘ ivrī šel Y. Ḥ. Brener : Ha-zěkhīyāh ha-gědōlāh : pereq ri ’ šōn mi-tōkh ‘ ṭūvyāh ha-ḥalvān. ’ ” In : Siman kri ’ah 1 : 200 – 210. Chanoch, Irene, 1930 : “ Fremdsprachliche Einflüsse im modernen Hebräisch. ” Ph. D. Diss., Friedrich-Wilhelms-Universität zu Berlin. Chaver, Yael, 2004 : What Must Be Forgotten : The Survival of Yiddish Writing in Zionist Palestine. Syracuse : Syracuse University Press. 186 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Chomsky, William, 1957 : Hebrew : The Eternal Language. Philadelphia : The Jewish Publication Society. Dubnov, Shimon, 1929 : Fun “ zhargon ” tsu yidish un andere artiklen : literarishe zikhroynes. Vilna : Kletzkin. – 1975 : Tōlědōt ha-ḥasīdūt : ‘al yěsōd měqōrōt ri ’ šōnīm, nidpāsīm wě-kitvēyyad. Tel Aviv : Dvir. Even-Shoshan, Avraham, 1985 : Ha-millon he-ḥādāš. 4 vols. Jerusalem : Kiryat-sefer. Frieden, Ken, 1985 : Genius and Monologue. Ithaca : Cornell University Press. – 2002 : “ Pārōdyāh wě-hagyōgrafyāh : sippūrīm ḥasīdiyyīm-kivyākhōl šel Y. L. Pereẓ. ” In : Chulyot [ Haifa ] 7 : 45 – 52. – 2005 : “ Joseph Perl ’ s Escape from Biblical Epigonism through Parody of Hasidic Writing. ” In : ajs Review : The Journal of the Association for Jewish Studies 29 : 265 – 282. – 2006 : “ ‘ Nussāḥ Mendelī ’ bě-mabbāt biqōrtī. ” In : Dappim lě-meḥqar běsifrut 14 – 15 : 89 – 103. – 2007 – 2008 : “ Epigonism after Abramovitsh and Bialik. ” In : Studia Rosenthaliana 40 ( Amsterdam ) : 159 – 181. – 2008 : “ Innovation by Translation : Yiddish and Hasidic Hebrew in Literary History. ” In : Justin Cammy, Dara Horn, Alyssa Quint and Rachel Rubinstein, eds. Arguing the Modern Jewish Canon : Essays on Literature and Culture in Honor of Ruth R. Wisse. Cambridge, ma : Center for Jewish Studies, Harvard University, and Harvard University Press, 417 – 425. – 2009 : “ Neglected Origins of Modern Hebrew Prose : Hasidic and Maskilic Travel Narratives, ” In : AJS Review : The Journal of the Association for Jewish Studies 33 : 3 – 43. Glinert, Lewis, 2005 : “ The Hasidic Tale and the Sociolinguistic Modernization of the Jews of Eastern Europe. ” In : Avidov Lipsker and Rella Kushelevsky, eds., Studies in Jewish Narrative : Ma ’aseh Sippur. Presented to Yoav Elstein. Tel Aviv : Bar Ilan University Press, vii – xxxvi. Harshav, Benjamin, 1983 : Tevye ha-ḥalvān wě-mōnōlōgīm. Tel Aviv : Siman Kri ’ah and Ha-kibbutz ha-me ’uhad. Jacobson, David C., 1987 : Modern Midrash : The Retelling of Traditional Jewish Narratives by Twentieth-Century Hebrew Writers. Albany : suny Press. Jastrow, Marcus, 1992 : A Dictionary of the Targumim, the Talmud Babli and Yerushalmi, and the Midrashic Literature. New York : Judaica Press. ( Original edition 1903. ) Ken Frieden : Yiddish in Abramovitsh ’ s Literary Revival of Hebrew 187 K ’na ‘ ani, Yakov, 2000 : Ha-millōn hā-‘ Ivrī ha-mālē ’. 4 Vols. Tel-Aviv : Hotza ’ at milonim la ‘ am. Kritik iber Mendele Moykher Sforim, 1911 : Ale verk fun Mendele Moykher Sforim ( S. Y. Abramovitsh ). Vol. 17. Cracow : Farlag “ Mendele. ” Merkin, Reuven, 1978 : “ Ōẓar ha-millīm bě-ḥibūrāw hā-‘ ivriyyīm šel Š. Y. Abrāmovīẓh : nitūaḥ ha-běḥīnāh ha-millonīt, ha-diqdūqīt wě-hasignōnīt bě-siyyūa‘ ha-maḥšēv. ” 2 vols. Ph. D. Diss. Jerusalem : Hebrew University. Miron, Dan, 1996 : A Traveler Disguised : The Rise of Modern Yiddish Fiction in the Nineteenth Century, 2nd ed. Syracuse : Syracuse University Press. [ First ed., New York : Schocken, 1973. ] Miron, Dan, and Norich, Anita, 1980 : “ The Politics of Benjamin iii : Intellectual Signiĳicance and Its Formal Correlatives in Sh. Y. Abramovitsh ’ s Masoes Benyomin Hashlishi. ” In : Marvin I. Herzog, Barbara Kirshenblatt-Gimblett, Dan Miron and Ruth Wisse, eds., The Field of Yiddish : Studies in Language, Folklore, and Literature 4. Philadelphia : Institute for the Study of Human Issues : 1 – 115. Niborski, Yitskhok, and Neuberg, Simon, 1999 : Verterbukh fun Loshn-koydesh-shtamike verter in yidish. Paris : Bibliothèque Medem. Perry, Menahem, 1968 : “ Hā- ’ anālōgyāh u-měqōmāh bě-mivneh hā-rōmān šel Mendelī Mō ” S. ” In : Ha-sifrut 1 : 65 – 100. – 1981 : “ Thematic and Structural Shifts in Autotranslations by Bilingual Hebrew-Yiddish Writers : The Case of Mendele Mokher Sforim. ” In : Poetics Today 2 : 181 – 192. Rabin, Chaim, 1985 : “ The Continuum of Modern Literary Hebrew. ” In : Glenda Abramson and Tudor Parfitt, eds., The Great Transition : The Recovery of the Lost Centers of Modern Hebrew Literature. Totowa, nj : Rowman & Allanheld. Ravnitzky, Y. H., 1922 : “ ‘ Al ha-signōn hā-‘ ivrī šel Mendelī Mōkhēr Sěfārīm. ” In : Kōl kitvēy Mendelī Mōkhēr Sěfārīm, vol. 7 Berlin : Moriah : 166 – 175. Rubin, Israel, 1945 : “ Vegn der virkung fun yidish oyfn geredtn hebreish in Erets-Yisroel. ” In : yivo-bleter 25 : 303 – 309. Shakhevitch, Boaz, 1967 : “ ’Arba‘ lěšōnōt : ‘ iyyūnīm šel sifrūt bi-lěšōn hamaśkīlīm ‘ al pī Ha-mě ’assēf. ” In : Molad 212 : 236 – 242. Sholem Aleichem, 1976 : Kětāvīm ‘ ivriyyīm, ed. Khone Shmeruk ( Jerusalem : Mossad Bialik. Sternharz, Nathan, 1874 : Sefer ḥayyēy MōHaRa ” N. Ed. Naḥman of Tcherin. Lemberg, n.p. – 1876 : Sefer yěmēy MōHaRNa ” T. Ed. Naḥman of Tcherin. Lemberg, n. p. Unger, Menashe, 1961 : “ Yidishe verter in Shivkhe ha-Besht. ” In : Yidishe shprakh 21 : 65 – 73. 188 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Weinreich, Max, 2008 : History of the Yiddish Language. 2 Vols. Paul Glasser, ed. Shlomo Noble and Joshua A. Fishman, trans. New Haven : Yale University Press. [ Original Yiddish edition, Geshikhte fun der yidisher shprakh, 4 vols., New York : yivo, 1973. ] Weinreich, Uriel, 1965 : Hā-‘ ivrīt hā-’aškěnazīt wě-hā-‘ ivrīt še-ba-yīdīš : běḥīnātān ha-gē ’ ōgraf īt. Jerusalem : Rafael Haim Ha-Cohen [ Originally published in Leshonenu 24 ( 1960 ) : 242 – 252 and 25 ( 1961 ) : 57 – 80 and 180 – 196. ] Zuckermann, Ghil ’ ad, 2003 : Language Contact and Lexical Enrichment in Israeli Hebrew. New York and Basingstoke, UK : Palgrave Macmillan. Jan Schwarz “ Nothing But a Bundle of Paper ” Isaac Bashevis Singer ’ s Literary Career in America Isaac Bashevis Singer seemed really to live nowhere at all, though everyone had an address for him. He did not quite ĳit into the New World or the Old, so canny was he at adapting himself to American tastes, so skillful at exploiting those tastes for his own ends. His streak of opportunism often worked on behalf of his genius, and the public clowning in which he indulged neither seriously damaged his gifts as a perverse fabulist nor lacked a touch of contempt for his American admirers. Irving Howe, Margins of Hope : An Intellectual Autobiography 1 Unlike that of other Yiddish writers in North America after 1945, Isaac Bashevis Singer ’ s work has been thoroughly investigated in a variety of scholarly works in multiple ĳields. There are bibliographies of Singer ’ s work in Yiddish and English covering all stages of his career, with the exception of the period between 1952 and 1959.2 Although an increasing number of studies examining Singer ’ s works have appeared since his death in 1991, much of his Yiddish work published in the daily newspaper ‫ ָארווערטס‬and Yiddish journals has not yet been examined. Most of Singer ’ s work, which includes journalism, novels, life writing, and short stories, has not even been translated or reprinted in Yiddish in book form. David Neal Miller mentions that Singer published 907 items in Yiddish newspapers and journals from 1924 to 1949 ; only eleven of these ( the novel ‫רײ‬ ַ ‫גא‬ ָ ‫דער שׂטן אין‬, nine short stories, and one critical essay ) have been translated into English. In her bibliography of Singer ’ s work from 1960 to 1991, Roberta Saltzman has compiled a list of Singer ’ s Yiddish ĳiction written during this period that has not been translated ; it includes 11 novels, 11 novellas and 56 short stories.3 In addition, Singer published many works of life writing as serials in ‫ ָארווערטס‬from the early 1950s onwards which have never been made available in book form in Yiddish or English.4 It is possible that future investigations of 1 Howe 1982 : 264. 2 Miller 1983, 1979 ; Saltzman 2002. See also : Miller 1991. A footnote to this article states : “ This article appears in somewhat different form as the introduction to the author ’ s Bibliography of Isaac Bashevis Singer, 1952 – 1959. ” The latter work has still not been published. 3 Saltzman 2002 : xiii f. 4 See Schwarz 2005 : 142 – 152. 190 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Singer ’ s multifaceted work in the Yiddish newspapers and journals will reveal literary treasures that will further add to his literary reputation. It is the English versions of Singer ’ s works that have become deĳinitive ; translations into other languages ( including Hebrew and Polish ) are made from English, not Yiddish. From the 1960s to the 1980s, Singer scholarship as well was dominated by a focus on this corpus in English. Starting in the late 1980s, however, a new generation of Yiddish scholars began to study his Yiddish work.5 It is time for these two schools of Singer research to enrich each other, informed by an inclusive approach to the author ’ s Yiddish and English corpus. Singer ’ s Yiddish work must be the point of departure for any serious scholarly engagement. However, Singer ’ s literary bilingualism as translator of his Yiddish work into English ( almost always with the help of American translators ), which began in the 1960s, became an integrated part of his oeuvre. The English versions of his Yiddish work ( in some instances, signiĳicant differences exist between the two ) are in many cases artistically superior to the original Yiddish newspaper editions. As a result, it is pertinent to view the Yiddish and English versions as belonging to one corpus without a priori privileging the Yiddish in which Singer ĳirst published almost all of his work.6 The crucial period of Singer ’ s artistic career was the Polish period, between his debut in 1925 and his departure from Warsaw in 1935. In this decade ( his twenties ) he was at the center of the Yiddish literary world in Warsaw and contributed to both highbrow and shund journals.7 The sources for a reconstruction of this period in Singer ’ s life can be found in his life writing written from the mid-1950s to the early 1980s in New York as well as in his journalistic and literary contributions to Polish Yiddish periodicals between 1925 and 1935. However, this voluminous material has not yet been systematically examined to outline the particulars of Singer ’ s Polish period, where the keys to his later development and meteoric rise to fame in America can be found.8 Singer 5 See Wolitz 2001 and Sherman 2007 b. 6 Chaim Grade published eighteen books in Yiddish between 1936 and 1976. During his lifetime, six books of Grade ’ s works ( short stories, novels and life writing ) were published in English translation. See Lisek 2007 : 74 f. Singer, on the other hand, published considerably fewer books in Yiddish than in English. 7 The fact that there was no strict division between journalism and highbrow literature was emblematic of the discourse of Polish Yiddish culture in the interwar period. In that regard, Singer ’ s multiple cultural engagements were typical : “ The absence of clear-cut professional boundaries was in part a consequence of the weak economic base of Yiddish culture in Poland. Intellectuals needed to ‘ dance at many weddings ’ in order to make a living. The daily press and popular theater were the only ĳinancially secure cultural institutions. ” Fishman 2005 : 90. 8 Crucial for such an examination of Singer ’ s Polish period are the works of Chone Jan Schwarz : “ Nothing But a Bundle of Paper ” 191 grew up in an ultra-Orthodox home that, in its extreme piety, was quite unusual compared with the backgrounds of his Yiddish literary peers. As a result of his exposure to his Hasidic father ’ s rabbinical court in Warsaw, and the traditional Judaism of his maternal grandfather, the Bilgoray rabbi ( Singer lived in Bilgoray from age 13 to 17 ), he could draw on much deeper experiences of traditional Jewish life than his contemporaries. Furthermore, like his older brother I. J. Singer ( 1893 – 1944 ), Singer had a phenomenal memory that would serve him well as an artist obsessively mining his autobiographical past.9 In 1935, Singer followed his brother I. J. Singer to New York, where the latter, who had arrived in 1933, had become an internationally renowned novelist and contributor to the ‫ ָארווערטס‬, the Jewish Daily Forward. Thanks to his older brother ’ s reputation, the lesser-known Singer landed a contract with ‫ ָארווערטס‬just a few months after arriving in New York. Abe Cahan, the legendary ‫ ָארווערטס‬editor, invited Singer to serialize his new novel in the newspaper. It began biweekly publication on October 5, 1935 under the title ‫היסטארישער‬ ָ ‫ ַא‬: ‫דער זינדיקער משיח‬ ‫מאן‬ ַ ‫רא‬ ָ ( The Sinful Messiah : A Historical Novel ). Following his critically acclaimed debut novel ‫רײ‬ ַ ‫גא‬ ָ ‫ ( דער שׂטן אין‬Satan in Goray, 1933 ), in The Sinful Messiah Singer depicted a controversial ĳigure from Jewish history, Jacob Frank ( 1726 – 1791 ), who had been influenced by the Sabbatean creed. Frank and his followers converted to Catholicism en masse in mid-eighteenth-century Poland. That novel has never been published in book form and was considered a failure by the author. However, according to a short article in ‫ ָארווערטס‬from 1936, the novel was highly popular among its readers.10 Singer published no more ĳiction for the next seven years, instead writing an increasing number of tabloid-style articles with titles like “ People Who Enjoy Hurting Others and People Who Get Pleasure from Being Hurt ” and “ Divorced His Wife and Took Her as a Lover. ” Shmeruk and Nathan Cohen. See Cohen 2003 ; Shmeruk 1981 – 1982. The latter article includes a list of autobiographical novels and memoirs about interwar Warsaw published in ‫ ָארווערטס‬from the mid-1950s until 1981. Most of these works have never appeared in book form in English or Yiddish. See also Fishman 2005 : 83 – 139 ; Yungman 1985. Two other formative experiences in Singer ’ s Polish period are Tlomatske 13, the address and unofĳicial name of the Association of Jewish Writers and Journalists in Warsaw, where he spent a great deal of time ; and the influence of Hillel Zeitlin, the important post-hasidic religious philosopher in Warsaw whose son, the poet Aaron Zeitlin, collaborated with Singer in the publication of the journal Globus from 1932 to 1934. See Cohen 2002 ; Szeintuch 2000, a volume of Aaron Zeitlin ’ s letters from Warsaw in the interwar period ; Zeitlin 1946. For a selection of Yiddish prose literature in interwar Poland, see Trunk and Zeitlin 1946. 9 See Singer 1984 : xi. 10 Isaac Bashevis Singer Papers, The Harry Ransom Center, University of Texas, ĳile 81 : 8. 192 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ In 1943, Singer published a reprint of ‫רײ‬ ַ ‫גא‬ ָ ‫ דער שׂטן אין‬and ĳive new stories.11 Four of these stories were narrated by the ‫ ( יצר ־ הרע‬the Evil Inclination ), part of a planned series of monologues entitled The Diary of the Evil One. Singer ’ s talent for storytelling blossomed in these monologues ’ formulaic battles between Good and Evil among ordinary shtetl Jews who were tempted by the Evil One to perpetrate the most outrageously transgressive acts. Singer turned these monologues into a sustained narrative unit, subverting the progressive humanism of Yiddish writers such as I. L. Peretz and Sh. An-sky, author of the renowned play ‫דער דיבוק‬. Peretz ’ s debut work, the epic poem ‫מאניש‬ ָ ( 1888 ) is told by an omniscient third-person narrator. Monish, the innocent young Talmud scholar, is tempted to perpetrate the ultimate act of heresy : he swears eternal love to Marie, the Gentile daughter of a German businessman, by the name of God : ‫ ון דער‬/ — ‫רויסגעזאגט‬ ָ ‫ ון זינדיקן מויל ַא‬/ . . . ‫גאט‬ ָ ‫נאמען‬ ָ ‫דעם‬ ! ‫שלאגט‬ ָ ‫ “ הייך ַא דונער‬he sinfully speaks the name of God / and is struck by the thunder of His rod. ” 12 As a result, Monish is condemned to an eternal Jewish purgatory. In Singer ’ s pieces, in contrast, the Sabbatean creed of sexual promiscuity as “ redemption through sin ” leads the characters to utter desperation and suicide.13 While Monish is punished by having his earlobe nailed to a doorpost in the netherworld, a Jewish purgatory, Singer graphically outlines the collective punishment of his sinners in the story ‫דער חורבן ון קרע־‬ ‫ ( שעוו‬The Destruction of Kreshev ), included in the 1943 volume. Having encouraged his wife Lise to commit adultery with a servant named Leybl Shmayser ( Laybl Whip ), Lise ’ s husband eventually confesses everything to the town rabbi. The punishment is swiftly carried out with a vengeance. Carted through the town, Lise becomes the target of verbal and physical abuse from the shtetl ’ s Jews. Again Singer subverts the father of Yiddish literature I. L. Peretz, who in the story ‫דרײ מתּנות‬ ַ ( Three Gifts ) had portrayed a martyred woman ’ s heroism. The woman pinned her dress to her body in order to maintain her chastity ( ‫ ) צניעות‬during a similar act of public humiliation. The main difference, however, is that in Peretz ’ s story the abusers are anti-Semites cheered on by priests and the mayor of the town, while in Singer ’ s the drama is played out entirely among Jews with almost no reference to the Gentile world. Again, Peretz ’ s martyrological universe, the quintessential sanctum of mod11 Singer 1943. 12 Howe, Wisse and Shmeruk 1987 : 80 – 81. Translation by Seymur Mayne. 13 Like the German Jewish kabbalah scholar Gershom Scholem ( 1897 – 1982 ), Singer turned Sabbatai Zevi into the prototype of his times. Scholem ’ s ĳirst published essay about Sabbatai Zevi, “ Redemption through Sin ” ( Scholem 1971 : 78 – 141 ), originally appeared in 1937. Later, in his magisterial study Sabbatai Ṣevi : The Mystical Messiah ( 1973 ), Scholem would acknowledge Singer ’ s stories as one of the most vivid expressions of Polish kabbalism in its “ unique fascination with the sphere of evil. ” Both Scholem and Singer mapped the long historical trajectory of Jewish destruction and renewal. Scholem 1974 : 299. Jan Schwarz : “ Nothing But a Bundle of Paper ” 193 ern Yiddish culture, has been violently imploded by Singer ’ s chillingly detached depiction of the collective orgy of revenge that descends on the poor sinner Lise, who eventually commits suicide. Singer closes one of his darkest stories with the complete destruction of Kreshev in a conflagration perpetrated by Leybl Shmayser. The only character to escape the yeytser-hore ’ s evil net is Gimpel, Lise ’ s father. This namesake of the righteous Gimpel the Fool ( 1945 ) would reappear under different guises in Singer ’ s stories published after the Holocaust. ‫מושקאט‬ ַ ‫ ( די ַאמיליע‬The Family Moskat ), Singer ’ s ĳirst work to be translated into English, became the test case for his standard procedure after 1950 of trimming and shortening the Yiddish novels serialized in ‫ ָארווערטס‬. The correspondence between the publisher Alfred A. Knopf and Singer in 1948 – 1949 indicates that initially the latter, contrary to the demand of his publisher, was against cutting the Yiddish text. Knopf pointed out that Singer ’ s older brother I. J. Singer had no issues “ in cutting very considerably The Brothers Ashkenazi, ” which the publisher had made available in English in 1936. The main issue was that the American readership in English was very different from Singer ’ s Yiddish readers : “ After all you must remember that we are publishing books in English for American readers to whom you are not as yet even a name. ” A central part of the editing and translating of Yiddish novels was the question of accessibility that applied to foreign language writing in general, regardless of the fact that Singer ( and many other Yiddish writers ) lived not in a foreign country but in New York, where they had a huge, devoted readership. Knopf perceptively articulated the quality that set Singer ’ s work apart, “ which I respect as being a sort of monument to a life that has ceased to exist and will never exist again. ” Literature as retrospective reconstruction of a lost world would be a central trope of post-1945 Yiddish literature, continuing a trend already evident in the historical novels of the two Singer brothers in the interwar period.14 The mutual influence between I. J. Singer and his younger brother has been noticed but not systematically analyzed. Key texts are I. J. Singer ’ s novels ‫קאלב‬ ַ ‫יאשע‬ ָ ( 1932 ) and ‫ ( די ברידער ַאשכּנזי‬1936 ), which can be viewed as prototypes against which Singer conceived his early historical novels, ‫רײ‬ ַ ‫גא‬ ָ ‫ ( שׂטן אין‬1933 ), ‫ ( דער זינדיקער משיח‬1936 ) and ‫די ַאמיליע‬ ‫מושקאט‬ ַ ( 1945 – 1948 ). An examination of the popularity of the Yiddish historical novel, a staple of the literary supplements in Yiddish newspapers, would undoubtedly highlight the centrality of I. J. Singer in the development of this genre and its subsequent re-conceptualization in Singer ’ s work. Moreover, I. J. Singer became a literary father ĳigure to his younger brother, enlisting him in the world of Yiddish letters in Warsaw 14 Isaac Bashevis Singer Papers, The Harry Ransom Center, University of Texas, ĳile 104 : 3. 194 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ( as proofreader of the highbrow journal ‫ליטערארישע בלעטער‬ ַ in 1923 ) and in New York ( as a contributor to ‫ ָארווערטס‬in 1935 ). I. J. Singer ’ s sudden death from a heart attack in 1944 at age ĳifty led gradually to the disappearance of Singer ’ s “ anxiety of influence ” with regard to his successful older brother.15 Singer, the obscure fabulist of dark tales from the already-forgotten past of Polish Jewry, might well have remained a footnote in the annals of Yiddish literature. Instead, he debuted as an American Jewish writer with The Family Moskat ( serialized in ‫ ָארווערטס‬from 1945 to 1948 and published in book form in Yiddish and English in 1950 ). Then in 1953, eight years after the story ’ s publication in Yiddish, Saul Bellow translated “ Gimpel the Fool. ” 16 “ Gimpel ” catapulted Singer into the mainstream of American letters at an auspicious time for Jewish literature in America.17 The clash between post1945 Yiddish culture ’ s turning its back on the goyish world and Singer ’ s quest to conquer it was articulated in the pages of the Yiddish literary journal ‫גאלדענע קייט‬ ָ ‫ די‬in 1950 – 1951. A contentious exchange took place about the viability and future of Yiddish literature between Der Lebediker ( “ one who is alive, ” a pseudonym of the Yiddish humorist Khayim Gutman, 1887 – 1961 ) and the Yiddish pedagogue Avrom Golomb. Der Lebediker ’ s article ‫ליטעראטור‬ ַ ‫הארץ אין דער ייִ דישער‬ ָ ‫למדן און עם ־‬ ( Scholar and Ignoramus in Yiddish Literature ) presented an iconoclastic attack on the utilitarian tendency in Yiddish literature that sought to further a particular ideological point of view. According to Der Lebediker, the greatest danger to the renewal of Yiddish literature was ‫ ( למדנות‬scholarship ), its attempt to replace aesthetic beauty and entertainment with the values of the seyfer, the holy book ’ s ethical and religious qualities. Der Lebediker characterized this literature as “ remaining stuck in its own un-artistic domain, which means Sabbath limit literature. ” 18 Rejecting this ‫ בעל ־ תּשו&ה‬tendency in Yiddish literature, Der Lebediker summed up his position : ‫דארף‬ ַ — !‫הארץ‬ ָ ‫צוריק צום עם ־‬ ‫ אונדזער שיינע‬.‫בלײבן ַאר פּובליציסטן און מאמריסטן‬ ַ ‫זאל למדנות‬ ָ .‫זײן אונדזער רוף‬ ַ . . . ! ‫מאל וועלטלעך‬ ָ ‫נאך ַא‬ ָ ‫ וועלטלעך און‬,‫זײן כּכל ־ הגוייִ מדיק‬ ַ ‫ליטעראטור מוז‬ ַ ( Back to ignorance ! – must be our credo. Let scholarship be for publicists and essayists. Our belles-lettres must be similar to non-Jewish literature, worldly and even more worldly. ) 19 15 See Norich 1991. 16 The story was published in Partisan Review, May/June 1953. First published as ‫„ גימפּל‬ “ ‫ תּם‬in 1945. 17 See Schwarz 2008. 18 ‫טײט „תּחום ־ שבת ־ לי־‬ ַ ‫בא‬ ַ ‫דאס‬ ָ ,‫בלײבן שטעקן אין אייגענעם ניט ־ קינסטלערישן תּחום‬ ַ ‫דאך‬ ָ ‫דאס מיינט‬ ָ „ Der Lebediker 1950 : 141. “. . .‫טעראטור‬ ַ 19 Ibid. : 142. Jan Schwarz : “ Nothing But a Bundle of Paper ” 195 In the following volume, Avrom Golomb responded in the article ( That Is Not the Way ), referring to Aḥad-Ha ‘ am ’ s call for a Jewish spiritual-cultural home in Palestine in the Hebrew journal ‫המליץ‬ in 1899 : 20 ‫לא זו הדרך‬ ‫ווארט‬ ָ ‫דאס‬ ָ ‫ איז‬,‫ גלייב איך‬,‫ַאר אונדז ַאלעמען‬ ,‫גאלדענע קייט ” ניט סתּם ַא שיינער אויסדרוק‬ ָ „ ‫גראם‬ ַ ‫פּרא‬ ָ ‫ ַא‬.‫גראם‬ ַ ‫פּרא‬ ָ ‫גאנצע‬ ַ ‫נאר עס איז ַא‬ ָ ‫ליטערא־‬ ַ ‫גראם אין דער‬ ַ ‫פּרא‬ ָ ‫אין לעבן און ַא‬ ‫ווארט‬ ָ ‫דאס‬ ָ .‫שא ונג‬ ַ ‫ אין אונדזער קולטור ־‬,‫טור‬ ‫ קולטור ־ המשך ָאן‬,‫ המשך‬:‫מיינט ַאר אונדז‬ . . . ‫דאס כּסדרדיקע און אייביקע‬ ָ ,‫איבעררײס‬ ַ ‫ווײטער ון‬ ַ ‫ווײטער און‬ ַ ” ‫„קיבל ־ תּורה ־ ומסורה‬ .‫דור צו דור‬ For all of us, I believe, the word “ the golden chain ” is not simply a beautiful expression, but a whole program of life and literature, our cultural creativity. The word means to us : continuity, cultural continuity without rupture, the constant and the eternal – receiving the Torah and the Tradition continuously from generation to generation. Obviously, Der Lebediker ’ s attack on Yiddish literature ’ s self-imposed ghettoization antagonized deeply held convictions in the Yiddish world of the day. According to Golomb, the Yiddish writer was to serve as a guardian of the flock, a national hero ; if Yiddish literature turned into di goyim ’ s literature, it meant betrayal : ‫ שטײען ַאר מיר‬,1950 ‫ אין‬,‫הײנט‬ ַ [...] ‫ און איך זע אין זײ אײן גרויסן‬,‫דאר ן זײ נעמען ַאר ַא מוסטער‬ ַ ‫וואס מיר‬ ָ ” ‫די „ כּל הגוייִ ם‬ [ . . . ] ‫דאנעק‬ ַ ‫מײ‬ ַ ( [ T ]oday, in 1950, the goyim on whom we model ourselves appear in front of me, and I see them as one huge Majdanek [ … ] ). ” 21 Der Lebediker ’ s position is unexceptional in its advocacy of the independence of aesthetic categories from extra-literary ends. However, ĳive years after the end of World War II, the Yiddish cultural world, having suffered a catastrophic blow in terms of the loss of Yiddish speakers and writers murdered in the Holocaust, was in a state of hyperactivity, traumatized and beleaguered. At that time, Singer was not only in search of God and Love – key words in the titles of the ĳirst two volumes of his memoirs Love and Exile ( 1976 – 1982 ). He was in search of a cultural arena outside the decimated remnants of survivors and the old guard of Yiddishist patriots in America, and would soon ĳind it in English. American Jewish intellectuals like Irving Howe and Philip Rahv were to a large extent removed from the Holocaust. They did not address its ramiĳications publicly in a sustained manner until the early 1960s, in the debate over Hannah Arendt ’ s New Yorker articles covering the Eichmann trial in Jerusalem.22 Singer ’ s fables and supernaturalism dressed in post-modern garb were an exotic reminder of the Jewishness 20 Golomb 1951 : 192. 21 Ibid. : 195. 22 See Howe 1982 : 269 – 275 and Norich 2007. 196 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ these intellectuals had abandoned in their quest to become fully Americanized. Backed by the cultural prestige of the New York intellectuals, Singer reached the wider American cultural world through English versions of his work. In return, Singer guided some of them back to the “ world of their fathers. ” 23 Until “ Gimpel the Fool ” appeared in Partisan Review in 1953, Singer was virtually unknown outside the Yiddish world. At almost ĳifty, Singer had contributed a few original stories and novels, securing him steady employment at ‫ ָארווערטס‬. He had barely made a name for himself as a Yiddish writer and was primarily known as the younger brother of the late I. J. Singer. His meteoric rise to literary fame in America was partly due to his artistic versatility, which he had established during his decade-long apprenticeship as a professional Yiddish writer in Warsaw between 1925 and 1935. During the ĳirst decade of his literary career, Singer published literary criticism, short stories, novels, and life writing, and translated into Yiddish 11 books by writers such as Knut Hamsun, Thomas Mann, and Stefan Zweig. His four-volume translation of Mann ’ s The Magic Mountain ( 1929 – 1930 ) was praised as a major contribution to Yiddish letters.24 Singer ’ s work as translator has yet to be systematically analyzed. It is particularly important to investigate how his Yiddish translations provided him with the tools that he would utilize after 1950 to transform his Yiddish work into American English. Singer replicated this diversiĳication in the different context of American culture post-1945. He published bread-and-butter journalism, middlebrow novels and life writing in ‫ ָארווערטס‬under the pseudonyms Varshavski and Segal, promoted and participated in translating his work into English, and, beginning in the 1960s, became an extremely popular performer, lecturer and interviewee.25 Singer ’ s best work was published in Yiddish journals and newspapers under the name Yitskhok Bashevis. His proliĳic output as writer and cultural ĳigure enabled Singer to achieve ĳinancial security for the ĳirst time in his career. He pursued his literary career with a single-minded business zeal, insuring that his literary stock went up by promoting his works at public performances all over America and publishing proliĳically in English. Singer maintained his artistic independence after 1945, when many Yiddish writers were reclaiming literature as a means to extra-literary ends, lamenting and commemorating what had been lost. Even in the novel Enemies : A Love Story ( 1966 ) and the short story “ The Cafeteria ” 23 The title of Irving Howe ’ s 1976 book about Jewish life in New York. 24 Mann 1929 – 1930. 25 For a selection of Singer ’ s proliĳic output as an interviewee, see Farrell 1992. Jan Schwarz : “ Nothing But a Bundle of Paper ” 197 ( 1969 ),26 the Holocaust served merely as a backdrop for his grand comedy of human passions and beliefs. Singer clung to the independence of literature from any political, social and cultural ideology. In a 1955 article, the Yiddish critic Shmuel Niger pointed out the danger of political correctness for a living and breathing Yiddish literature, echoing Der Lebediker ’ s position in ‫גאלדענע קייט‬ ָ ‫ די‬: 27 ‫באלד‬ ַ ‫וואס איז בעת און‬ ָ ,‫ליטעראטור‬ ַ ‫אונדזער‬ ‫טאקליזם געווען עפּעס ַא‬ ַ ‫קא‬ ַ ‫יארן ון‬ ָ ‫נאך די‬ ָ ‫ הייבט‬,( ‫לאס‬ ָ ‫סא‬ ָ ‫כאר מיט‬ ָ ‫ ַא‬,‫כאר ) אמת‬ ָ ‫מין‬ ,‫ביסלעכווײז ָאן צו קומען צו זיך און צוריק ווערן‬ ַ ‫זײן — ַא וועלט ניט ון‬ ַ ‫דארף‬ ַ ‫ליטעראטור‬ ַ ‫וואס ַא‬ ָ ,‫לויטער ציבור און אויך ניט ון שליחי ־ ציבור‬ ‫וואס‬ ָ ,‫נאר ון ָאריגינעל ־ שע ערישע יחידים‬ ָ ‫ווײטער און הייבן זיך אויף‬ ַ ‫ קוקן‬,‫גראבן טי ער‬ ָ ‫זײנע מינהגים און‬ ַ ‫העכער ונעם קהל און‬ .‫מנהיגים‬ [ O ]ur literature which, during and after the cataclysm, became a chorus [ in truth, a chorus with solos ], is slowly recovering and returning to what a literature ought to be – not only a world of community and cantors, but original creative individuals who dig deeper, see further and lift themselves higher than the community with its customs and leaders. The critical consensus has long been that the three volumes of Singer ’ s short ĳiction published in Yiddish newspapers and journals (‫צוקונ ט‬, ‫גאלדענע קייט‬ ָ ‫די‬, ‫ ס&י&ה‬and ‫ ) ָארווערטס‬are his most important contribution to Yiddish letters. The twelve collections of short stories published in English translation, beginning with Gimpel the Fool and Other Stories ( 1957 ) and ending with The Death of Methuselah and Other Stories ( 1988 ), established this body of work as the Essential Singer for a worldwide readership. The three-volume Library of America edition of his short stories in English translation, published in honor of Singer ’ s centennial in 2004, is the most recent addition to the canonization of Singer as an American writer.28 The indisputable fact remains that Singer is a universally acclaimed writer due to his prominence and visibility in English. This does not detract from his mastery of the Yiddish artistic word, or challenge his place as the last great heir to the Yiddish storytelling tradition beginning with Nachman of Bratslav and I. L. Peretz. Any serious critical engagement with Singer ’ s work must begin with the original Yiddish stories while acknowledging that, because of their narrative and stylistic 26 Yitskhok Bashevis, ‫קא עטעריע‬ ַ ‫ די‬in ‫ ( די צוקונ ט‬March – April 1968 ) and included in the collection ‫ ( מעשׂיות ון הינטערן אויוון‬Singer 1982a : 43 – 71 ; English translation by I. B. Singer and Dorothea Straus in Singer 1982 b : 287 – 300 ). 27 Niger 1955 – 1956 : 8. 28 Singer 2004. 198 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ simplicity, “ the spell of Singer ” is eminently translatable.29 Attempts by critics to view Singer ’ s relationship with other post-1945 Yiddish writers in terms of Cynthia Ozick ’ s influential story “ Envy ; or, Yiddish in America ” ( 1969 ) have tended to overstate Singer ’ s difference from other Yiddish writers. In crucial ways, Singer was a remarkably normative Yiddish writer in the post-Holocaust period. His work would have been unthinkable without the classical Yiddish writers as a sounding board against which Singer could develop his iconoclastic philosophy of protest, sabotaging sacrosanct notions of humanism and modernism. As is the work of Chaim Grade, Leib Rochman, Chava Rosenfarb and Eli Schechtman, the ĳinest Yiddish prose writers of his generation, Singer ’ s ĳiction is set in a particular part of Central and Eastern Europe – in his case, the small shtetlekh of the Lublin region : Yanov, Frampol, Tishevitz, Goray, Kreshev, Yosefov.30 As Wolitz and Sherman write : “ In his short stories, Bashevis Singer remarkably shows himself as a regionalist in the truest, fullest sense, a writer of genius who, with precision and meticulous care, uses the particular as his chief and best means of reaching the universal. ”31 Singer ’ s urban locus is Krochmalna Street, the poor section of Jewish Warsaw where his father, a ‫ ( מורה ־ הוראה‬rabbi authorized to answer ritual questions ), conducted his rabbinical court ( ‫ ) בית ־ דין ־ שטוב‬prior to World War I, as depicted in the memoir ‫טאטנס בית ־ דין ־ שטוב‬ ַ ‫מײן‬ ַ ( My Father ’ s Court ).32 In family chronicles such as the The Family Moskat ( 1950 ) and The Manor ( 1967 ), Singer recreated the narrative sweep of multiple generations of Polish Jews prior to the catastrophe. Beginning in the late 1950s, Singer began writing novels and short stories about Jewish life in America such as Shadows on the Hudson ( 1957 – 1958 ), Enemies : A Love Story ( 1966 ), and semi-autobiographical short stories.33 Singer ’ s America serves as a screen on which he projects existential crises and internal struggles that originated in Jewish Poland. Even in the most American of his novels, Shadows on the Hudson, in which the protagonist Hertz Dovid Grein travels to Miami and upstate New York, Singer depicts these locations mostly through the suffocating world of the Holocaust survivors that Grein runs into in cafeterias and hotels : The wider America with which Grein came into contact was just as complicated as he was himself. He would never understand it prop29 30 31 32 33 See Miron 1992 and Bloom 2010. Janów, Frampol, Tyszowce, Goraj, Krzeszów, Józefów. Wolitz and Sherman 2001 : 224. For a close reading of this work see Schwarz 2005 : 142 – 152. For a close reading of “ The Cafeteria ” see Schwarz 2001. Jan Schwarz : “ Nothing But a Bundle of Paper ” 199 erly. American remained for him the one country in the world where people walked with their heads held high, yet he could see that behind all individual differences the eternal human tragedy remained constant.34 Singer ’ s literary career as a Jewish American writer embodied continuous change and productivity that would open up “ a new vein in his work, and really a different style. ” 35 Singer ’ s late style is characterized by a greater freedom in addressing survivor guilt, suicidal behavior, and his characters ’ lack of agency. However, even Singer ’ s usual disregard for literary decorum had its limits when it came to allowing the publication of Shadows on the Hudson in English translation. In this novel he “ lets it all hang out ” in an almost exhibitionist exposure of survivors ’ nihilism, promiscuity and self-destruction. Singer forbad the publication of this work in English translation until after his death ; it appeared forty years later, in 1998, in a translation by Joseph Sherman.36 The reception of the posthumously published novel is indicative of the contradictory critical responses to Singer ’ s work in English. In The New York Times, the reviewer applauded the work as revealing “ Singer speaking in an unfamiliar raw and brutal voice, the grandfatherly Yiddish writer stripped of the kindly, gentle tone and the flights of the supernatural fantasy that we mostly know him by. ” 37 The novel is given the highest marks as “ a startling, piercing work of ĳiction, a book with a strong claim to being Singer ’ s masterpiece. ” 38 In another review in The New York Times, the novel is torn to shreds as “ chaotic, rambling, repetitive and parochial, ” so unlike Singer ’ s short stories that, “ at their best, are like hard diamonds of perfection. ” The reviewer perceptively points to the novel having been written “ on demand and for a very speciĳic audience with very speciĳic intellectual and emotional needs. ” 39 The Montreal Yiddish poet and ĳiction writer Chava Rosenfarb agreed with The New York Times reviewer ’ s negative assessment that “ Bashevis ’ s work which was ĳirst published in ‫ ָארווערטס‬was usually shabby and chaotic. Only when they were published in the English version did they achieve their true artistic form. ” 40 Singer never oversaw the editing of the English version of Shadows on the Hudson, which was translated more or 34 Singer 1998 : 198. 35 Dickstein et al. 2004 : 118. 36 See Joseph Sherman ’ s article about his conflicts with the publisher Farrar Straus Giroux about how to translate Singer into English, Sherman 2002. 37 Bernstein 1997. 38 Siegel 1998. 39 Ibid. 40 Rosenfarb 1992 : 76. 200 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ less directly from the serialized version. As a result, the novel allows us to enter the uncensored world of Singer ’ s serialized novels in ‫ָארווערטס‬ with a minimum of the edits and touchups that usually improved his novels in English. Hertz Dovid Grein, like most of the characters in the novel, arrived in America one or two decades before the Holocaust ; a few, such as Anna, have escaped war-torn Europe under dramatic circumstances. Like the protagonist of Enemies : A Love Story, which is a more artistically fulĳilled version of the same theme, Grein ĳinds himself entangled with three women at the same time : his loyal wife, his long-time lover and his most recent infatuation, Boris Makover ’ s daughter, Anna. Its main characters drift aimlessly, sexually and professionally, outwardly successful in America but inwardly suffering desperately over their loss of family, career, and home in the Holocaust. Their pursuit of happiness in America remains unfulĳilled, trapping them in serial relationships and get-rich-quick schemes. In a few cases, they seek out the certainty of clear-cut solutions to their predicament in Orthodox Judaism ( Boris Makover and Grein ) and spiritualism ( Dr. Margolin ). The novel succeeds in delineating the plight of the ‫שארית ־ הפּליטה‬, the traumatized remnants of the Holocaust exiled from their Ashkenazi Jewish homelands, languages and landscapes in crass, materialistic, intellectually superĳicial America. Less successful is the novel ’ s character development, which – as is often the case in Singer ’ s work – tends to devolve into caricature. Singer ’ s particular talent lies in uncovering the deep archetypical battles between Good and Evil, the basic existential choices of modern Jews, rather than in elaborating upon the subtle aspects of their social and psychological conditioning.41 In many ways, Singer is a typical representative of the Yiddish writers exiled from Jewish Eastern Europe, refugees before or after the conflagration who lived out their remaining days writing and publishing proliĳically in places like New York, Buenos Aires, Montreal, and Tel Aviv. Like the Yiddish writers Chaim Grade and Aaron Zeitlin, his survivor guilt at not having had “ the privilege of going through the Hitler Holocaust ” suffused his work and sharpened his deliberate exposition of desperate nihilism and self-destructive tendencies.42 And like other post-1945 Yiddish writers, his enormous output on the staff of a Yiddish newspaper, continued productivity and embrace of new genres until a ripe old age reflected his work ’ s life-afĳirming character.43 41 Rosenfarb 1992 : 104. 42 The Yiddish and Hebrew poet Aaron Zeitlin displayed a similar self-deprecating, selfdestructive view in his post-Holocaust poetry. See Zeitlin 2007. The quote is from Singer ’ s author ’ s note in Enemies : A Love Story ; Singer 1966 ( no pagination ). 43 ‫דאס‬ ָ ‫ ַאז‬,‫קלאר‬ ָ ‫ ַאז עס מוז ווערן‬,‫פּאסיע‬ ַ ‫זא‬ ַ ‫ און מיט ַא‬,‫נעגאטיווקייט‬ ַ ‫זײן‬ ַ ‫מאל‬ ָ ‫טאנט ַאזוי יל‬ ָ ‫בא‬ ַ ‫ער‬ Jan Schwarz : “ Nothing But a Bundle of Paper ” 201 Singer ’ s work is intrinsically woven into the web of Yiddish cultural politics, personal relationships, various newspapers and journals from rekhte to linke ( politically right and left ) in which the shrinking group of Yiddish writers and ‫ ( קולטור ־ טוערס‬cultural activists ) fought each other in the uphill battle against assimilation and oblivion. American letters in the postwar period, which provided a fertile ground for young Jewish writers, enabled Singer to break out of the increasingly ghetto-like character of Yiddish in New York to become a major player on the American literary stage. The post-9 / 11 era has actualized aspects of Singer ’ s work that highlight moral issues ( e.g., ‘ the axis of evil ’ ), nihilism, and the threat of religious and political fundamentalism. The celebration of his centennial in 2004 and the jubilee edition of his short stories by the Library of America – Singer is the only Yiddish writer to be so honored – indicate that his literary star is unlikely to dim any time soon. The 1967 story “ My Adventures as an Idealist ” 44 is vintage Singer in its bittersweet self-portrait of the artist as middle-aged man exiled between languages and cultures. The mysterious Sigmund Seltzer, the narrator ’ s sparkling alter ego, has commissioned the narrator to translate his ghostwritten autobiography from German into Yiddish. Like Singer, the narrator has translated Thomas Mann ’ s The Magic Mountain into Yiddish. The narrator continues to expand the work into a work of ĳiction with autobiographical traits that he is unable to complete ( like Singer himself was unable to complete his own autobiography ). The meaning of Seltzer ’ s life becomes tied to his quest to get his ghostwritten autobiography published. Visiting the dying Seltzer in the hospital, the narrator closes the story with this prescient observation about literary posterity : 45 Our eyes met in silence. His hair had become white and sparse, his forehead higher. An expression of gentleness and wisdom I had never seen before shone in his eyes. He half winked, half smiled, as if to say, I know everything that you know, and a little more in addition. He was no longer the Sigmund Seltzer I had known all these years, but a sage ‫זײן‬ ַ ‫געדאר ט‬ ַ ‫וואלט ער‬ ָ ,‫וואלט ער באמת קיין שום ליכט נישט געזוכט‬ ָ ‫ און‬.‫ַארקערטע איז דער אמת‬ ‫ווײל יעדע ָארעם ון‬ ַ ,‫שרײבן‬ ַ ‫ בכלל אוי הערן צו‬,‫זעלבסטמארד‬ ָ ‫ליטערארישן‬ ַ ‫באגיין‬ ַ ‫קאנסעקווענט און‬ ָ ‫יא צום לעבן און צום‬ ָ ‫זאגן‬ ָ ‫ איז אין זיך ַאליין ַא ָארעם ון‬,‫זײן‬ ַ ‫זאל נישט‬ ָ ‫ ווי ייִ אושדיק זי‬,‫שע ערישקייט‬ .‫ ( מענטש‬He emphasizes many times his negativity, and with such passion, that it becomes clear that the opposite is the case. And if he had not sought any light he would have been consistent and committed literary suicide, stopped writing, because every form of creativity regardless of its despair is in itself a way of saying yes to life and to man. ) Rosenfarb 1992 : 102. 44 Singer 2004 ( 3 ) : 745 – 758. First published in The Saturday Evening Post, November 18, 1967. 45 Singer 2004 ( 3 ) 758. 202 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ puriĳied by suffering. He stared at me with a look of fatherly affection and murmured, “ In the end what remains after us writers ? Nothing but a bundle of paper. ” The story was originally published in Yiddish as ‫ ( דער מחבר‬The Author ) in ‫ ָארווערטס‬in 1965, and did not appear subsequently in any short story collection. This was probably due to the cartoonlike lack of character development with which it demolishes the myth of the Author and his Original Creation. Like Selzer ’ s autobiography, which is pieced together by ghostwriters and translators, Singer ’ s English oeuvre, which lifted him out of obscurity in America, was the result of an auspicious collaboration of publishers, translators and editors.46 Ever the professional writer and son of a Hasidic rebbe in Warsaw, Singer did not harbor any illusions about the Yiddish word ’ s longevity after its severance from Hebrew Scriptures and religious law ( ‫ ) הלכה‬as a result of the rise of the ‫ ( השׂכּלה‬Jewish Enlightenment ) in nineteenth-century Eastern Europe. In an article in ‫זשורנאל‬ ַ ‫לגעמײנער‬ ַ ‫ ַא‬in 2006, Rabbi William Berkowitz, a close friend of Singer, told how his son had approached the writer and asked him to inscribe the book ‫ שבחי הר ” ן‬, a Hebrew volume in praise of Nachman of Bratslav : 47 When Singer took the book his hands were trembling. “ I don ’ t know, ” he said, “ I ’m not worthy of inscribing anything in this book. ” My son insisted and he wrote This book was written by a great human being. There never has been nor is there anyone like him. Singer had internalized the distinction between what was traditionally viewed by his Hasidic father as a ‫ ( ס ר‬a holy book in Hebrew ), and his own work, ‫ ( די ייִ דישע ביכלעך‬Jewish / Yiddish secular books ). Singer closed the Yiddish literary canon in the second half of the twentieth century while devising a life-raft for his work in English translation. He created a new readership for his work in America without cutting his umbilical cord to ‫ ָארווערטס‬and its readership. Traces of Singer ’ s Old-World storytelling, supernaturalism, nihilism, and depiction of the ‫ שארית ־ הפּליטה‬are evident in the work of Jewish American writers like Saul Bellow, Bernard Malamud, Cynthia Ozick, Steve Stern, Jonathan Safran Foer, Nicole Krauss, Dara Horn and Jeremy Rothenberg, among others.48 His work remains a vital bridge between the last flowering of Yiddish literature after the Holocaust and the rise of a new Jewish literary center in North America. 46 Stavans 2004 : 63 f. 47 Berkowitz 2006. 48 See Ozick ’ s, Foer ’ s, and Rothenberg ’ s appreciations of Singer in Stavans 2004. Jan Schwarz : “ Nothing But a Bundle of Paper ” 203 Bibliography Berkowitz, William, 2006 : “ You ’re Isaac Bashevis Singer ? ” To the 15th Yartzeit of One of Our Greatest Yiddish Writers, Who Died On July 24, 1991. ” In : Algemeyner zhurnal, July 20. Bernstein, Richard, 1997 : “ Shadows on the Hudson : Dark Side of Isaac Bashevis Singer. ” In : The New York Times, December 31. Bloom, Harold, 2010 : “ Revisiting Isaac Bashevis Singer. ” In : The New York Review of Books, October 28, 2010 : 45. Cohen, Nathan, 2002 : “ Yitskhok Bashevis-Zinger and the Writers ’ and Journalists ’ Association in Warsaw. ” In : Hugh Denman, ed., Isaac Bashevis Singer : His Work and His World. Leiden : Brill : 169 – 181. Cohen, Nathan, 2003 : Sefer, sōfēr wě- ‘ ittōn : Merkaz ha-tarbūt ha-yěhūdīt bě-Waršāh, 1918 – 1942. Jerusalem : Magnes Press. Dickstein, Morris, Rosen, Jonathan, Roskies, David, Sheffer, Isaiah and Stavans, Ilan, 2004 : “ The Achievement of Isaac Bashevis Singer : A Roundtable Discussion. ” In : Ilan Stavans, ed., Isaac Bashevis Singer : An Album. New York : The Library of America. Farrell, Grace, ed., 1992 : Isaac Bashevis Singer : Conversations. Jackson : University of Mississippi Press. Fishman, David E., 2005 : The Rise of Modern Yiddish Culture. Pittsburgh : University of Pittsburg Press. Golomb, Avrom, 1951 : “ Loy zu haderekh. ” In : Di goldene keyt 7 : 192 – 197. Howe, Irving, 1976 : World of Our Fathers : The Journey of the East European Jews to America and the Life They Found and Made. New York : Harcourt Brace Jovanovich. – 1982 : A Margin of Hope : An Intellectual Autobiography. New York : Mariner Books. – Wisse, Ruth R., and Shmeruk, Chone, eds., 1987 : The Penguin Book of Modern Yiddish Verse. New York : Viking. Lebediker, Der ( Khayim Gutman ), 1950 : “ Lamdn un amorets in der yiddisher literatur. ” In : Di goldene keyt 6 : 138 – 142. Lisek, Joana, 2007 : “ Chaim Grade. ” In : Joseph Sherman, ed., Writers in Yiddish. ( Dictionary of Literary Biography 333 : Yiddish Literature ). Detroit : Thomson Gale, 74 – 82. Mann, Thomas, 1929 – 1930 : Der tsoyberbarg. Transl. Isaac Bashevis Singer. Vilna : Kletskin. Miller, David Neal, 1979 : A Bibliography of Isaac Bashevis Singer, January 1950 – June 1952. New York : yivo Institute for Jewish Research. – 1983 : Bibliography of Isaac Bashevis Singer, 1924 – 1959. New York : Peter Lang. 204 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ – 1991 : “ Bibliography as Ideology. ” In : Yiddish 8 ( 1 ) : 63 – 74. Miron, Dan, 1992 : “ Passivity and Narration : The Spell of Bashevis Singer. ” In : Judaism 1 : 6 – 17. Niger, Shmuel, 1955 – 1956 : “ Tendentsn in der nayster yidisher literatur. ” In : Jewish Book Annual 13 : 3 – 8. Norich, Anita, 1991 : The Homeless Imagination in the Fiction of Israel Joshua Singer. Bloomington : Indiana University Press. – 2007 : Discovering Exile : Yiddish and Jewish American Culture During the Holocaust. Stanford : Stanford University Press. Rosenfarb, Chava, 1992 : “ Yitskhok Bashevis un Sholem Ash ( a pruv fun a farglaykh ). ” In : Di goldene keyt 133 : 75 – 104. Saltzman, Roberta, 2002 : Isaac Bashevis Singer : A Bibliography of His Works in Yiddish and English, 1960 – 1991. Maryland : Scarecrow Press. Scholem, Gerschom, 1971 : The Messianic Idea in Judaism. New York : Schocken. – 1973 : Sabbatai Ṣevi : The Mystical Messiah. Princeton : Princeton University Press. – 1974 : Major Trends in Jewish Mysticism. New York : Schocken. Schwarz, Jan, 2001 : “ ‘ Death Is the Only Messiah ’ : Three Supernatural Stories by Yitskhok Bashevis. ” In : Seth L. Wolitz, ed., 2001 : The Hidden Isaac Bashevis Singer. Austin : University of Texas Press : 107 – 118. – 2005 : Imagining Lives : Autobiographical Fiction of Yiddish Writers. Madison : University of Wisconsin Press. – 2008 : “ 1953 / 1954 – A Year in Yiddish Literature. ” In : Ezra Mendelsohn, ed., Studies in Contemporary Jewry 23 – Jews and the Sporting Life : 185 – 201. Sherman, Joseph, 2007 a : “ Translating ‘ Shotns baym hodson ’ [ Shadows on the Hudson ] : Directly Encountering Isaac Bashevis Singer ’ s Authorial Dualism. ” In : Hugh Denman, ed., Isaac Bashevis Singer : His Work and His World. Leiden : Brill : 49 – 80. – 2007 b : “ Isaac Bashevis Singer. ” In : Joseph Sherman, ed., Writers in Yiddish. ( Dictionary of Literary Biography 333 : Yiddish Literature ). Detroit : Thomson Gale, 278 – 289. Shmeruk, Chone, 1981 – 1982 : “ Bashevis Singer – In Search of his Autobiography. ” In : Jewish Quarterly 29 ( 4 [ 108 ] ) : 28 – 36. Siegel, Lee, 1998 : “ West Side Story. ” In : The New York Times, January 25. Singer, Isaac Bashevis, 1943 : Der sotn in Goray. A mayse fun fartsaytns un andere dertseylungen. New York : Farlag Matones. – 1945 : “ Gimpl tam. ” In : Yidisher kemfer 24 ( March 30 ) : 17 – 20. – 1953 : “ Gimpel the Fool. ” In : Partisan Review 20 ( May – June ) : 300 – 313. – 1966 : Enemies : A Love Story. New York : Farrar Straus and Giroux. Jan Schwarz : “ Nothing But a Bundle of Paper ” 205 – 1982 a : Mayses fun hintern oyvn. Tel Aviv : Farlag Y. L. Perets. – 1982 b : Collected Stories. New York : Farrar, Straus, Giroux. – 1984 : Love and Exile : An Autobiographical Trilogy. New York : Farrar, Straus and Giroux. – 1998 : Shadows on the Hudson. Transl. Joseph Sherman. New York : Farrar, Straus and Giroux. – 2004 : Collected Stories. 3 vols. Ed. Ilan Stavans. New York : The Library of America. Stavans, Ilan, ed., 2004 : Isaac Bashevis Singer : An Album. New York : The Library of America. Szeintuch, Yekhiel, ed., 2000 : Bi-rěšūt hā-rabbīm u-vi-rěšūt ha-yāḥīd. Jerusalem : Magnes Press. Trunk, Yekhiel Yeshaye, and Zeitlin, Aaron, eds., 1946 : Antologye fun der yidisher proze in Poyln tsvishn beyde velt milkhomes ( 1914 – 1939 ). New York : tsiko. Wolitz, Seth L., ed., 2001 : The Hidden Isaac Bashevis Singer. Austin : University of Texas Press. – and Sherman, Joseph, 2001 : “ Bashevis Singer as a Regionalist of Lublin Province. ” In : Seth L. Wolitz, ed., 2001 : The Hidden Isaac Bashevis Singer. Austin : University of Texas Press, 219-226. Yungman, Moshe, 1985 : “ Singer ’ s Polish Period : 1924 to 1935. ” In : Yiddish 6 ( 2 – 3 ) : 25 – 38. Zeitlin, Aaron, 2007 : Poems of the Holocaust and Poems of Faith. Ed. and transl. Morris M. Faierstein. New York : Universe. Zeitlin, Elkhonen, 1946 : In a literarisher shtub. Buenos Aires : Tsentralfarband far poylishe yidn in Argentine. Sabine Koller Mentshelekh un stsenes Rahel Szalit-Marcus illustriert Sholem Aleichem Marc Chagall träumte davon, die jiddischen Klassiker zu illustrieren. Von Yitskhok Leybush Peretz abgesehen, ging dieser Wunsch für ihn nicht in Erfüllung.1 Chagalls Illustrationen zu Sholem Aleichem bleiben ein Stück ungemalter Kunstgeschichte, so groß die Afĳinität zwischen dem Maler, der die jiddische Sprache › sah ‹, und dem Autor, der eine unerreicht bildkräftige Fiktion schuf, auch gewesen sein mochte.2 Dem jiddischen Literaturkritiker Bal-Makhshoves ( Yisroel Eliashev / Izidor Ėlijašev ; 1873 – 1924 ) beispielsweise erscheinen Sholem Aleichems Figuren einem “ ‫ווײס‬ ַ ‫שווארץ ־‬ ַ ‫לבאם ון ַא צייכנער אין‬ ָ ‫ ( „ ַא‬Heft eines Zeichners ) entsprungen, ersonnen und erschaffen ‫שארן‬ ַ ‫„ ון ַא‬ “ ‫ ( קינסטלעראויג‬von einem scharfen Künstlerauge ).3 Als Bal-Makhshoves dies schrieb, konnte er nicht ahnen, dass so begnadete Künstler wie Yosl Bergner ( geb. 1920 ), Ben Shahn ( 1898 – 1969 ) oder Anatolij Kaplan ( 1902 – 1980 ) meisterlich minimalistisch oder üppig ornamentiert den großen Autor illustrieren würden. Ob Sholem Aleichems Kasrilevker Einfaltspinsel, der Geiger Stempenyu oder die Ziege aus ‫דער‬ ‫שנײדער‬ ַ ‫ארכּישוטער‬ ַ ( Der verzauberte Schneider, 1900 ) – sie alle haben den Weg ins Bild gefunden. Den Anlass zu Bal-Makhshoves ’ Überlegungen jedoch gaben die Gravuren einer Künstlerin, von der wir leider allzu wenig wissen : Rahel Szalit-Marcus. Wer ist diese Frau ? 1 Vgl. Chagalls Brief an Yoysef Opatoshu vom 24. Januar 1934 ( yivo, reg. 436, folder 249 ; in englischer Übersetzung in Harshav 2004 : 434 ). Chagall fertigt zwischen 1915 und 1916 drei Illustrationen zu Peretz ’ Erzählung ‫מאכער‬ ַ ‫ ( דער קונצן ־‬Der Zauberkünstler / Der Taschenspieler ) an ( Harshav 2003 : 213 ). 2 S. hierzu Kenig 1931 : 27 – 31. Die Übersetzungen im Text stammen, soweit nicht anders angegeben, von mir. 3 Bal-Makhshoves in der Einleitung zu : ‫ זעכצן צײכענונגען צו‬: ‫מענטשעלעך און סצענעס‬ ‫מאטל פּײסי דעם חזנס ִײנגל‬ ָ ‫ ( שלום ־ עליכמס ווערק‬Menschen und Szenen : Sechzehn Zeichnungen zu Sholem Aleichems Werk Motl Peyse dem khazns [ Motl, Sohn des Kantors Peyse ], Bal-Makhshoves 1922 : o. S. ). Der Text ist leicht verändert in Fenster ( 1951 : 234 f ) abgedruckt. 208 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬# ‫לקט‬ 1. Rahel Szalit-Marcus : Biobibliographische Skizze ‫האב איך זײ ַאלעמען געקענט ? צי בין איך‬ ָ ‫צי‬ ‫האב איך געזען‬ ָ ‫ [ אין זײער ַאטעליע ? צי‬/ ] ‫געווען‬ ? ‫ווײטן‬ ַ ‫נאענט צי ון‬ ָ ‫ [ ון‬/ ] ‫זײער קונסט‬ Kannte ich sie denn alle ? War ich in ihren Ateliers ? Sah ich ihre Kunst von nahe oder fern ? Mit diesen Zeilen beginnt Marc Chagall das Widmungsgedicht ‫אר די‬ ַ 4 ‫ ( קינסטלער ־ קדושים‬Für die Märtyrerkünstler, 1950 ). Er steuert es einem 1951 von Hersh Fenster herausgegebenen Gedenkband bei : ‫אונדזערע‬ ‫רפּײניקטע קינסטלער‬ ַ ‫א‬ ַ ( Unsere zu Tode gequälten Künstler ) erinnert an 84 jüdische, in Frankreich lebende jüdische Künstler, die während der Nazidiktatur ums Leben kommen, darunter so bekannte Namen wie Chaïm Soutine, Moyshe Kogan, Henri ( Henryk ) Epstein oder Marcel Slodki ( Marceli Słodki ). Auf Seite 231 blickt den Leser auf einer grobkörnigen, wenig konturierten Photographie Rahel Szalit-Marcus an. Wer waren ihre Lehrer, wer ihre Vorbilder ? Wie sahen ihre Skizzenbücher aus, wie ihre Studien zu größeren Werken ? Wo sind ihre Ölbilder, Aquarelle, Gouachen ? Rahel Szalit-Marcus, geboren 1892 in Chjenty ( eine ältere Quelle nennt Telsze ) im einstigen Zarengouvernement Kovno, ist in ihrem Herkunftsland Polen, in Deutschland und in ihrer späteren Wahlheimat Frankreich kaum bekannt.5 Außer überblicksartigen Erwähnungen ĳindet die Künstlerin selten Erwähnung.6 Rahel Szalit-Marcus ’ kunstsinniger Vater fördert ihr Talent in Lódź. Im › polnischen Manchester ‹, erlebt sie nach der Revolution von 1905 die antizaristische, pro-polnisch-romantische Aufbruchsstimmung der dortigen Jugend mit, der ‫לײט‬ ַ ‫ ַאחדות ־‬, also Mitgliedern der Vereinigten Jüdischen Arbeiterpartei ( Hitachadut ).7 Nach ersten malerischen Fingerübungen besucht die begabte junge Frau ab 1911 die Münchner Akademie der Künste und 4 Marc Chagall, ‫אר די קינסטלער ־ קדושים‬ ַ ( Für die Märtyrerkünstler ), 1951 : o. S. 5 Der von Sylvie Buisson herausgegebene Ausstellungskatalog Montparnasse déporté. Artisti Europei da Parigi ai Lager nennt Chjenty als Geburtsort und 1892 als Geburtsjahr ( Buisson 2007 : 130 ; s. auch Malinowski 2007 : 118 ), Hersh Fenster Telsze und 1894 ( 1951 : 231 ) ; einige Internetquellen geben das litauische Ischgenty an ( http ://www.artfact.com/auctionlot/szalit-marcus,-rahel-1896-ischgenty-litauen-kz-1-c-wvryhsbdfu ; 3.3.2012. Die detaillierteste biographische Darstellung ĳindet sich in Fenster 1951 : 231 – 232 ; vgl. auch http ://www. jewishvirtuallibrary.org/jsource/judaica/ejud_0002_0019_0_19446.html ; 11.3.2012. Einen wichtigen Beitrag zur Wiederentdeckung der Künstlerin und ihrer jüdischen Schaffensund Leidensgenossen leistete die erfolgreiche Ausstellung Montparnasse déporté, die 2005 im Museum Montparnasse und anschließend 2006 in Yad Vashem gezeigt wurde ; s. Buisson 2007 und Süssmann 2006. 6 Vgl. auch Sennewitz 1999 : 225. 7 Fenster 1951 : 231. Sabine Koller : Mentshlekh un stsenes 209 wird Teil einer kleinen polnisch-jüdischen Künstlerkolonie. Wie ihre Kollegen Henryk ( Chaim ) Epstein oder der eben erwähnte Marcel Slodki, dem sie auch später in Paris freundschaftlich verbunden sein wird, kommt sie in München erstmalig mit dem Expressionismus in Berührung.8 Die Trennung von ihrem Mann, dem deutsch-jüdischen Schauspieler Julius Szalit, und dessen Selbstmord im Jahre 1916 hinterlassen in Rahel Szalit-Marcus tiefe Wunden, die nie ganz heilen werden. Noch im selben Jahr siedelt die Künstlerin nach Berlin über. Hier in Berlin, Drehscheibe zwischen Ost und West und Umschlagplatz fulminanter avantgardistischer Ideen, erlebt die ostjüdische Kulturrenaissance ihre letzte große Blüte. Als sich nach der Russischen Revolution und in den Wirren des Russischen Bürgerkrieges ein wahrer Exodus russisch-jüdischer Emigranten nach Berlin ergießt, kommt Rahel Szalit-Marcus mit talentierten Vertretern und glühenden Verfechtern der jiddischen Literatur in Berührung : Nach Berlin verschlägt es literarische Größen wie Dovid Bergelson, Leyb Kvitko, Der Nister, Uri Tsvi Grinberg oder Moyshe Kulbak ; in ‫ ִעיר וְ ֵאם ְּביִ ְשׂ ָר ֵאל‬, der › Stadt und Mutter in Israel ‹ ( 2 Sam 20 : 19 ),9 stehen Chaim Nachman Bialik und S.Y. Agnon an der Spitze der modernen hebräischen Kultur. Am » Ostbahnhof Europas « ( Karl Schlögel ) wirken ostjüdische Künstler wie Marc Chagall, Yisokher Ber Rybak oder Henryk Berlewi. Neben El Lissitzky, Vladimir Majakovskij oder Else Lasker-Schüler frequentieren weniger bekannte jiddische Kulturaktivisten wie Elye Tsherikover, Jakob Lestschinsky oder Nokhem Shtif das legendäre, von der Berliner Bourgeoisie gefürchtete Romanische Café.10 Auch Rahel Szalit-Marcus ist hier häuĳig zu Gast. Sie schließt sich der Secession und – wie Yisokher Ber Rybak auch – der Novembergruppe an. Ähnlich wie Jakob Steinhardt, Jankel ( Jankiel ) Adler oder Joseph Budko, bewegt sich die Künstlerin zwischen west- und ostjüdischer Kultur, wie es für viele Juden während der Weimarer Republik typisch ist. Als Sujets bevorzugt sie Portraits, Blumensträuße und Stillleben ; sie malt aber auch impressionistisch angehauchte Berlinansichten, die das Stadtproletariat in den Blick nehmen. Und : Sie entdeckt die Gravur für sich. Damit ist der Weg in die jiddische Buchillustration geebnet.11 8 Ibid. 9 S. Marten-Finnis und Valencia 1999 : 103 – 120. 10 Vgl. hierzu die ironische Beschreibung des russisch-jüdischen Autors Il ’ ja Ėrenburg : » Solide Bürger blickten, wenn sie am Sonntag in die Gedächtniskirche gingen, erschrocken aufs Romanische Café ; ihnen war, als hätte sich vis-à-vis der Kirche der Generalstab der Weltrevolution niedergelassen « ( 1962 : 520 ). Zu Berlin als jiddischer Hochburg während der Weimarer Republik s. Estraikh 2006, Estraikh und Krutikov 2010, Dohrn und Pickhan 2010 und Stiftung Jüdisches Museum Berlin 2012. 11 Vgl. Schwarz 1920 : 74 – 77. 210 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬# ‫לקט‬ Nach der Machtübernahme der Nazis flieht Rahel Szalit-Marcus nach Frankreich. Wie andere ihrer polnisch-jüdischen Kollegen zählt sie zur so genannten École de Paris. Die stilistisch heterogene Pariser Schule ist weniger eine auf eine einheitliche ästhetische Linie eingeschworene Gruppe denn eine geistige und künstlerische Heimat für diejenigen Künstler, die vor Hitler aus anderen europäischen Ländern flüchten müssen.12 Doch wie eng sie ihren Künstlerbekannten tatsächlich verbunden ist, bleibt im Dunkeln : Rahel Szalit-Marcus führt ein zurückgezogenes Leben, öffnet sich nur ihren engsten Freunden.13 1942 wird sie verhaftet und nach Auschwitz deportiert. Sie kommt dort im selben Jahr ums Leben. Der Verbleib vieler ihrer Werke – die Nazis verwüsteten bei ihrer Verhaftung ihr Atelier, ihre Bilder wurden in alle Himmelsrichtungen verstreut – ist ungeklärt.14 2. Rahel Szalit-Marcus als Illustratorin Im russisch-jüdischen Berlin, in einem jiddischen Milieu, besinnt sich Rahel Szalit-Marcus auf ihre osteuropäischen Wurzeln.15 Sie entdeckt die jiddische Literatur für sich. Aus der eifrigen Leserin wird eine begeisterte Illustratorin. 1923 erscheinen die ‫ סיפּורי ־ מעשׂיות‬von Nachman von Bratzlaw ( Nakhmen Braslever ), gesammelt von Moyshe Kleynman,16 und das Kinderbuch ‫ ( ְק ִט ָינא ָכּל ־ בּו‬Kleines Allerlei ) von Chaim N. Bialik mit Illustrationen von Rahel Szalit-Marcus.17 Außer Heinrich Heine, Charles Dickens, Lev Tolstoj und Fëdor Dostoevskij fühlt sie sich den beiden Klassikern der jiddischen Literatur Mendele Moykher-Sforim und Sholem Aleichem verbunden. In Mendeles ‫ ( ישקע דער קרומער‬Fischke der Lahme, 1869 ) und Sholem Aleichems ‫מאטל פּײסי דעם חזנס‬ ָ ( Motl, 12 Paris wurde in den ersten Jahrzehnten des 20. Jahrhunderts für viele europäische Künstler – man denke an Pablo Picasso, Joan Miró, Amadeo Modigliani oder Hans Arp – zu einem Mekka. Auch vielen ostjüdischen Künstlern wurde die Metropole zur zweiten Heimat, so Marc Chagall, Chaïm Soutine, Emmanuel Mané-Katz oder Jacques Lipchitz. Zur sogenannten École de Paris s. Malinowski 2007, Buisson 2007 und http ://www.shalom-magazine.com/Print.php ?id=450215 ; 11.3.2012. 13 Fenster 1951 : 233. 14 Erhalten sind die Ölbilder Straße ( 1920 ) und Die Dorfmusikanten ( 1920 ; s. Abbildung in Buisson 2007 : 131 ). 15 Inwieweit hier auch Kontakt zur Lodzer Gruppierung ‫ ( יונג ייִ דיש‬Junges Jiddisch ), beispielsweise zu Henryk Berlewi oder Marek Szwarc, zustande kommt, die sich der Illustration jiddischer Texte zuwenden, ist momentan nicht zu sagen. 16 S. Fenster 1951 : 232 und Kühn-Ludewig 2008 : 34. 17 Die genannten Ausgaben erscheinen im Rimon-Verlag. Fenster und Sennewald ( 1999 : 225 ) erwähnen noch Kindergeschichten von Martin Buber sowie Israel Zangwills Der König der Schnorrer. Diese konnte ich bisher nicht ermitteln. Sabine Koller : Mentshlekh un stsenes 211 Sohn des Kantors Peyse, 1911 und später ) ĳindet Rahel Szalit-Marcus eine Sprachkunst vor, die sie im Medium der Radierung und gespeist von ihrem ostjüdisch geprägten Vorstellungsschatz auf originelle Weise ins Visuelle übersetzt.18 Insbesondere Mendeles und Sholem Aleichems Romanhelden werden von ihr kunstvoll gestaltet,19 ‫דארטן געשיל־‬ ָ ‫וואס ווערן‬ ָ ,‫די הײמישע טיפּן‬ ‫ ווי זי לעגט שפּעטער‬,‫זײנען‬ ַ ‫וואס‬ ָ ‫דערט און‬ ‫ ווי זײ‬,‫כגעגאנגען‬ ַ ‫נא‬ ָ ‫ איר כּסדר‬,‫דערצײלן‬ ‫אריקסירן‬ ַ ‫בײ איר געבעטן זײ צו‬ ַ ‫וואלטן זיך‬ ָ .‫דורך איר אין בילד‬ die Typen der Heimat, die dort geschildert werden und die ihr, wie sie später oft erzählte, immer folgten, als wollten sie sie bitten, sie bildlich festzuhalten. Im Falle von Sholem Aleichems ‫מאטל פּײסי דעם חזנס‬ ָ erfahren Motls Mutter, sein Bruder Elye, dessen Frau Brokhe, Elyes kurzsichtiger Freund Pinye und natürlich Motl selbst in 16 Zeichnungen eine visuelle Umsetzung. Rahel Szalit-Marcus nimmt sich in ‫ זעכצן‬: ‫מענטשעלעך און סצענעס‬ ‫מאטל פּײסי דעם חזנס ִײנגל‬ ָ ‫ ( צײכענונגען צו שלום ־ עליכמס ווערק‬Menschen und Szenen : Sechzehn Zeichnungen zu Sholem Aleichems Werk Motl Peyse dem khazns yingl ) nur des ersten, ästhetisch ausgereifteren Teil des Motl-Romans an – vielleicht, weil der zweite Teil unvollendet blieb und von Sholem Aleichem nicht als Publikation in Buchform vorgesehen war,20 vielleicht, weil er nicht zugänglich war.21 3. Sholem Aleichems ‫מאטל פּײסי דעם חזנס‬ ָ : Poetik und Illustrationskunst Sholem Aleichems kleiner Motl hat bei der Literaturkritik zunächst einen schlechten Stand. Wie ein David wirkte er im Vergleich zu Sholem Aleichems beiden Goliaths, dem ( hyper )aktiven Luftmenschen Menakhem-Mendl und dem bodenständigen, passiven Tevye, welche 18 1922 erscheinen die Illustrationen zu Mendele im Propyläen-Verlag, diejenigen zu Sholem Aleichem im Klal-farlag. In der bibliophilen Ausgabe zu Sholem Aleichem sind die Gravuren der Künstlerin mit kürzeren, den Illustrationen entsprechenden Textausschnitten des jiddischen Originals ergänzt. Ziel sei es, durch derartige Publikationen das Leseinteresse an der jiddischen Literatur zu wecken, so Bal-Makhshoves in seinem Vorwort ( Bal-Makhshoves 1922 : o. S. ). Hinweise, welche Ausgabe von Sholem Aleichems Roman zugrunde lag, gibt es nicht. 19 Fenster 1951 : 232. 20 Miron 1978 : 149. 21 Der europäische Zyklus erscheint 1911 in Buchform ; der amerikanische Teil, verfasst 1916, wird erstmals 1918 herausgegeben ( Miron 1978 : 122 und 133 ). Die Textverweise in diesem Beitrag folgen dem vierten Band der ikuf-Ausgabe ‫ ַאלע ווערק ון שלום עליכם‬von 1953 : ‫ ון דער הײם קײן ַאמעריקע‬: ‫ ערשטער טײל‬.‫ כּת*ים ון ַא ייִ נגל ַא יתום‬.‫מאטל פּײסי דעם חזנס‬ ָ . 212 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬# ‫לקט‬ die beiden widerstreitenden Kräfte ostjüdischen Lebens verkörpern.22 1908 dann bekundet eben jener Bal-Makhshoves, der viele Jahre später in Berlin Szalit-Marcus ’ Illustrationsarbeit treffend charakterisieren sollte, besonderes Gespür für die literarische Größe des kleinen Motl. Anklänge an die archetypischen Figuren Menakhem-Mendl und Tevye erkennt Bal-Makhshoves auch in Sholem Aleichems ‫מאטל פּײסי‬ ָ ‫דעם חזנס‬.23 Als Inbegriff und Hypostase des jüdischen Kindes ist jedoch Motl der unbestrittene Held des Romans.24 Über ihn wird nicht nur die Handlung organisiert, der Weggang aus der alten Welt des zugrunde gehenden Schtetls ; auch die ( Um- )Wertungen geschehen aus Motls Perspektive. Mit seinen Augen erleben wir die ( Miss- )Geschicke der Menschen im Schtetl und auf dem Weg nach Amerika. Doch trotz der verschiedenen Stationen, auf denen wir Motl, den Sympathieträger des Autors – und des Lesers – begleiten, ist der Roman kein Entwicklungsroman. Wie Elye, sein Bruder, oder dessen Freund Pinye, ist Motl eine statische Figur. Er bleibt unverändert der Gleiche oder, wie Dan Miron lakonisch konstatiert : Motl wird niemals ( er )wachsen.25 Für die Illustratorin wäre die Darstellung einer statischen Figur eine vergleichsweise einfache Aufgabe, gäbe es da nicht die ambivalente Erzählperspektive, die – wie könnte es bei Sholem Aleichem anders sein – auch seine Schreibweise bestimmt. Die kindliche Naivität der Romanĳigur und des Ich-Erzählers Motl paart sich mit der sprachlich virtuosen Rafĳiniertheit der Erzählinstanz, die den kleinen Jungen begleitet : Dank dieser widersprüchlichen, doch ästhetisch fruchtbaren Verbindung lesen wir die ‫ ( כּת*ים ון ַא ייִ נגל ַא יתום‬Schriften eines Waisenjungen ), der gar nicht schreiben und kaum lesen kann.26 Ist Motl bloß ein Vorwand für Sholem Aleichems entlarvende Sicht auf die Welt ( zwischen untergehendem Alten und noch unbekannten Neuem ), die er nur einem Kind in den Mund zu legen wagt ? Dan Miron, der dem Vexierspiel von Sholem Aleichems realer und ĳiktionaler Identität nachgeht, vermutet : » Sholem Aleichem can perhaps be said to function in Motl Peyse dem khazns in the capacity of a ghost-writer, or a souffleur. «27 Wer souffliert, macht einen Anderen zum Stimmträger der eigenen Position. Motl, das Kind, ist Sholem Aleichems Sprachrohr, das wie in Hans Christian Andersens Des Kaisers neue Kleider klar und unbefangen die Wahrheit erkennt – und äußert. 22 S. hierzu Bal-Makhshoves 1953 : 172 – 190. 23 Motls Bruder Elye, der sich vom traditionellen Schtetl-Leben ab- und dem kapitalistisch bestimmten Stadtleben zuwendet, stuft der Kritiker als eine Variante MenakhemMendls ein. Bal-Makhshoves 1922 : o. S. 24 Ibid. : o. S. 25 Miron 1978 : 144 und 162. 26 Vgl. Miron 1978 : 25. 27 Ibid. Sabine Koller : Mentshlekh un stsenes 213 Folgt man Gérard Genettes narratologischer Unterscheidung zwischen Stimme und Modus und seiner Untersuchung über den Grad der Nähe und die Art der Fokalisierung der erzählenden Instanz, dann erscheinen in ‫מאטל פּײסי דעם חזנס‬ ָ derjenige, der spricht, und derjenige, der sieht, als durchaus identisch.28 Doch wird diese scheinbare Kongruenz ständig durch den Motl gleichsam über die Schulter blickenden, wissenden Erzähler Sholem Aleichem manipuliert. Dieser zieht die Fäden, bleibt jedoch für den Leser unsichtbar. Sholem Aleichems Poetik der Komik legt sich wie ein dünner Film zwischen Motls unbändige Lebenslust und das ihm ständig drohende Unheil.29 Wir lachen mit Motl, auch da, wo es nichts zu lachen gibt : Die Art und Weise, wie ( komisch ) die Ereignisse aus Motls Sicht mit Sholem Aleichems Worten erzählt werden, ist ambivalent. Sie nimmt der Realität ihre Brutalität, ohne diese ganz zu tilgen.30 Doch wie einen Autor illustrieren, dessen Humor und Darstellungskraft wesentlich auf Sprachakrobatik basieren ? 31 Dessen Charaktere vorrangig über Sprache, Versprecher, Sprachspiele proĳiliert werden ? 32 Als der russische Formalist Jurij Tynjanov sich 1922, also im selben Jahr, in dem Rahel Szalit-Marcus ’ Graphiken zu ‫מאטל פּײסי דעם חזנס‬ ָ erscheinen, mit der Kunst der Illustration auseinandersetzt,33 beruft er sich unter anderem auf zwei Autoren, die aufgrund ihrer Poetik eine Verbindung mit Sholem Aleichem zulassen : Sowohl Nikolaj Leskov als auch Nikolaj Gogol ’ verwenden den skaz ( von russ. skazat ’ : › sagen ‹ ), also eine mündlich geprägte Erzählweise, die auch für Sholem Aleichem konstitutiv ist.34 Die Poetik beider russischer Autoren erzeugt eine Konkretheit der handelnden Personen, die durch die Illustration nicht wiedergegeben werden kann, da diese in der Regel mit einer » Komprimierung und Vereinfachung « der sprachlichen Darstellung einhergehe.35 In Tynjanovs Augen › tötet ‹ die erklärende – also schlicht den Inhalt wiedergebende – Illustration die Komplexität des erzählerischen und sprachlich komponierten Gefüges. Glaubt man Tynjanov, so 28 S. hierzu Genette 1996 und Martinez und Scheffel 2003 : 27 – 107. Genettes Theorie der Fokalisierung kategorisiert, aus welcher Sicht erzählt wird. Im Falle von ‫מאטל פּײסי דעם חזנס‬ ָ handelt es sich um eine auktoriale ( interne ) Fokalisierung : Der Erzähler sieht hier im Unterschied zur auktorialen Perspektive das Geschehen gleichsam mit den Augen der Figur. 29 Zur Rezeption von Sholem Aleichem durch Yekhiel Yeshaye Trunk, Bal-Makhshoves, Shmuel Niger und Meir Wiener unter besonderer Berücksichtigung der Komik s. Miron 1978 : 122 – 126. 30 Man denke an die Flucht über die Grenze, die Motls Familie fast das Leben kostet ( Sholem Aleichem 1953 : 125 f ). 31 Zu Sholem Aleichems Sprachkomik s. Loytsker 1939 : 17 – 80. 32 Vgl. Miron 1978 : 134. 33 Tynjanov 1984 : 148 – 154. 34 Zu Sholem Aleichems skaz-Technik s. Erlich 1964 : 44 – 50 sowie Safran 2012 und Koller 2012. 35 Tynjanov 1982 : 188. 214 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬# ‫לקט‬ haftet der Illustration fast ein Fluch an : » Die Illustration gibt ein Detail der Fabel wieder, niemals eines des Sujets. « 36 In dieser grundlegenden formalistischen Unterscheidung meint die Fabel die chronologisch ablaufende Handlung, das Sujet deren künstlerische ( und damit potenziell nichtchronologische ) Anordnung : Komposition, Erzählerkniffe und sprachliche Gestaltung gehören hierher. Nur dann, wenn ein Illustrator sich von der reinen Inhaltsästhetik zu lösen vermag und visuelle Ausdrucksformen ĳindet, die dem » Prinzip des jeweiligen poetischen Werks analog « 37 sind, hat eine Illustration für Tynjanov eine Berechtigung. Auf Sholem Aleichems Roman bezogen, bedeutet dies : Wer ‫מאטל‬ ָ ‫ פּײסי דעם חזנס‬illustrieren will, der sollte sich nicht so sehr auf die Handlung als auf deren sprachlich-ästhetische Darstellung konzentrieren. 4. Ein Roman in Bildern : Szalit-Marcus ’ Illustrationen im Überblick Die Geschichte, die Szalit-Marcus ’ Illustrationen erzählt, beginnt textgetreu mit Motls ( dionysischem ) Tanz mit Meni, dem Kälbchen, an einem Frühlingstag nach Pessach in der freien Natur ( s. Abb. 1 ). Als scharfer Kontrast dazu folgt die Illustration ‫קראנקן‬ ַ ‫בײם‬ ַ ‫דאקטער‬ ָ ‫שווארצער‬ ַ ‫דער‬ ‫טאטן‬ ַ ( Der schwarze Doktor beim kranken Vater ) : Sie zeigt Motls Vater im Krankenbett, die händeringende Mutter, einen zuversichtlich dreinblickenden Arzt – auch im Text ist er “ ‫דאקטער‬ ָ ‫ ( „ ַא רײלעכער‬ein fröhlicher Doktor ; S. 13 ) – und schließlich Motl selbst, liebevoll und wie zum endgültigen Abschied von seines Vaters Hand berührt. Nach dem Portrait von Pesye, der Nachbarin ( Ill. 3 ), greift die Künstlerin mit ‫משה דער‬ ‫טאוול ון ַא קרבן ־ מנחה‬ ָ ‫אײנבינדער שטויסט די קינדער מיט ַא‬ ַ ( Moyshe der Buchbinder schlägt die Kinder mit dem Buchdeckel eines Korbn-minkhe ) das häuĳig wiederkehrende Thema der familiären Gewalt gegen Kinder auf ( vgl. Kap. ii / 5 ).38 Die Illustration ‫מאטלען‬ ָ ‫טראכט‬ ַ ‫בא‬ ַ ‫ ( מנשה דער רוא‬Menashe der Heilkundige untersucht Motl ; Ill. 5 ) bildet das Gegenstück zur zweiten Graphik ; hier wie da sehen wir Menschen, die krank sind. Den weltlich gekleideten, aufgeklärten und vertrauenerweckenden Doktor ( der gleichwohl den Tod des Vaters nicht verhindern kann ) ersetzt der “ ‫„ רוא‬, dubios wie die “ ‫פּראשקעס‬ ָ „ ( Pulverchen ), die – so glaubt jedenfalls Motls Mutter – “ ‫מאכן ון טויט לעבעדיק‬ ַ ,‫זײנען מחיה מתים‬ ַ „ ( Tote lebendig machen ).39 Im Text ist der Mund des Heilkundigen schief und 36 Ibid. : 195. 37 Ibid. : 193. 38 Dass der Familienvater Menashe für seine schmerzhafte Schelte das Frauengebetbuch für Nachmittagsgebete verwendet, ist ein pikantes Detail in Sholem Aleichems Darstellung. 39 Sholem Aleichem 1953 : 37. Sabine Koller : Mentshlekh un stsenes 215 Abbildung 1 Motls Tanz mit Meni, dem Kälbchen 216 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬# ‫לקט‬ ein Auge kleiner als das andere,40 in der Illustration ist ein Auge offen, das andere geschlossen. Rahel Szalit-Marcus schreibt dem Quacksalber sein Metier zwischen Leben und Tod förmlich ins Gesicht : ‫צומאכן מיט‬ ַ „ “ ‫ ( ַאן אויג‬wörtl. › ein Auge schließen ‹ ) bedeutet im Jiddischen › sterben ‹.41 Mit Menashe, dem Quacksalber, beschließt die Künstlerin die Exposition der Figuren, die Motls Lebenswelt ausmachen. In den folgenden fünf Illustrationen tritt eine Figur auf den Plan, die hierbei nicht fehlen darf : Motls großer Bruder Elye. Rahel Szalit-Marcus portraitiert ihn gemeinsam mit dessen in Text und Bild wenig sympathisch gezeichneter Frau Brokhe ( Ill. 6 ) ; wir erleben den scharf überzeichneten Elye in seinem Element : Um den Lebensunterhalt der verarmten Familie zu garantieren, macht er Kwass ( Ill. 7, s. Abb. 2 ), den Motl anschließend verkaufen muss ( Ill. 8 ). Die nächsten Taten Elyes, die im Desaster enden, werden in fast grotesker Manier in den Radierungen 9 und 10 festgehalten : Er stellt Tinte her ( Ill. 9 ), die im Buch zu einer schwarzen Sintflut anschwillt – , schließlich verlegt er sich auf Mäusegift. ‫גאס‬ ַ ‫ַא‬ ‫ ( ניסט‬Eine Straße niest ; Ill. 10 ) zeigt die grotesk überzeichnete Familie, wie sie von Niesanfällen geschüttelt wird. In Sholem Aleichems Text kann Motl nicht der Versuchung widerstehen, auf dem Sack mit dem für die Mäuse verhängnisvollen Pulver so lange zu reiten, bis er platzt. Die Künstlerin konzentriert sich bei dieser Episode auf die komische Folge des kläglichen Versuchs, Geld zu verdienen. Auf diese szenische Darstellung folgt das Portrait von Elyes Freund Pinye ( Ill. 11, s. Abb. 3 ; Kap. xi ). Erneut steht die Charakterisierung der Figur im Vordergrund. Der langnasige Pinye überragt in der nächsten Illustration Motls Familie, die in ‫ארן קײן ַאמעריקע‬ ָ ‫ ( מיר‬Wir fahren nach Amerika ) auf einem vollbepackten Leiterwagen den Weg ins Ungewisse antritt ( Ill. 12, s. Abb. 4 ). Oder ist es der Weg ins Licht, dem der kleine Motl in Gestalt einer kindlich gezeichneten Sonne am linken ( westlichen ) Bildrand entgegenblickt ? Die dreizehnte Illustration gibt eine wenig erfreuliche Antwort : ‫ ( די רומע ייִ דענע‬Die fromme Jüdin ) entfaltet in Text und Bild eine perĳide Dialektik von Sein und Schein. Tücke und Verschlagenheit sind ihr ins Gesicht geschrieben, die Hände scheinen nur zu beten : Im Verein mit dem Gesichtsausdruck und im Kontext der gesamten Bildaussage suggeriert die festgehaltene Geste eher, dass die Alte sich in Vorfreude der zu erwartenden Beute die Hände reibt ( vgl. Kap. xiii ). In ‫רײלין ַזײטשיק ון דער עזרא‬ ַ ( Fräulein Zaytshik [ = Häschen ; S.K. ] von der Ezra ; Ill. 14 ) ist die Ansprechpartnerin einer ( ĳiktiven ) jüdischen Hilfsorganisation für Motls Familie, die nach mehreren Peri40 Ibid. : 36 41 Dies ist ein häuĳiges Motiv bei Marc Chagall, aber auch bei Yisokher Ber Rybak oder Yoysef Tshaykov. Sabine Koller : Mentshlekh un stsenes 217 Abbildung 2 Elye macht Kwass 218 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬# ‫לקט‬ petien schließlich in Antwerpen angelangt ist, im Sinne des Textes das positive Pendant zur betrügerischen Jüdin an der russisch-habsburgischen Grenze.42 Doch herrscht in der Illustration zugleich eine seltsame Spannung zwischen dem erbarmungslos freundlichen, komisch modellierten Fräulein und Motls ewig trauriger Mutter. Rahel Szalit-Marcus ’ Bilderreigen endet mit der Abfahrt von Pesyes Familie, Motls ehemaligen Nachbarn im Schtetl, nach Amerika ( vgl. Kap. xix ). Der › Kampf ‹ zwischen komischem und traurigem Duktus ist hier entschieden : Die abschließende fünfzehnte Illustration ‫בײם שיף‬ ַ ‫ליאסטרע‬ ַ ‫כא‬ ַ ‫ ( מיר געזעגענען זיך מיט דער‬Wir verabschieden uns am Schiff von der Bande, s. Abb. 5 ) ist ein fast biblisches Gruppenbild des Abschieds. Den Sprung über den Teich schaffen Szalit-Marcus ’ Figuren im Unterschied zur literarischen Vorlage nicht. Das Deckblatt zu ‫מענטשעלעך‬ ‫ און סצענעס‬zeigt Motl mit seiner Mutter und einem weiteren Kind ( Goldele ? ) an einem menschenleeren Kai auf einem Koffer sitzend ; im Hintergrund sieht man ein auslaufendes Schiff. Am Ende des graphischen Zyklus verweigert sich die Künstlerin dem Autor, dem sie sonst inhaltlich und ästhetisch gefolgt ist : London und Amerika bleiben ausgespart. Für Rahel Szalit-Marcus gibt es nur den Exodus, nicht aber ein Ankommen. Rahel Szalit-Marcus ĳindet die goldene Mitte zwischen Tynjanovs illustrativem Extremismus ( der im Grunde alles Inhaltliche abqualiĳiziert ) und dem künstlerischen Bedürfnis, Sholem Aleichems visuelle Poetik dort umzusetzen, wo sie ihre größte Wirkung entfaltet : in der Gestaltung seiner Figuren, die über den Typus hinaus ins Archetypische reichen. 5. Figurenportraits in Text und Bild : Elye, Pinye und Motl In seinem Vorwort zur Ausgabe von 1922 überträgt Bal-Makhshoves sein literarisch gewonnenes und an Sholem Aleichems Figuren erprobtes Archetypenkonzept auf Rahel Szalit-Marcus ’ Illustrationen : In der Gravur ‫ארן קײן ַאמעריקע‬ ָ ‫ מיר‬erkennt er in Pinye ‫קיכאטישע‬ ָ ‫דאן ־‬ ָ ‫„ עפּעס ַא ִײדישע‬ “ ‫געשטאלט‬ ַ ( die Gestalt eines jüdischen Don Quichotte ).43 Als Sancho 42 Die Stationen Brody, Lemberg, Krakau und Wien, die zwischen dem Grenzübertritt und dem längeren Aufenthalt in Antwerpen liegen ( vgl. Kap. xiv – xviii ), wo die Familie auf die Ausreisegenehmigung nach Amerika wartet, thematisiert Szalit-Marcus nicht. Auch wenn sie in Motls kindlicher Wahrnehmung einen tiefen Eindruck hinterlassen, werden der paradiesische Nachbarsgarten, der altersverwirrte Lurye, der Motl fressen will, oder die Hochzeit zwischen Brokhe und Elye ebenfalls nicht dargestellt. 43 Bal-Mashoves 1922 : o. S. Sabine Koller : Mentshlekh un stsenes 219 Abbildung 3 : Elyes Freund Pinye 220 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬# ‫לקט‬ Pansa fungiert der Kutscher, der ihn begleitet. Elye, der mit spitzer Nase unterhalb von Pinye sitzt, erscheint ihm als “ *‫„ קלײנשטעטלדיקער איו‬ ( kleinstädtischer Hiob ).44 Gramgebeugt, vielleicht sogar schlafend, sitzt er da, das unter einer schwarzen Schirmmütze und düsterer Schraffur sich abhebende Gesicht vom Weg ins Heil abgewandt. In diese Abbildung mündet die Serie von Portraits und szenischen Darstellungen, die Elye in ein anderes Licht rücken ( s. Ill. 6, 7, 9 und 10 ). Elye erscheint hier keineswegs als der große Dulder, der Gottes Wille über sich ergehen lässt. Vielmehr ist er – ganz im Sinne des Textes – die Verkörperung des aktiven, ja schädigenden Prinzips. Die Künstlerin hält in drucktechnischer Vollendung fest, wie er Kwass herstellt und dabei den Blick in ein Buch senkt, das an die Stelle der Heiligen Schrift tritt ( s. Abb. 2 ) : ‫אר‬ ַ „ 45 “ ! ‫ ( אײן רובל הונדערט רובל‬Für einen Rubel – hundert Rubel ! ), so wird das Handbuch angepriesen, dem Elye verfällt und das den Eintritt in den Kapitalismus markiert.46 Zugleich betont Rahel Szalit-Marcus graphisch die Hand, die im Kwass rührt. Von der feinen Punktierung der Gegenstände, des Hintergrundes und Elyes selbst, die den Einfluss eines Meisters der Radierung, nämlich Hermann Struck, vermuten lässt, heben sich das Buch und die tätige Hand, Theorie und Praxis des Kapitalismus, deutlich ab.47 Der Schwarz-Weiß-Kontrast wird in der neunten Illustration gesteigert : Tiefschwarz und fast unheimlich ragen die Tintenflaschen ins Bild ; auf den bleichen Gesichtern der Mutter, Motls und Elyes hinterlassen die Tintenflecken dunkle Schatten. Die Künstlerin realisiert hier Sholem Aleichems vielsagenden Vergleich, die Tinte habe schwarz gemacht “ ‫ ( „ ווי די שדים‬wie die Teufel ).48 Diese emotionale Färbung des Dämonischen und Unheilbringenden geht nahtlos auf die Folgeillustration und auf Elye, ihren Protagonisten, über.49 Letztere entlarvt Elyes abschließenden › kapitalistischen Akt ‹, die Herstellung von Rattengift : Die Gesichter sind vom Niesen entstellt, die Münder weit aufgerissen. Die Strichführung ist heftig bis aggressiv, die Häuser im Hintergrund 44 Ibid. 45 Sholem Aleichem 1953 : 70. 46 Vgl. Miron 1978 : 164 – 166. Der Lerneifer, der eigentlich religiösen Schriften gelten sollte, geht auf das Handbuch über : “ ‫ ( „ ער זיצט און לערנט אים אויף אויסנווײניק‬Er sitzt und lernt es auswendig ; Sholem Aleichem 1953 : 78 ). 47 Bei Hermann Struck lernen auch Jacob Steinhardt, Josef Budko und Marc Chagall die Technik der Gravur. 48 Sholem Aleichem 1953 : 81. 49 Auch Elyes Bart wächst “ ‫ ( „ מיט רוחות‬wie der Teufel ; Sholem Aleichem 1953 : 95 ) – und seltsam, da er nur am Hals sprießt, das Gesicht jedoch glatt bleibt ( ibid. ). Berl, der Schuster, heißt Elye einen “ ‫מאכער‬ ַ ‫ ( „ כּישוף ־‬Hexenmeister ; Ibid. : 94 ), der dem Rattenfänger von Hameln gleich mit einem Zauberspruch alle Ratten in den Fluss gelockt habe. Sabine Koller : Mentshlekh un stsenes 221 Abbildung 4 Wir fahren nach Amerika sind an den Rändern in beunruhigender Auflösung begriffen. Wieder ist Elyes Kopf gebeugt ; die Hand des Niesenden ist zur Faust geballt. Sein Gesicht und damit sein Wesen entziehen sich dem Blick des Betrachters. In Rahel Szalit-Marcus ’ Serie bleibt Elye konstant eine negativ gezeichnete Figur. Die stringente Charakterzeichnung im Bild entspricht dem Tenor von Sholem Aleichems Figurenbeschreibung im Text : Was immer geschieht, Elye wird schnell böse ; er schlägt seinen jüngeren Bruder Motl, vor allem, weil dieser zeichnet. Die Figur des Elye wird von Sholem Aleichem in vielen Fällen karikatural überzeichnet ( er ist klein und wirkt im Vergleich zu seiner Frau weibisch ) ; 50 seine Handlungen misslingen 50 Ibid. : 54. 222 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬# ‫לקט‬ und werden parodistisch umgedeutet : Am Ende von Elyes Versuchen, Geld zu verdienen, steht nicht der große Gewinn, sondern totale Armut. Dem handelnden Elye setzt Szalit-Marcus einen kontemplierenden Pinye entgegen ( s. Abb. 3 ). Der Kontrast zwischen Elye, dem grotesk überformten kapitalistischen Aktivisten, und Pinye, dem humoristisch dargestellten › Dichter und Denker ‹ und Vertreter des passiven, geistigen Prinzips, könnte in der graphischen Serie augenfälliger nicht sein : Auf die konvulsivische Körpersprache der zehnten Illustration mit dem sich krümmenden Elye folgt das Bild des hoch aufgeschossenen, in sich ruhenden Pinye. Den Kopf auf die Hand gestützt, ohne die phänomenal krumme Nase platt drücken zu können, erscheint der Uhrmachersohn als heitere Variation von Rodins Denker. Wie Sholem Aleichem überzeichnet Rahel Szalit-Marcus Pinyes Adamsapfel und seine Nase, verewigt sie seinen heruntergerutschten Strumpf. Der lose herabhängende Kittel und das schlotternde Hemd betonen seine hagere Gestalt. Auch für den komischen Gehalt des Pinye ĳindet die Künstlerin adäquate visuelle Mittel.51 Als Standpunkt wählt die Künstlerin den Blick von unten nach oben und damit den Blick eines Kindes ( Motls ? ), das zu Pinye aufschaut. Unverrückbar steckt dieser in großen Schuhen. Aus der Perspektive des Kindes, die auch der Erzähler wählt, erwächst die bildkünstlerische Gestaltung Pinyes. Sie greift den im Text angelegten Humor und Pinyes wunderlich-unschuldige Geistigkeit gleichermaßen auf ( Sholem Aleichem betont, dass Pinye, von seinen Hirngespinsten übermannt, der Kopf davonzufliegen scheint ; 52 von Pinye stammt übrigens die Idee, nach Amerika auszuwandern ) : 53 ‫ מוזט איר זיך‬,‫ַאז איר טוט אויף אים ַא קוק‬ ,‫וואס ער איז דין און הויך‬ ָ ,‫ נישט גענוג‬.‫צעלאכן‬ ַ ‫ ווי‬,‫נאז‬ ָ ‫לאנגע‬ ַ ‫ ַא‬,‫לאנגע אויערן‬ ַ ‫פּאר‬ ָ ‫האט ער ַא‬ ָ .‫ און ַא נידעריקע ראיה דערצו‬,‫גאנער‬ ָ ‫ַא‬ Wenn ihr ihn euch einmal anseht, brecht ihr in Lachen aus. Nicht genug damit, dass er dünn und hochgewachsen ist : Er hat zudem eine lange Nase, ein paar lange Ohren, einen langen Hals, wie ein Gänserich ; dabei ist er kurzsichtig. 51 Dass Pinye für Sholem Aleichem ein zentrales Vehikel der Komik ist, bezeugt vor allem die von großer Sprachkomik gekennzeichnete Episode in der Bahn, als Pinye, Motl und dessen Familie zur Grenze unterwegs sind ( Ibid. : 117 – 119 ). 52 Ibid. : 103 und 110. 53 Ibid. : 106 und 102. Sabine Koller : Mentshlekh un stsenes 223 Abbildung 5 Wir verabschieden uns am Schiff von der Bande Sholem Aleichem bedient sich des komischen Kontrasts ( langohrig vs. kurzsichtig ) ; Szalit-Marcus führt diesen in einen druckgraphischen Gegensatz über : Pinyes Ohren und sein Hals heben sich von der schwarzen Mütze und der geschwärzten Mantelpartie an der linken Schulter deutlich ab. Mehr noch als durch antithetische Setzungen sind Text und Illustration durch komisch wirkende Übertreibungen geeint. Auch dank der überzeichneten Physis und Physiognomie Pinyes, seiner Körperlänge und Pose wird Sholem Aleichems rhetorisches Hauptverfahren der Hyperbel bildlich umgesetzt.54 54 Ibid. : 102. 224 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬# ‫לקט‬ ‫ניטא‬ ָ .‫געראטענע כּלי‬ ָ ‫דעראר איז ער ָאבער ַא‬ ַ ‫זײן‬ ַ ‫ מיט‬.‫קאנען‬ ָ ‫זאל ניט‬ ָ ‫וואס ער‬ ָ ,‫זאך‬ ַ ‫אײן‬ ‫ריבערגעיאגט‬ ָ ‫ ַא‬,‫זאגט מען‬ ָ ,‫האט ער‬ ָ ‫לערנען‬ ‫ארשטעקן‬ ַ ‫שרײבן וועט ער‬ ַ ‫זײן‬ ַ ‫ מיט‬.*‫דעם ר‬ ‫האט ַא‬ ָ ‫וואס ער‬ ָ ‫ ַאחוץ‬.‫גארטל ַאלע קענערס‬ ַ ‫אין‬ ‫ איז ער ַא גרויסער בריה‬,‫האנטשריט‬ ַ ‫זעלטענע‬ ‫שרײבט‬ ַ ,‫שרײבן‬ ַ ‫זאל ניט‬ ָ ‫וואס ער‬ ָ .‫גראמען‬ ַ ‫אויף‬ ‫באשריבן די‬ ַ ‫האט שוין‬ ָ ‫ ער‬.‫גראמען‬ ַ ‫ער מיט‬ ‫ די‬,‫גבאים‬ ָ ‫ די‬,‫ דעם שוחט‬,*‫ דעם ר‬: ‫שטאט‬ ָ ‫גאנצע‬ ַ ‫האט‬ ָ ‫זײן אײגענע משפּחה — ַאלעמען‬ ַ ,‫יאטקעס‬ ַ .‫גראמען‬ ַ ‫ און ַאלעמען אין‬,‫באשריבן‬ ַ ‫ער שוין‬ Dabei ist er ein fähiges Bürschchen. Es gibt nichts auf der Welt, was er nicht weiß. Mit seinem Lernen hat er, so sagt man, den Rabbi überholt. Mit seinem Schreiben steckt er alle Fachmänner in die Tasche. Über die Tatsache hinaus, dass er eine außergewöhnliche Handschrift hat, versteht er sich trefflich aufs Reimen. Er hat bereits die ganze Stadt beschrieben : den Rabbi, den Schächter, die Verwalter jüdischer Einrichtungen, die Fleischer, seine eigene Familie – alle hat er beschrieben, und alle in Versen. Pinye bleibt im Text von der karikaturalen Schärfe des Erzählers, an der dieser bei Elye nicht spart, unberührt. Auch in der graphischen Gestaltung wird er zu einer sympathischen Idealĳigur überhöht. Die weißen Leerstellen der Gravur verstärken den Eindruck des Hellen und Lichten, der von Pinye ausgeht. In der achten Illustration, in der der kleine Motl seinen Kwass anpreist, scheint der Boden ( auch im Sinne einer Weltordnung ) unter ihm nach links unten wegzurutschen ; in Pinyes Portraitierung hingegen steigt die gesamte Linienführung der Gestalt und der Umgebung ( Mauer, Boden ) nach rechts oben, zum Licht ( des Wissens ) hin an. Organisch ist er mit dem Buch – einem Leitmotiv des Textes wie der Illustrationen – verbunden.55 Mit seinem ganzen Wesen ist er heiligen oder eigenen Schriften – und der Bildfläche des Lichten zugewandt.56 Geborgen in der Schrift, scheint ihm die Zeit wenig anzuhaben : Der Uhr an der Wand – sie steht für Pinyes ‫ייִ חוס‬, da er von einem Uhrmacher abstammt – kehrt er den Rücken zu.57 Motl als Hypostase des jüdischen Kindes ist der Held von Sholem Aleichems letztem Roman. Er steht für Werden, Wachstum, Leben. Das Waisenkind, das seinen Vater verloren hat, hat keine Verankerung in der jüdischen Tradition mehr, nichts hält ihn im Schtetl : 58 Motl » is not only the symbolic incarnation of spring, he is also the historical symbol 55 Vgl. weltliche und heilige Bücher als Mittel oder Anlass zur Gewalt, zum Gelderwerb, zur geistigen Erbauung oder – in Antwerpen – zur Fixierung der Flüchtlingsströme nach Amerika, vgl. die Ill. 4, 6, 7, 11 und 14. Das Buchmotiv offenbart eine tiefgreifende weltanschauliche Symbolik : Pinye, der für seine Verse Prügel bezieht, verbrennt das Schaden bringende Buch, das sich Elye gekauft hat ( Ibid. : 98 ). 56 S. hierzu Ibid. : 104. 57 Die Künstlerin setzt mit der Abbildung der Uhr eine wichtige Motivkette der ostjüdischen Malerei fort, wie sie sich beispielsweise bei Yehuda Pen ( russ. Jurij Pėn ) oder – virtuos kubistisch – bei Yisokher Ber Rybak ĳindet. 58 Vgl. Sholem Aleichem 1953 : 29. Sabine Koller : Mentshlekh un stsenes 225 of the ĳinal bankruptcy of traditional Jewish culture «.59 Er ist reine Gegenwart, reines Sein, akulturell und azivilisatorisch. Um diesem Konzept zu entsprechen, kann er nicht als konkrete Romangestalt, sondern nur symbolisch-archetypisch konstruiert sein.60 Zugleich ist der kleine Motl eine relationale Figur. Er steht zwischen allen Erwachsenen ; als wahrnehmende Instanz beĳindet er sich aber auch zwischen dem Erzähler und dem Leser. Wie antworten nun die Illustrationen auf diese speziĳische Seinsweise, die Sholem Aleichem dem kleinen Motl zugedacht hat ? In sieben der fünfzehn Illustrationen ( das Titelblatt nicht mitgerechnet ) taucht Motl als konkrete Figur auf. Nur einmal, beim Kwass-Verkaufen, ist er allein ( Ill. 8 ). In allen anderen Fällen ist er Bestandteil der Situationen, die Szalit-Marcus einfängt. Gezeigt wird er in Abhängigkeit von den Personen und Umständen, die unmittelbaren Einfluss auf ihn haben. ( Selbst im Einzelportrait wird er vom riesigen Kwass-Krug, der auf Elye verweist, dominiert. ) Auf der Inhaltsebene der Bilder ist Motl nicht autonom, wohl aber auf der Ausdrucksebene, also ästhetisch : Motl sieht immer anders aus : Seine Wandelbarkeit im Bild entspringt und entspricht Sholem Aleichems Leitgedanken, ihn als Prinzip › Leben ‹, als Leben als solches zu gestalten. Motl steht dank der ästhetischen Gestaltung der Illustrationen Pinye am nächsten. Erneut tritt Szalit-Marcus ’ Sensibilität für die sprachlich-rhetorisch gestalteten Sinnlinien von ‫מאטל פּײסי דעם חזנס‬ ָ zutage : Wie Pinye ist auch Motl im Text hyperbolisch konzipiert. Sein Hymnus auf den Frühling am Beginn des Romans ist durch Wiederholungen und Steigerungen auf eine hyperbolische Note gestimmt.61 Ein überschwängliches Glücksgefühl ist gleichmäßig auf Motl und Meni, das Kälbchen, verteilt. Diese Korrespondenzbeziehung zwischen Kind und Kalb übernehmen in der Illustration die Farbe Weiß und die dynamische Figurengestaltung ( s. Abb. 1 ) : Sie überbrücken die Grenzen zwischen Mensch und Tier und betonen das Einende, nämlich das junge Leben. Mit seinen hochgerissenen Armen ist Motl gleichsam die Visualisierung des Freudengesangs, der beim ekstatischen Erleben der Natur aus ihm herausbricht. Vor einem bewegten Bildgeschehen im Hintergrund – die Punktierungen sind stark, es gibt weder gerade Linien noch klare Grenzen – erscheinen Motl und das Kalb als Inkarnationen des Glücks. 59 Miron 1978 : 156, s. auch 145 und 148. 60 Ibid. : 178. 61 Sholem Aleichem 1953 : 11f. 226 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬# ‫לקט‬ Sholem Aleichem, der Schriftsteller, und Szalit-Marcus, die bildende Künstlerin, sympathisieren beide mit Motl, dem Kind, und Pinye, dem Kind gebliebenen Luftikus. Die Hyperbel ist dabei das zentrale ästhetische Verfahren und das entscheidende emotionale Vehikel : » while lyricism and hyperbole signify health and movement, caricature and description by comic synecdoche indicate morbidity and immobility. «62 Die innere Verwandtschaft zwischen Motl, den Sholem Aleichem als angehenden Künstler entwirft, und Pinye, dem dichtenden › Berufsgenossen ‹ Sholem Aleichems, steckt also im wort- und bildkünstlerischen Detail. In der Illustration ‫ארן קײן ַאמעריקע‬ ָ ‫ ( מיר‬Wir fahren nach Amerika ) werden der Kutscher, Motl und Pinye mit einer Diagonale von links unten nach rechts oben von den übrigen Figuren abgetrennt. Während Elye und die übrigen Gestalten die Augen geschlossen halten, blicken der Kutscher, Motl und Pinye erhobenen Hauptes gen Westen und damit in die Zukunft. Neben die Perspektive auf Motl tritt die Sichtweise aus Motls Perspektive. In den Bildern, in denen er nicht abgebildet wird, ist er als Standpunkt vertreten, den die Graphikerin zu den Figuren einnimmt. Motl wird damit nicht nur als Romanĳigur und Gegenstand des Inhalts ins visuelle Medium übersetzt. Er wird es auch als Wahrnehmungsorgan, als Erzählperspektive und damit als Form gebendes Romanelement. Motl ist in Rede übersetztes Sehen ; als solcher ist er auch in denjenigen Illustrationen anwesend, in denen er nicht gezeigt wird, sondern aus dessen Sicht die Künstlerin andere Figuren ( die Nachbarin, die böse Jüdin etc. ) zeigt.63 Denn eines dürfen wir nicht vergessen : Motl zeichnet.64 6. Die letzte Illustration oder : Kein Abschied vom Text ‫אײך ַאוועקגעגעבן ַאלע שטײנער ון‬ ַ ‫וואלט‬ ָ ‫איך‬ ‫ארבן‬ ַ ‫אר אײן קעסטל‬ ַ ‫גאנצער וועלט‬ ַ ‫דער‬ ‫האב‬ ָ ‫ איך‬.‫מאלן‬ ָ ‫מיט ַא בערשטעלע אויף צו‬ ‫לאנג מיט ַא שטיטל‬ ַ ‫אויסגעמאלט ַא שיף נישט‬ ָ ‫ליאסטרע‬ ַ ‫כא‬ ַ ‫ ַא שיף מיט ַא‬,‫פּאפּיר‬ ַ ‫אויף‬ ‫דאס‬ ָ ‫האב‬ ָ ‫ איך‬.‫ קעפּ אויף קעפּ‬,‫גראנטן‬ ַ ‫עמי‬ .[ . . . ] ‫גאלדעלען‬ ָ ‫מאלעכטס ַאוועקגעשענקט‬ ָ 62 63 64 die Alle Steine der Welt würde ich hingeben für einen Farbkasten und einen Pinsel, um zu malen. Neulich habe ich mit einem Bleistift ein Schiff auf Papier gezeichnet, ein Schiff mit einer Gruppe von Emigranten, Kopf an Kopf. Das Bild habe ich Goldele geschenkt [ … ]. Miron 1978 : 169. Zum Einsatz der Perspektive in Literatur und Malerei s. Uspenskij 1975. Der zeichnende Motl ist autobiographisch motiviert. ‫מאטל פּײסי דעם חזנס‬ ָ stellt zugleich Fortsetzung der beiden Künstlerromane ‫ ( סטעמפּעניו‬Stempenyu, 1888 ) und ‫יאסעלע‬ ָ ‫לאווײ‬ ָ ‫סא‬ ָ ( Yosele die Nachtigall, 1889 ) dar ( Miron 1978 : 122 ). Sabine Koller : Mentshlekh un stsenes 227 So spricht Motl, nachdem das Schiff mit seinen ehemaligen Nachbarn an Bord ausgelaufen ist.65 Die Abschiedsszene am Hafen wird also gleich zweimal bildlich festgehalten : Zum einen geschieht dies im Text durch den zeichnenden Motl, wobei diese Bebilderung immer im Status des Imaginären verbleibt ( es ist an uns Lesern, uns vorzustellen, wie sie wohl aussehen mag ). Zum anderen konkretisiert Rahel SzalitMarcus in der letzten Illustration die Emigration nach Amerika ( s. Abb. 5 ). Naive Züge erinnern an Motl, den ĳiktiven Urheber des Bildes. Die Familie, die rechts im Bild das Schiff besteigt, könnte ein Kind gezeichnet haben. Doch überwiegt der Duktus einer erwachsenen, erfahrenen Künstlerin, in den sie – anders als die literarische Vorlage – etablierte und erhabene ästhetische Formeln der europäischen und der ostjüdischen Kunst aufnimmt. Im Text ist die Passage aufgrund ihrer rhythmischen und asyndetischen Struktur von hoher Dynamik. Nach dem letzten Hupen des Schiffes, das Motl an eine Tierstimme erinnert, haben es nicht nur die Menschen, sondern auch die Sätze eilig : 66 ‫זאל זיך שוין‬ ָ ‫ מע‬,‫דאס הוידעט מען ון שיף‬ ָ ‫קושערײ‬ ַ ‫לויערײ מיט ַא‬ ַ ‫ עס ווערט ַא‬.‫געזעגענען‬ ! ‫טעאטער און גענוג‬ ַ ‫מיט ַא געווײן — ַא‬ Da wogt es vom Schiff her, man möge nun Abschied nehmen, und schon hebt ein Gerenne und Geküsse und Geweine an – kurzum, reines Theater Zwar fließen ( auf der Inhaltsebene ) die Abschiedstränen, doch erzeugen hyperbolische und lautmalerische Elemente ( auf der Ausdrucksebene ) eine komische Stimmung.67 Die Trennung ist für Motl ein » Theater «. Er ist nicht traurig, sondern neidisch.68 Die Illustratorin teilt den heiteren Tenor der Textstelle nicht. In der Hektik des Abschieds verlieren die Gestalten ihre im Text vorhandene Konkretheit – weder Elye, Brokhe noch Motl sind auf dem Bild auszumachen, im Vordergrund taucht erneut die trauernde Mutter als Symbolĳigur auf. Die Figuren der Illustration gerinnen zu Archetypen der conditio judaica von Exil und ewiger Wanderschaft. Diesen Ton in Moll gibt der historische und soziokulturelle Kontext vor, in dem die Künstlerin sich zum Zeitpunkt der Anfertigung der Gravuren beĳindet : Die Geschichte der Ostjuden zu Beginn der 1920er Jahre ist in erster Linie eine Geschichte des Verlusts. Gerade der Verlust der Heimat, der 65 Sholem Aleichem 1953 : 189. 66 Ibid. : 177. 67 Auch Pinyes und Elyes vorausgehender Disput über Amerika und Kanada ist von großer Komik ( s. ibid. ). 68 Ibid. 228 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬# ‫לקט‬ den kleinen Motl im Text wenig kümmert, verleiht der letzten Illustration eine leise Melancholie. Hier schimmern Bilder des Unterwegsseins und Klagens durch, wie sie die polnisch-jüdische Malerei als Reaktion auf die vielen Pogrome und Vertreibungen im 19. und 20. Jahrhundert hervorgebracht hat : Leon Pilichowski, Maurycy Gottlieb oder Maurycy Minkowski haben, meist in realistischer Manier, ein Inventar jüdischer ( Opfer- )Darstellungen erstellt, das in Rahel Szalit-Marcus ’ Gestaltung mitschwingt.69 Über diesen konkreten historischen Bezugsrahmen hinaus enthält die Illustration etwas Biblisches. Hier geht es um das jüdische Volk, nicht um ein Einzelschicksal. Hier scheint eher das Wehklagen der Propheten denn das Werk eines Humoristen zugrunde zu liegen. Diese zeitlos-prophetische Patina überzieht die Gestalten, ihr Mienenspiel und ihre Gestik. Sie erinnern an Jacob Steinhardts Judenköpfe.70 Vor allem jedoch gemahnen sie an Jankel Adler, dessen mystischer Expressionismus in Ostatnia godzina rabiego Eleazara ( Die Todesstunde des Rabbi Eliezer ; um 1918 ) El Greco fortsetzt. Rahel Szalit-Marcus ’ Illustrationen zu Sholem Aleichem sind vom jüdischen Expressionismus, wie er aus der Begegnung von deutschem Expressionismus und ostjüdischchassidischer Glaubenserfahrung hervorging, nicht unberührt.71 Rahel Szalit-Marcus verankert ihre Illustrationen zu Sholem Aleichems ‫מאטל פּײסי דעם חזנס‬ ָ in ihrer osteuropäisch-ostjüdischen Heimat. Zugleich macht sich in der letzten Illustration das deutsch-jüdische künstlerische Umfeld bemerkbar. Vielleicht gestaltet Rahel Szalit-Marcus ihre Hypostasierung von Mutter und Kind angeregt durch Käthe Kollwitz. Kollwitz, wie Steinhardt ebenfalls Mitglied der Secession, fertigt eine Reihe von Mutter-Kind-Zeichnungen an ; viele ihrer graphischen Werke durchzieht eine Körpersprache der Schutzlosigkeit und der Bedürftigkeit. Hier berühren sich die beiden Künstlerinnen. Doch ist das links im Bild nicht der zuversichtlich lächelnde Pinye ? Sholem Aleichem, der “ ‫שרײבער‬ ַ [ ‫הומאריסט ] און‬ ָ „ ( Humorist und Schriftsteller ), wie er sich selbst nannte, wird von diesem wirkmächtigen künstlerischen Kontext, in dem der expressionistische Ausdruckswille eine empathisch-tragische Note erhält, nicht völlig verdrängt. In ‫מיר‬ ‫בײם שיף‬ ַ ‫ליאסטרע‬ ַ ‫כא‬ ַ ‫ געזעגענען זיך מיט דער‬mag die Abweichung von der 69 Vgl. beispielsweise Pilichowskis Jom Kippur ( vor 1910 ), Maurycy Minkowskis Nach dem Pogrom ( 1905 ) und Die Vertriebenen ( 1916 ) oder Maurycy Gottliebs Betende Juden an Jom Kippur in der Synagoge ( 1878 ). 70 Vgl. Steinhardts Judenkopf ( 1913 ) und sein Betender Jude ( 1916 ). Steinhardt, der 1933 nach Palästina emigrierte, war wie Szalit-Marcus Mitglied der Secession und Mitbegründer der Gruppe der Pathetiker ( Pfefferkorn 1972 : 104 ). 71 S. Stolarska-Fronia 2010 : 313 – 317. Sabine Koller : Mentshlekh un stsenes 229 literarischen Vorlage am größten sein. Doch wird sie nie zum Verrat : Im Rückgriff auf das ästhetische und emotionale Potenzial der west- und ostjüdischen Kunst zu Beginn des 20. Jahrhunderts weitet Rahel SzalitMarcus ihre Deutung von ‫מאטל פּײסי דעם חזנס‬ ָ bis zu dem Punkt aus, an dem Sholem Aleichems Weltanschauung offenbar wird : Rahel SzalitMarcus spürt den schmalen Grat, auf dem sich sein Amerika-Roman zwischen Tragischem und Komischem bewegt.72 Im Sturm der Zeiten verschwindet daher Sholem Aleichems Lachen, das mit dem Leben versöhnt, weder aus dem Text noch aus dem Bild. Zitierte Literatur Bal-Makhshoves, 1922 : » Bagleytvort. « In : Rahel Szalit-Marcus, Mentshelekh un stsenes : zekhtsn tseykhenungen tsu Sholem-Aleykhems verk Motl Peyse dem khazns yingl. Berlin : Klal-Farlag. – 1953 : » Sholem-Aleykhem. « In : Ders., Geklibene verk. New York : tsiko, 172 – 190. Buisson, Sylvie, Hg., 2007 : Montparnasse déporté. Artisti Europei da Parigi ai Lager. Turin : Elede. Chagall, Marc, 1951 : » Far di kinstler kedoyshim. « In : Hersh Fenster, Hg., Undzere farpaynikte kinstler. Paris : [ Selbstverlag ], o. S. Dohrn, Verena, und Pickhan, Gertrud, Hg., 2010 : Transit und Transformation. Osteuropäisch-Jüdische Migranten in Berlin 1918 – 1939. Göttingen : Wallstein Verlag. ( Charlottengrad und Scheunenviertel, 1 ) Ėrenburg, Il ’ja G., 1962 : Menschen. Jahre. Leben. München : Kindler [ russ. Original : Ėrenburg, Il ’ ja G., 1990 : Ljudi. Gody. Žizn ’ . Moskva : Sovetskij pisatel ’ .] Erlich, Victor, 1964 : » A Note on the Monologue as a Literary Form : Sholem Aleichem ’ s › Monologn ‹ – A Test Case. « In : For Max Weinreich on his Seventieth Birthday : Studies in Jewish Language, Literature, and Society. London – Den Haag – Paris : Mouton & Co, 44 – 50. Estraikh, Gennady, 2006 : » Vilna on the Spree : Yiddish in Weimar Berlin. « In : Aschkenas. Zeitschrift für Geschichte und Kultur der Juden 16 : 103 – 127. – und Krutikov, Mikhail, Hg., 2010 : Yiddish in Weimar Berlin. At the Crossroads of Diaspora Politics and Culture. Oxford : Legenda. ( Studies in Yiddish, 8 ) Fenster, Hersh, 1951 : Undzere farpaynikte kinstler. Paris : [ Selbstverlag ]. Genette, Gérard, 1998 : Die Erzählung. 2. Aufl. München : Fink. 72 Vgl. Peretz 1947 : 301 – 304. 230 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬# ‫לקט‬ Harshav, Benjamin, 2003 : Marc Chagall on Art and Culture. Stanford : Stanford University Press. Kenig, Leo, 1929 : » Mark Shagal un Sholem-Aleykhem. Etyud. « In : Ders., Shrayber un verk. Etyudn un shtrikhn. Wilna : Kletskin, 27 – 31. Koller, Sabine, 2012 : » On ( Un )Translatability : Sholem Aleichem ’ s Ayznban-geshikhtes ( Railroad Stories ) in German Translation. « In : Gennady Estraikh, Mikhail Krutikov, Kerstin Hoge und Jordan Finkin, Hg., Translating Sholem Aleichem. History, Politics, and Art. Oxford : Legenda, 134 – 149. Kühn-Ludewig, Maria, 2008 : Jiddische Bücher aus Berlin ( 1918 – 1936 ). Titel, Personen, Verlage. 2. Aufl. Nümbrecht : Kirsch. Loytsker, Kh[ ayim ], 1939 : » Humor in Sholem-Aleykhems shprakh. « In : Visnshaft-akademye fun ussr, Hg., Afn shprakhfront, Bd. 4. ( Sholem-Aleykhem-zamlung ). Red. Elye Spivak. Kiev : Farlag fun visnshaftakademye fun ussr, 17 – 80. Malinowski, Jerzy und Brus-Malinowska, Barbara, 2007 : W kręgu École de Paris. Malarze żydowscy z Polski. Warschau : Wydawnictwo DiG. Malinowski, Jerzy, Piątkowska, Renata, und Sztyma-Knasiecka, Tamara, 2010 : Jewish artists and Central-Eastern Europe : Art Centers, Identity, Heritage from the 19th Century to the Second World War. Warschau : Wydawnictwo DiG. Martinez, Matias, und Scheffel, Michael, 2003 : Einführung in die Erzähltheorie. 4. Aufl. München : C. H. Beck. Miron, Dan, 1972 : Sholem-Aleykhem : Person, Persona, Presence. New York : yivo Institute for Jewish Research. ( Neu abgedruckt in : Ders., 2000 : The Image of the Shtetl and other Studies of Modern Jewish Literary Imagination. Syracuse, NY : Syracuse University Press, 128 – 156. ) – 1978 : » Bouncing Back. Destruction and Recovery in Sholem Aleichem ’ s Motl Peyse dem khazns. « In : yivo Annual of Jewish Social Science 17 : 119 – 184. ( Neu abgedruckt in : Ders., 2000 : The Image of the Shtetl and other Studies of Modern Jewish Literary Imagination. Syracuse : Syracuse University Press, 179 – 255. ) Peretz, Yitskhok Leybush, 1947 : » Sholem-Aleykhem. « In : Ders., Ale verk, Bd. 6. New York : tsiko, 301 – 304. Pfefferkorn, Rudolf, 1972 : Die Berliner Secession. Eine Epoche deutscher Kunstgeschichte. Berlin : Haude und Spener. Rusel, Jane, 1997 : » Jacob Steinhardt und Joseph Budko : Eine vergleichende Betrachtung. « In : Daniela Christmann, Gabriele Kiesewetter, Otto Martin und Andreas Weber, Hg., Rücksicht. Festschrift für HansJürgen Imiela zum 5. Februar 1997. Mainz : Herrman Schmidt, 213 – 219. Safran, Gabriela, 2012 : » Four English poets and the evolving translatability of Sholem Aleichem. « In : Gennady Estraikh, Mikhail Krutikov, Sabine Koller : Mentshlekh un stsenes 231 Kerstin Hoge und Jordan Finkin Hg., Translating Sholem Aleichem. History, Politics, and Art. Oxford : Legenda, 113 – 133. Schwarz, Karl, 1920 : » Rahel Szalit-Marcus. « In : Ost und West 3 – 4 : 74 – 77. Sennewald, Adolf, 1999 : Deutsche Buchillustratoren im ersten Drittel des 20. Jahrhunderts. Materialien für Bibliophile. Wiesbaden : Harrassowitz. Sholem Aleichem, 1953 : Ale verk. Bd. 4 : Motl Peyse dem khazns. Ksovim fun a yingl a yosem. Ershter teyl : fun der heym keyn Amerike. Buenos Aires : ikuf-farlag. Stiftung Jüdisches Museum Berlin, Hg., 2012 : Berlin Transit. Jüdische Migranten aus Osteuropa in den 1920er Jahren. Göttingen : Wallstein Verlag. ( Charlottengrad und Scheunenviertel, 3 ) Stolarska-Fronia, Małgorzata, 2010 : » Jewish Expressionism – a Quest for Cultural Space. « In : Jerzy Malinowski, Renata Piątkowska, und Tamara Sztyma-Knasiecka, Hg., Jewish Artists and Central-Eastern Europe : Art Centers, Identity, Heritage from the 19th Century to the Second World War. Warschau : Wydawnictwo DiG, 313 – 317. Süssmann, Roland S., 2006 : » Montparnasse déporté. « In : Shalom. Le magazine juif européen 45. ( Online unter http ://www.shalom-magazine. com/Print.php ?id=450215 ; 11.3.2012. ) Szalit-Marcus, Rahel [ Rokhl Shalit-Markus ], 1922 : Mentshelekh un stsenes : zekhtsn tseykhenungen tsu Sholem-Aleykhems verk Motl Peyse dem khazns yingl. Berlin : Klal-farlag. Tynjanov, Jurij N., 1982 [ 1922 ] : » Illustrationen. « In : Ders., Poetik. Ausgewählte Essays. Leipzig/Weimar : Kiepenheuer, 184 – 195. ( russ. : Tynjanov, Jurij N., 1977 : » Illjustracii. « In : Ders., Poėtika. Istorija literatury. Kino. Moskau : Nauka, 310 – 318. ) Uspenskij, Boris A., 1975 : Poetik der Komposition. Struktur des künstlerischen Textes und Typologie der Kompositionsform. Frankfurt a. M. : Suhrkamp. ( russ. : Uspenskij, Boris A., 2000 : Poėtika kompozicii. Struktura chudožestvennogo teksta i tipologija kompozicionnoj formy. 3. Aufl. Sankt-Peterburg : Azbuka. ) Alyssa Quint Avrom Goldfaden ’ s Sheygets Theater Introduction Most historians of the Yiddish theater still refer to Avrom Goldfaden as the father of the Yiddish theater, or, when aspiring to scholarly distance, the so-called father of the Yiddish theater. The self-conscious qualiĳication is a way of acknowledging that such language lends itself better to mythology than to social history. “ Fatherhood, ” of course, implies Goldfaden ’ s pride of place as the ĳirst to write and stage modern Yiddish theatrical productions and manage a commercially sustainable acting troupe. But in fact, the notion of “ fatherhood ” both overestimates Goldfaden ’ s personal role in the development of Yiddish theater and understates the historical signiĳicance of his achievement by turning Yiddish theater into nothing more than a Jewish family affair. The conventional reading claims that Goldfaden “ fathered ” the Yiddish theater in Iasi, Romania in 1876 and, following his return to Russia, led two troupes on a tour of the empire ’ s southwestern provinces. In 1880, Goldfaden secured permission to stage his work in the interior, where Jewish residence was still highly restricted, and his theater enjoyed extended spells in Moscow and St. Petersburg. At the end of 1883, the government placed a ban on Yiddish theater. As a result, a substantial number of the best actors, playwrights, and producers of the fledgling Yiddish stage left – many of them for America. Goldfaden attempted to build a theater business in Warsaw but met with limited success. By the time Goldfaden decided to go to America in 1888, it became clear that he had waited too long : his competitors as well as the members of his own troupe had already turned New York into the center of Yiddish theater without him. Furthermore, his former actors retained the memory of his abusive treatment and general egomania. Now in America, these same actors organized themselves anew ( and would eventually form the very ĳirst actors ’ union in the United States ), and when their old boss arrived, they turned Goldfaden away.1 The sting of their rejection colored the rest of Goldfaden ’ s days. Even as he re1 For more on the Yiddish Actors Union see yivo 2009. 234 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ turned to Europe, ĳirst with the idea of producing Yiddish theater in Paris and other European cities, it was clear to Goldfaden that New York was the center of his world. He was in close and anxious touch with his few supporters and friends there. By 1900, New York-based Yiddish actors banded together to raise money for Goldfaden, who they heard was living in penury, and from then on sent annual stipends to his residence in Paris. He returned to the United State in 1903 and died in 1908.2 From 1888 to 1908, among a number of intellectual and artistic projects, theater-related and otherwise, which Goldfaden took on, he expended great effort on shoring up and deĳining his legacy. He pursued this agenda in his letters and in conversation with colleagues. He also wrote no fewer than eight autobiographical works, seven sketches and one more detailed autobiography that, as he explains, doubles as a detailed history of the modern Yiddish theater.3 It is punctuated by such abstract statements as, “ The whole theater turned on my ‘ I ’ ” that lay claim to the theater as his singlehanded accomplishment. Goldfaden generated about a hundred pages of this account, but either he never made it past the early year of 1878, or the rest of the document was lost. What survives was edited by the Yiddish theater historian Sholem Perlmutter and published in the Philadelphia-based Yiddish-language daily newspaper The Jewish Daily twenty-one years after Goldfaden ’ s death. In fact, rather remarkably, in eight attempts at writing his autobiography Goldfaden never moves beyond the ĳirst two years of his career in Romania with any detail. Among his autobiographies, ‫ון שמענדריק ביז‬ ‫ בן ־ עמי‬, published in ‫מעריקאנער‬ ַ ‫ דער ַא‬in 1907, underscores the close relationship he drew in his mind between his need to ingratiate himself 2 For more on Goldfaden during his ĳinal years, see the collected documents in Goldfaden-bukh 1926 and Shatzky 1930. 3 In Goldfaden-bukh 1926 Shatzky contextualizes four of Goldfaden ’ s autobiographical pieces in a short introductory essay. The ĳirst dates to 1887 and was published in Goldfaden ’ s own short-lived periodical entitled ‫צײטונג‬ ַ ‫יארקער אילוסטרירטע‬ ָ ‫ ; ניו ־‬the second was revised and published by Mordkhe Spektor as a third-person-history of the Yiddish theater and published in ‫רײנד‬ ַ ‫ הויז ־‬in 1887 ; the third was published in ‫ווארהייט‬ ַ soon after his death in 1908 ; and the fourth he completed in 1901 in Paris and published in three segments in a quarterly called ‫ מיניקעס בלעטער‬that same year. The 7th and 8th autobiographies are re-published and edited by Shatzky in Goldfaden-bukh except for the missing second of three segments ( Shatzky was unable to ĳind a surviving copy of the peysakh installment of Minikes bleter ). “ Shatzky was the ĳirst scholar to point out that Goldfaden ’ s copious autobiographical forays were tied to his experience in America. Apparently in 1926 Shatzky did not know about yet another autobiographical project Goldfaden had undertaken, which would have been the longest if it had been completed. See Shatzky 1926. Moyshe Shtarkman published an autobiographical piece by Goldfaden entitled “ Fun Shmendrik biz Ben-Ami ” ( Shtarkman 1930 ). This one was quite obviously written to justify his play Ben-Ami, which he wrote late in his life in reaction to the Kishinev Pogroms of 1903 and desperately wanted to see on the American Yiddish stage. It was ĳinally staged during the ĳinal weeks of his life. The eighth is described in the body of the text above. Alyssa Quint : Avrom Goldfaden’s Sheygets Theater 235 to an American audience and what he achieved in presiding over the Yiddish theater during those ĳirst years. Read together and alongside his dramatic works, Goldfaden ’ s autobiographical writings, letters, and conversations draw our attention to a set of cultural questions that intersect with the production of Yiddish theater in nineteenth-century Eastern Europe, including what I would dub the Yiddish theater ’ s gentile problem. Goldfaden ’ s version of his life was dominated by his persona as a father : ĳirst caring for an institution made up of an audience and actors both equally childlike, and then, later, abandoned by his ungrateful children – by which he means the actors who established themselves in New York theaters. His gripes with his former actors dovetailed with the frustration of many members of New York ’ s Jewish intelligentsia over the absence of either artistic sophistication or ideological commitment in the New York Yiddish theater. Nina Warnke sets this parallel out nicely in her deĳinitive article on the New York Yiddish theater scene of the 1890s, “ The Child Who Wouldn ’ t Grow Up, ” in which the metaphor of the theater as a child was often bandied about by critics and playwrights alike.4 The lack of socialist or artistic commitment, however, was not Goldfaden ’ s issue. Goldfaden ’ s vitriol was churned by the rising fame, opportunity and income of actors he had once cultivated and held under his thumb. The expression of his complaints, however, is sometimes vague and has a coded quality. In a letter to the writer Isaac Dineson, for instance, Goldfaden depicts himself as an Old-World immigrant “ whose children have, when he joined them in the New World, turned their backs on all the sacriĳices he made for them in the past. ” He gestures, however, to more than just his rebellious actors.5 ,‫כאטש איך ווײס ניט צו וועמען‬ ָ ,‫האב איך‬ ָ ‫טענות‬ ‫וואקסט אויס ַא גוטער‬ ַ ‫מײנס‬ ַ ‫דאס ליב קינד‬ ָ ‫וואס‬ ָ ‫ און איך מעג זיך‬,‫ ַאן עזות ־ מחוצף ־ פּנים‬,‫שייגעץ‬ ‫טאטן‬ ַ ‫מאל שעלטן אין‬ ָ ‫ ַאז מען וועט מיך ַא‬,‫ריכטן‬ ‫האב‬ ָ ‫וואס איך‬ ָ ,‫טײערן תּכשיט‬ ַ ‫אר דעם‬ ַ ‫רײן‬ ַ ‫ַא‬ .‫געבראכט‬ ַ ‫אויף דער וועלט‬ But I have a complaint, although I don ’ t know against whom, that my dear child is growing up a sheygets [ non-Jewish male ], an impertinent child and I should prepare myself that some day they will curse me for this precious brat that I brought into the world. Warnke renders sheygets in an idiomatic form, as if Yiddish theater is a ‘ rascal, ’ which accurately reflects the context and tone of the letter. But I suggest that Goldfaden chose this word here for its literal meaning as 4 5 Warnke 2003. Quoted in Zylbercweig 1931 ( i ) : 330. English translation from Warnke 2003 : 203. 236 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ well. In bolder terms, he wrote to the French Jewish writer Adolf Lichtenstein complaining about the plethora of foreign adaptations being performed on the Yiddish stage. “ Guilty for this are our Jewish-authorsanti-Semitic apostates ( ‫ ) יִ ידישע ־ מחברים ־ ַאנטיסעמיטים ־ משומדים‬who have sought to make the stage gentile. ” 6 Here and elsewhere, Goldfaden would associate the post-Goldfaden Yiddish theater of the 1890s and 1900s with apostasy, and invoked the presence of the non-Jew as a dangerous specter haunting the Yiddish culture of performance. Against the background of American fears about assimilation, Goldfaden went on to portray himself as the defender of the theater ’ s Jewish honor. In his autobiography and elsewhere, Goldfaden sought to establish himself as the theater ’ s legitimate father, and its sole Jewish proprietor. Furthermore, alongside the looming sheygets threat he obscured the full picture of the Yiddish theater ’ s ĳirst years – one which included a host of robustly competitive producers, writers, and actors working with and against each other throughout the seven formative years of modern Yiddish theatrical life in Romania and Russia ( 1876 – 1883 ). That is, while a number of these early founders had relationships with Christianity, Goldfaden ’ s description of them as constituting a gentile threat is a framework he cultivated years later in America. Before 1883, anxieties that attached themselves to a “ gentile threat ” were of a subtler complexion, as evidenced in Goldfaden ’ s own dramatic work, especially his celebrated historical operetta Dr. Almasada or the Jews of Palermo ( 1880 ). But, as this paper will show, Goldfaden was more right than he knew, for the origins of the Yiddish theater were bound up with the social construction of its “ gentile ” otherness, both threatening and deeply seductive, both on the stage and off. Part i : Christianity and the Players of the Yiddish Theater ( 1876 – 1883 ) 7 If you were to mention the Yiddish theater to the Jewish public in Russia in 1880, Goldfaden would immediately come to mind. But if you mentioned it in the more sophisticated Odessa circles, they would think of 6 Shtarkman 1926 : 74. 7 The ĳirst period of the Yiddish theater is bookended by Goldfaden ’ s ĳirst Yiddish-language vaudeville productions in Iasi ( 1876 ) at the beginning and the Czarist ban on Yiddish theater enacted in the Russian Empire in October 1883. For a discussion of Christians ( from birth ) who performed on the Yiddish stage see Zylbercweig 1941 : 187 – 193. Zylbercweig remarked on converts and the Yiddish theater in an article about himself as a lexicographer. See Shepard 1964. Alyssa Quint : Avrom Goldfaden’s Sheygets Theater 237 Yoysef Yehude ( Osip ) Lerner ( 1849 – 1909 ). Yet, despite the important contemporary role that Lerner had played in the world of Yiddish culture, what we know of his biography is sketchy and contradictory. He was born in Berdichev in 1847 to traditional parents who sent him to ‫ חדר‬and then to a secular Russian high school. As a young man he studied law, but after receiving his degree settled in Odessa, where he devoted himself to literary and journalistic work in Russian, Hebrew, and Yiddish. Among his early writings is an 1868 Russian-language pamphlet that champions the Yiddish language for its literary potential and includes an appreciation of one of modern Yiddish literature ’ s ĳirst serious writers, Israel Aksenfeld. Lerner ’ s efforts on behalf of Yiddish predate Sholem Aleichem ’ s ‫ביבליאטעק‬ ָ ‫אלקס ־‬ ָ by more than twenty years.8 In 1877 – 1878, Lerner was in Romania reporting on the Russo-Turkish War for a Russian newspaper ; there, he observed Goldfaden ’ s troupe at ĳirsthand. He returned to Odessa to produce Yiddish theater, but his productions had higher artistic aspirations than the shows produced by Goldfaden. He staged over a dozen plays, trying for success with highbrow literary material ( which he personally translated into Yiddish ) or works in the tradition of the modern Yiddish closet dramas penned earlier in the century for consumption in Russian salons. Nokhem Meyer Shaykevitsh ( also an active theater producer in the Russian Empire during this period, before he became famous for his pulp ĳiction novels ) claims that although Goldfaden was the ĳirst to stage Yiddish plays in Romania, the theater blossomed into its true artistic form only under the hand of Lerner in Odessa, particularly in the city ’ s premier venue, the Mariinsky Theater. Shaykevitsh writes in 1891 : 9 From then on [ that is, from 1880 ], the Yiddish theater began to bloom. Mr. Lerner translated the renowned plays La Juive, Uriel Acosta, and Deborah into Yiddish and staged them in their full splendor. He spared no cost on the costumes, and the sets, and hired Mr. Grodsky, who studied theater in Vienna, to teach the actors how to deliver their lines and how to act. Lerner was baptized sometime in the 1890s ( no source provides a deĳinite date ), but according to the literary lexicographer Zalmen Reyzen, who offers a sensitive ĳirst glance at this ĳigure, the contradictions predated his apostasy by decades. ‫מענדעלסאהן‬ ָ ‫ ( דער עטער משה‬Uncle Moses Mendelssohn ), for instance, apparently staged during the Yiddish the8 For the most comprehensive biography of Lerner, see Reyzen 1926 – 1929 ( iii ) : 269 – 278 and Lerner ’ s Aksenfeld essay ( Lerner 1868 ). 9 Shomer 1901. 238 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ater ’ s ĳirst period ( 1876 – 1883 ), conĳirms this theory. The play reflects his strong dual interest in both Yiddish culture and radical assimilation. In it the German-Jewish philosopher is portrayed as a wise and doting uncle to Esther, who converts to Christianity in order to marry Heinrich, with whom she has fallen in love. Mendelssohn admonishes her – not because her apostasy is morally wrong, as he explains to her, since “ in the world of ideas there are no differences between religious beliefs, ” but because her baptism is too hard emotionally for her traditional father to bear. And Mendelssohn continues : 10 ‫געווארן ַא‬ ָ ‫ביסט דו דען אויס איבערצ&גונג‬ ‫האסט ד&ן גלויבן‬ ָ ‫קריסטין ? געוויס ניין ! דו‬ ‫דײן ליבע‬ ַ ‫קאנען‬ ָ ‫זאלסט‬ ָ ‫נאר צוליב דעם‬ ָ ‫געביטן‬ ‫מאכן און אין דעם ביסטו שולדיק‬ ַ ‫געזעצלעך‬ ‫אויגאבע ון יעדן בעסערן מענטשן‬ ַ ‫וו & ל די‬ ‫ארבעסערן די‬ ַ ‫זאל זוכן‬ ָ ‫אך — ער‬ ַ ‫יעדן אין ז&ן‬ ‫באדערעניש‬ ַ ‫רעליגיאן איז ַא‬ ָ ‫ די‬.‫לאגע ון ַאלע‬ ַ ‫דאס איז ַא מלבוש‬ ָ ,‫ראלישן מענטשן‬ ַ ‫מא‬ ָ ‫ון יעדן‬ ‫אלק‬ ָ ‫וואס יעדעס‬ ָ ‫קאלירן‬ ָ ‫ארשידענע‬ ַ ‫ון‬ ‫דאס מלבוש‬ ָ ,‫נאקעט ל&ב‬ ַ ‫דעקט דערמיט צו ז&ן‬ ‫מאל מער גערייניקט און מיט דער‬ ָ ‫ווערט ַאלע‬ ‫ארשוווּנדן ווערן און‬ ַ ‫ארבן‬ ַ ‫צ&ט וועלן ַאלע‬ ‫באדעקן די‬ ַ ‫מאנטל ון אמת און שׂכל וועט‬ ַ ‫אײן‬ ‫האבן ַא חלק‬ ָ ‫קאנסטו דען‬ ָ . . . ‫גאנצע מענטשהײט‬ ַ ‫ ַאז דו נעמסט און‬,‫אין דער שיינער זיסער ַארבעט‬ ‫גאנצן ווי ַאזוי קענסטו‬ ַ ‫דאס מלבוש אין‬ ָ ‫ווארסט‬ ַ ? ‫באטײליקן זיך‬ ַ And are you a believing Christian ? Obviously not. You changed your religion only to make your love lawful with marriage and in this you are guilty, since you have given up on improving the lives of all. Religion is a necessity placed on every moral person. It is a garment ( malbesh ) of many colors that each nation holds tight to its nakedness. With time, this coat will grow purer and with time all the colors will disappear and it will become a single mantle of Truth and Understanding and cover all of mankind… How can you take part in this work if you have thrown your coat off ? Uncle Mendelssohn ’ s abstracted ideas about religion and their interchangeable nature would have been very radical for the Jewish audience of the Yiddish theater in the 1880s. This idea is intriguingly counterbalanced by the uncle ’ s assumption that Esther ’ s conversion to Christianity is not genuine. Lerner seems to be working out very personal questions in this work. Reyzen describes Lerner ’ s own apostasy as, on the one hand, shocking in light of his intense commitment to Yiddish literature and language, but also of a piece with a second literary life Lerner apparently pursued alongside his career in Yiddish and Hebrew, in ( non-Jewish ) Russian newspapers and books. A former student of Lerner ’ s from his days as a teacher in Odessa claims that Lerner wrote anti-Semitic articles published in the Novyi Telegraf and other journals and newspa10 Lerner 1889. Alyssa Quint : Avrom Goldfaden’s Sheygets Theater 239 pers from the 1870s into the 1890s. Although his entry on this intriguing ĳigure is probing, Reyzen suggests that Lerner ’ s extensive, trilingual literary career demands more attention and analysis. By the turn of the century, more tellingly, Lerner was participating in a collaborative revision of the Yiddish translation of the New Testament.11 Until recently, Yiddish scholars, perhaps embarrassed by his apostasy, had largely excised Lerner from the literary record, with the exception of Reyzen and Nokhem Minkov ( who occupies himself only with Lerner ’ s Yiddish work, not his life or Hebrew and Russian writings ).12 For similar reasons, the unprecedented writing career of Lerner ’ s wife Maria ( née Miriam, 1860 – 1927 ) still awaits scholarly attention.13 She was the ĳirst modern female Yiddish playwright and one of the ĳirst published Yiddish shortstory writers in a literature that has few recognizable female voices. Equally vague is the biography of another convert, by the name of Moyshe Hurvitz ( 1844 – 1910 ).14 Along with his main rival Josef Latayner, Hurvits dominated New York ’ s commercially-driven Yiddish theatrical scene from the last quarter of the nineteenth century into the beginning of the twentieth. Hurvits was born in Galicia in 1844 into a hasidic family but moved to Romania when he was eighteen and eventually became the director of a modern Jewish school in Bucharest. According to Zylbercweig, when he was kicked out, he promptly converted to Christianity and became a missionary. In the earliest surviving newspaper advertisements for Yiddish theater, dating to 1877, his are the only shows represented other than those produced by Goldfaden.15 He wrote and directed some theater in Romania but, according to the early theater historian B. Gorin, Goldfaden undercut him and, as a result, Hurvits eventually left for America.16 11 In Berlin in 1901, the B. F. B. S. invited J. Rabinowitz, W. I. Nelom, and Joseph Lerner, native speakers, respectively, of Bessarabian, Lithuanian and Galician Yiddish, to revise Hershon ’ s New Testament translation. The Mildmay Mission to the Jews ( whose main center was in Whitechapel, London ) distributed one hundred thousand copies of this edition. See Prager 1990 : 558. 12 Compare, remarkably, the entry on Lerner in Zalmen Reyzen ’ s lexicon with the one in the ‫ליטעראטור‬ ַ ‫נײער ייִ דישער‬ ַ ‫לעקסיקאן ון דער‬ ָ ( Yafe 1963 ). 13 See an informative entry on Maria Lerner by Zylbercweig ( 1931 – 1969 ( iii ) : 1169 f ). Included in her work are plays that were censored in St. Petersburg for public performance and contributions to ‫רײנד‬ ַ ‫ הויז ־‬and the ‫ חובבי ־ ציון‬periodical ‫דער וועקער‬. 14 Zylbercweig 1931 – 1969 ( i ) : 591. 15 See Shas-Roman 1930. 16 Gorin 1918 ( i ) : 198. Hurvits ’ s biography is curiously incomplete given the important and extended presence he had on the American Yiddish theater scene. His activities require more investigation and analysis. Latayner ’ s unpublished memoirs and the memoiristic work of Cesar Grinberg, both quoted by Zylbercweig in his lexicon, would go far in providing such details but I have had no success in tracking them down. 240 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ We know even less about Benedict Ben-Tsiyon who was born in 1839 in Kiev and spent time in Romania and Berlin, where he converted in 1863.17 As a Christian, he was allowed to enroll as a student at the University of Würzburg, where he earned his medical degree in 1867. In England, he was in contact with a missionary group and returned to Romania and then to Odessa as one of their emissaries to spread Christianity among Jews. In Odessa, Ben-Tsiyon began writing for the Yiddish theater. There is no evidence that any of his works were actually staged in the Russian Empire, but there are censored manuscripts of his Yiddish plays in the Tomashevski Collection at the New York Public Library ; most – if not all – are adaptations of British novels or plays. After pursuing missionary work for England ’ s Presbyterian Church in Odessa, Ben-Tsiyon moved to New York City. According to Gorin ’ s index of Yiddish productions, eight of his works were produced between 1881 and 1888,18 which does not include The Jewess, staged by the celebrated Yiddish actor David Kessler as early as 1881, and another two plays sold to Boris Thomashefsky in 1884, one of them called The Baptized Daughter. The Russian-Jewish writer Reuven Waisman, who remained Ben-Tsiyon ’ s friend in New York, recounts that Ben-Tsiyon autographed a book of his for Waisman with the following words, “ The former Hornostopolye sexton ’ s son, now in the topsy-turvy world of New York City. Doctor Benedict ( Borekh ) Ben-Tsiyon. ” 19 It is clear that – putting aside his own ambivalence about his religious choices – Ben-Tsiyon pursued an active career as a playwright in the world of Yiddish theater and was tolerated even as an apostate.20 In his account or “ rewriting ” of his early professional experience during his last years in the US, Goldfaden obscures the prominent place of his controversial co-founders. Ben-Tsiyon who at this time continued to enjoy some public attention, is not mentioned at all ; Lerner, whose reputation was alive only in Russia, is mentioned only in passing, as if he had made no contribution. Hurvits, however, a celebrity playwright of the American Yiddish stage, is openly maligned. Goldfaden contends that he met Hurvits in Bucharest in 1877 when Hurvits asked him to look at some dramas he had written for the stage. In his rendering of 17 Some of Ben-Tsiyon ’ s plays are part of the collection of manuscript plays housed in the Jewish Division of the New York Public Library. He is also mentioned by the on-line edition of the 1906 Jewish Encyclopedia under the name “ Benzion, Benedix ” and mentioned in passing in The Westminister, the newspaper published by the Presbyterian Church in an article entitled, “ Presbyterian Church in Odessa, Russia ” ( The Westminister 1905 : 17 ). 18 Gorin 1918 ( ii ) : 233. 19 Quoted in Zylbercweig 1931 – 1969 ( i ) : 187. 20 Ibid. Alyssa Quint : Avrom Goldfaden’s Sheygets Theater 241 their encounter, Goldfaden refers to Hurvits as the “ missionary-writer ” ( ‫מיסיאנער ־ מחבר‬ ָ ‫) דער‬: 21 The author of the play was a missionary, was known as such in Bucharest. When I asked him why he converted, the missionary-writer told me that he was very desperate for work and that his family was subsisting on potato peels, things were so bad. [ … ] And as the new God bought him over for 90 francs a month, he had no choice but to take the position. As he himself was able to appreciate, I could not take his plays to mount on the new fresh Yiddish stage. The audience would think that my theater had converted ! Goldfaden spares no sensational detail regarding his meeting with Hurvits. He explains that as a result of their meeting, “ the missionary ” ( Hurvits ) headed to the local tavern, where he staged his conversion back to Judaism over a lot of schnapps before a quorum of wagon drivers who happened to be hanging around. Such a show apparently earned Hurvits no points ; Goldfaden claims that he outright refused the young Hurvits a job in his theater. The high proĳile he achieved in New York notwithstanding, we know surprisingly little about Hurvits, and there is no competing narrative or biography of Hurvits ’ s meeting with Goldfaden or his path to producing Yiddish theater. This story has been repeated multiple times in Yiddish theater literature, but each rendition quotes Goldfaden ’ s autobiography as its only source. It has never been corroborated, and I would suggest that Goldfaden had plenty of motivation to have imagined retrospectively his indignation at what he presents as Hurvits ’ cynical performance at the tavern. Goldfaden also attacked the Jewish credentials of Jacob Gordin, recognized during his lifetime and by critics ever since as one of the greatest Yiddish playwrights.22 Before arriving in America, however, Gordin had served as a co-founder of the Spiritual-Biblical Brotherhood, which devoted itself to Jewish renewal and communal and agrarian life. While the group wasn ’ t conventionally Christian, it made no claim of continuity with Judaism and was attacked by Jewish enlighteners as a “ profoundly misguided evangelical effort. ” 23 Some found it so hostile to Judaism that they besieged the Brotherhood ’ s headquarters in Elizavetgrad. In her book on Gordin, Rewriting Russia : Jacob Gordin ’ s Yiddish Drama, historian Barbara Henry shows that Gordin himself sought to cover up or dismiss his Brotherhood activities, but that his involvement had, in fact, been extensive. Goldfaden was not alone in 21 Goldfaden 1929 : 7 f. 22 Henry 2011. 23 Ibid. : 52. 242 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ gesturing toward the compromised past that Gordin preferred to keep buried. “ [ G ]ordin ’ s perpetual antagonist Moyshe Leyb Lilienblum ( 1843 – 1910 ) denounced him as a hypocrite : ‘ To the authorities and the Russian press he presented himself as a reformer, and to the Jews he presented himself as a socialist, or a Tolstoyan. ’ ” 24 Raising the specter of the sheygets theater, Goldfaden complained about Gordin to American Yiddish actor and playwright Leon Kobrin soon after he arrived in New York in 1905 : 25 ‫מײן‬ ַ ‫מײן קינד ! גענומען‬ ַ ‫געטאן מיט‬ ָ ‫האט ער‬ ָ ‫וואס‬ ָ ‫ און‬,‫מײן בנימינען‬ ַ ,‫מײן ייִ דיש קינד‬ ַ ,‫געליבט קינד‬ ‫האט ער‬ ָ ‫מײן קדשי ־ קדשים‬ ַ ! ‫אים ָאפּגעשמדט‬ ,‫מיסיאנער‬ ָ ‫גאר ַא‬ ָ ‫דאך‬ ָ ‫ ער איז‬.‫געמאכט‬ ַ ‫מטמא‬ ! ‫טעאטער‬ ַ ‫ווי קומט ער צום ייִ דישן‬ What did he do with my child ! He took my beloved child, my Jewish child, my Benjamin and converted him ! My holy of holies he made impure. He is a missionary ; how did he get involved in the Yiddish theater ? Undoubtedly, the notoriety Goldfaden attributed to the Christian activities of some Yiddish theater players was meant to raise his own proĳile as the guardian of the theater ’ s yidishkayt. Despite his version of the ĳirst period of Yiddish theater, written so many years later, there is no evidence that apostates had been rejected as legitimate sources of ĳinancial support or creative material at any point in the history of the Yiddish theater. Finally, and perhaps most revealing, Shaykevitsh ’ s memoir mentions that Goldfaden and Lerner collaborated to put on plays in Odessa ’ s premier performance venue, the Mariinsky Theater. Their relationship did eventually crumble, but over business matters, not religious debates. Part ii : The Idea of the Gentile on the Yiddish Stage A more reliable source for Goldfaden ’ s ideas about the gentile element on the Yiddish stage may be culled from the character of Alonso, a supposed gentile that occupies a central place in the historical operetta Doctor Almasada ( ‫היסטארישע‬ ָ ,‫לערמא‬ ָ ‫פּא‬ ַ ‫דא ָאדער די ייִ דן אין‬ ַ ‫סא‬ ַ ‫למא‬ ַ ‫קטאר ַא‬ ָ ‫דא‬ ָ ‫ בילדער‬11 ‫ ַאקטן און אין‬5 ‫ ) ָאפּערעטע אין‬26 that Goldfaden ĳirst staged in a modest performance venue in St. Petersburg.27 When it premiered in January 1881 Doctor Almasada struck Goldfaden ’ s critics as weightier than his previous works, which were regarded by many intellectuals as harsh 24 25 26 27 Henry 2011 : 53. Kobrin 1925 ( ii ) : 158. Goldfaden 1893. For a recent treatment of Palermo Jewish life, see Ashtor 1979 : 219 – 241. Alyssa Quint : Avrom Goldfaden’s Sheygets Theater 243 satires of unreformable Jews. For the ĳirst two years following his return to Russia, Goldfaden had been attacked in the newspapers by Jewish reviewers for denigrating Jews.28 On the occasion of Doctor Almasada ’ s premiere in St. Petersburg, the local Russian-Jewish newspaper, Ruskii Evrei, was somewhat protective and upbeat about the playwright : 29 The performance of the new play marks a step forward, and at the very least, a happy occasion in the history of the young Yiddish theater. The Yiddish theater, which has existed for such a brief time, has already been submitted to so much disparagement that there is already a corpus of literature on it. [ ... ] but with this play, Goldfaden [ … ] did very well. [ … ] If from the execution of the play we could hope to expect more, the play itself made a good impression on the audience. Goldfaden was under signiĳicant pressure in Russia to generate content that was acceptable in the eyes of his contemporaries. It seems from the rather bland review that Dr. Almasada ’ s exotic and distant setting and plot obscured its more coded meaning, at least in the eyes of the reviewer, but its engagement with contemporary Russian-Jewish life is unmistakably present. Doctor Almasada ’ s ostensible subject is Jewish-Christian relations under the Crown of Aragon in the 14th-century Sicilian city of Palermo.30 The story moves between two main camps of characters. The ĳirst camp includes the governor of Palermo, Don Pedro, and his wife Isabella, whose daughter Elvira is dying of a mysterious illness. The second group is the elderly Jewish Doctor Almasada and his daughter. By the ĳirst act of the play, they and the rest of Palermo ’ s Jews have been driven out of the city by royal decree. Alonso, Dr. Almasada ’ s Christian apprentice, recognizes that only Dr. Almasada can heal Elvira but, as he explains to Isabella, Jews are forbidden from treating Christian patients. Dr. Almasada and Alonso collaborate to convince the governor that he should be allowed to bring Almasada ’ s Jewish medicinal genius to bear on Elvira ’ s grave situation. Elvira is saved and her restoration convinces 28 See the reviews of his early comedies in Oyslender and Finkel 1926 : 43 – 73. 29 Quoted in ibid. : 70. 30 Goldfaden was an avid reader of Jewish history and mentions the work of Jewish historians Jost and Graetz in his autobiography. The title cover of the printed edition states that Goldfaden wrote it based on a German novel but does not supply the title of the novel. i have not come up with a possible text. Zylbercweig recounts the theory that Goldfaden created this play from a play written by a former colleague of his from the Zhitomir rabinershul named N. B. Bazilinski, who published a number of plays during the theater ’ s heyday in Russia ( before 1883 ). This play was entitled ‫ ( דער בילבול‬The Libel ). See his book of theater anecdotes, ‫זאיִ ק‬ ַ ‫מא‬ ָ ‫טעאטער ־‬ ַ ( Zylbercweig 1941 : 144 f ). 244 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ the governor to influence the ruling “ Czar ” to repeal the anti-Jewish laws. Among its other plot-lines are a false accusation of murder followed by a stint in jail for Dr. Almasada, as well as the exploits of a band of robbers, and ĳinally and most importantly, what seems at ĳirst to be a forbidden romance between the Christian apprentice Alonso and the doctor ’ s Jewish daughter Miriam. The audience looks on as they trade confessions of love in Act I while Dr. Almasada is away from home :31 ‫ דו אײדעלער קריסט‬,‫נזא‬ ָ ‫לא‬ ָ ‫דאנק דיר ַא‬ ַ ‫איך‬ ‫נאר דו ביסט‬ ָ ‫אונדזער אײנציקער טרײסט יעצט‬ [.. .] ‫האט מיר ניט גיקענט רויבן‬ ָ ‫רעליגיאן‬ ָ ‫די ליבע צו מ&ן‬ ‫האב צו דיר ון ַאן ַאנדער גלויבן‬ ָ ‫וואס איך‬ ָ ‫דאס געיל‬ ָ ‫דאך דעם אונטערשײד ון היגע ַאנדערע קריסטן‬ ָ ‫איך זע‬ [.. .] .‫אר דיר‬ ַ ‫האסטו געוווּנען‬ ָ ‫מײן ליבע‬ ַ ‫טרײע‬ ַ ‫מײן‬ ַ ! ‫נזא‬ ָ ‫לא‬ ָ ‫ַא‬ I thank you, Alonso, you gentle Christian You are our only consolation […] My love of my religion could not rob me Of my love for you of another belief But I see how different you are from other Christians […] Alonso ! You have won my love for yourself. Against a backdrop of tense Jewish-Christian relations, Miriam confesses to Alonso that her love for him transcends even her commitment to the Jewish religion. By act ĳive, Miriam ’ s dilemma and the religious boundary between them will dissolve in line with the general ideological tenor of the play. The operetta is both politically conservative and nationalistic, especially compared to Jewish historical ĳiction generated at the same time in Western Europe. In France, for instance, Jewish historical ĳiction by authors like David Schornstein promoted history in lieu of religion and highlighted positive relations between Jews and Gentiles. As the scholar Maurice Samuels observes : 32 The general devaluation of Jewish religious observance in Schornstein ’ s historical ĳiction also serves to promote other aspects of the ideological program of emancipation which continued to influence Jewish thinking in post-emancipation-France. [ … Like ] the importance of forming bonds with Christians, with breaking down the literal and symbolic walls of the Jewish ghetto. In contrast, Doctor Almasada suggests that its Jewish onlookers are victims of an ignorant government and that the non-Jewish population, 31 Goldfaden 1893 : 15. 32 Samuels 2008 : 48. Alyssa Quint : Avrom Goldfaden’s Sheygets Theater 245 and its leaders most of all, must slough off its superstitious ideas about the Jews and change its restrictive policies. In one scene, Doctor Almasada, in jail for a crime he did not commit, pleads for his life. In the end, the government of Palermo speaks openly and apologetically about its earlier mistreatment of its Jewish population and reverses anti-Jewish legislation. In the context of Russian-Jewish life, such a picture would undoubtedly be resonant, if aspirational. Unlike Schornstein ’ s, Goldfaden ’ s grand gestures are organized around Jewish nationalist and religious sentiment and celebrate Jewish nationhood, God and Torah. When the Jews are forced to leave their homes in the city, they maintain their dignity and sing : 33 ‫דו הײליקע תּורה קום מיט אונדז מיט‬ ‫לאזן קענען מיר דיך ניט‬ ָ ,‫וווּהין מיר גיין‬ ‫דו ביסט אונדזער דעגן‬ ‫דארט‬ ָ ‫דאך‬ ָ ‫גאט איז‬ ָ ‫אין יעדען ָארט‬ ‫נאר‬ ָ ‫וווּ מען בעט אים‬ Holy Torah, accompany us Wherever we go, we cannot be without you You are our sword. God is there Everywhere Where one calls for him. Moreover, the religious practice of the Jews of Palermo does not stand between them and their ability to be peaceful citizens of the city. Unlike the ideas gentiles harbor about Jews, Torah-centered Jewish religion is not superstition. Though we know little about the exact circumstances under which Goldfaden wrote Doctor Almasada, moments of it feel particularly apropos to Jewish life in St. Petersburg, where he ĳirst put the play on the boards. Only twenty years earlier, Jews were prohibited from residing in the empire ’ s capital, but by the 1860s and 70s Jews began to migrate to the city by the thousands.34 Widespread economic disadvantage pressed Jews to “ travel clandestinely to larger cities and towns ” and as a result, considerably more Jews lived in St. Petersburg “ than were documented by either city or police census[ es ]. ”35 By the time Goldfaden and his troupe arrived in St. Petersburg, soon before they staged the play in January 1881, the capital city had “ a sizable Jewish migrant population, ” a good number of whom resided in the city illegally.36 Palermo, on whose streets the intolerant thug Don Diego would prefer Jewish feet did not tread, doubles well as the city of St. Petersburg : 37 33 34 35 36 37 Goldfaden 1893 : 21. Avrutin 2010 : 59. Ibid. : 98. Ibid. : 7. Goldfaden 1893 : 9. 246 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ‫לאנד‬ ַ ‫דא אין‬ ָ ‫נאך אום‬ ָ ‫וואס דרייען זײ זיך‬ ָ ‫שטראסן‬ ָ ‫לערמאס שיינע‬ ָ ‫פּא‬ ַ ‫נאך‬ ָ ‫באטרעטן זײ‬ ַ ‫וואס‬ ָ Why do they ramble around our land Why do they still tread Palermo ’ s beautiful streets ? Moreover, the ruler of Palermo is not referred to as “ King, ” for instance, but as “ Czar. ” Finally, the words spoken by Dr. Almasada in prison invoke the random passport checks conducted by Russian gendarmes in cities like St. Petersburg : ‫האב‬ ָ ‫ איך‬/ ‫גאנץ גוט‬ ַ ‫ איר קענט מיך‬/ ‫רעמד בין איך ניט‬ ‫דאקומענטן ַא סך‬ ָ “ I am not a foreigner / You know me well / I have many documents. ” 38 Apropos of Goldfaden ’ s apostate colleagues, however, the character of the operetta one should follow most closely is Alonso. Alonso can reveal his true identity only when Palermo ’ s Jews have been invited to return to live within the city walls. In the ĳinal act, Goldfaden reunites the titular hero with his daughter Miriam after her mysterious disappearance. Then, to her utter disbelief, the aging doctor proceeds to marry Miriam off to his Christian apprentice.39 ? ...‫נזא‬ ָ ‫לא‬ ָ ‫ ) קוקט זיך אום ( ַא‬: ‫מרים‬ ‫ מנשה רוף אים ָאן‬,‫נזא‬ ָ ‫לא‬ ָ ‫ ניט ַא‬,‫ נײן‬: ‫דא‬ ַ ‫סא‬ ַ ‫למא‬ ַ ‫ַא‬ ‫לאנג ָאן‬ ַ ‫דײן חתן שוין ון‬ ַ ‫ער איז‬ ‫אטער ז&נער‬ ָ ‫לעדא דער‬ ָ ‫טא‬ ָ ‫יוסף ון‬ ‫איז געוועזן דער בעסטער יוגנטר&נד מ&נער‬ ‫נאר געבוירן‬ ָ ‫וואס איר בײדע זענט‬ ָ ‫קוים‬ ‫מחותּנימשאט געשוווירן‬ ַ ‫האבן מיר צווישן זיך‬ ָ Miriam is stunned : Alonso… ? Doctor Almasada : No, not Alonso, call him Menashe He has been your groom for ages His father Yosef of Toledo Was my dearest friend in our youth When both of you had just been born, We swore to each other that we would be in-laws one day. As Alonso explains in the operetta ’ s ĳinal act, he is actually a Jew and not Christian. The relationships between the doctor and his student, and the student and his gentile mask resonated considerably with a RussianJewish audience. In general, Russian Jews of late Imperial Russia constituted a population that was shifting uneasily between increasingly fungible estate and confessional categories. In particular, baptism was a viable choice. According to Eugene Avrutin in his recent study Jews and the Imperial State, “ most Jews [ who ] chose to convert [ did so ] for strategic reasons – to alleviate the existential burdens of Jewishness, marry a Christian spouse, work in the profession of their choice, attend 38 Ibid. : 35. 39 Ibid. : 59. Alyssa Quint : Avrom Goldfaden’s Sheygets Theater 247 institutions of higher education, or receive residential privileges in the interior provinces. ” He continues : 40 Conversion entitled Jews to the legal rights to leave the Pale of Settlement and work in the profession of their choice [ … ]. By law, conversion erased much of the discrimination Jews faced in their daily lives – in the process improving their civil and material plight by allowing them to escape from the professional, geographic, and social stigmas attached to Judaism. As a result of such strategic conversions, the ĳigure of the friendly or covert apostate Jew assumed cultural currency during the nineteenth century. Historian Yankev Shatzky observes, for instance, that in 1840 baptized Jews in Warsaw contributed money to a Jewish orphanage in order to prevent Jewish orphans from falling prey to missionaries. “ This institution was the ĳirst demonstration of Jewish unity in Warsaw. It united all sides. ”41 But the Yiddish-language Haskala organ that Goldfaden read, and to which he contributed, provides a more cogent image of the Jewish apostate who deploys his newly acquired freedoms to alleviate the plight of Jews and society in general. An unsigned editorial, probably penned by the newspaper ’ s editor Alexander Tsederboym, legitimizes the contribution of baptized Jews to Russian-Jewish society : 42 ‫ ַאז די‬,‫זאך‬ ַ ‫אויסגעמאכטע‬ ַ ‫אסט ַאן‬ ַ ‫עס איז‬ ‫וואס גייען איבער צו ַאן ַאנדער‬ ָ ,‫דאזיקע ייִ דן‬ ָ ‫זאגן זיך‬ ָ ‫שײנט ַאז זײ‬ ַ ‫כאטש עס‬ ָ ,‫רעליגיע‬ ‫גאנצן ון זייערע ריִ ערע‬ ַ ‫ון אויסן ָאפּ אין‬ ‫הארצן‬ ַ ‫בלײבן זײ אין‬ ַ ‫דאך‬ ָ ,‫גלויבנסברידער‬ ‫טרײ דעם ייִ דנטום און זוכן‬ ַ ‫גרעסטנטײלס‬ ‫ מיר געינען‬.‫ווײזן‬ ַ ‫בא‬ ַ ‫אויף יעדן שריט עס צו‬ ‫טרײסטע‬ ַ ‫ָאט צווישן ַאזעלכע מענטשן די‬ ‫וואס טוען‬ ָ ‫נאציע‬ ַ ‫ארטרעטער ון דער ייִ דישער‬ ַ ‫ ַא סך מער‬,‫ות‬-‫מאל גרויסע טו‬ ָ ‫אונדז נישט אײן‬ ‫מאנכע ון אונדזערע ייִ דישע יונגע‬ ַ ‫ווי ַאילו‬ ‫האבן זײ ָאנגעהויבן ע פּ עס צו‬ ָ ‫וואס קוים‬ ָ ,‫לײט‬ ַ ‫גאנצן‬ ַ ‫ מײנען זײ ַאז זײ מוזן זיך שוין אין‬,‫לערנען‬ .‫פּזאגן ון זײערע ריִ עריקע ברידער‬ ָ ‫ָא‬ It has practically been decided that those Jews who adopt a new religion – and it appears on the exterior as if they have utterly renounced their old religion – remain, for the most part, true to Judaism in their hearts and seek out ways to express this at every turn. Among such people, we come across the most loyal representatives of the Jewish nation, who do us more favors than even many of our Jewish youth who, as soon as they begin studying, think they must sever all ties with their Jewish brothers. 40 Avrutin, 2010 : 119. According to Avrutin, towards the end of the century, the Russian government questioned the sincerity of Jewish baptisms and began introducing laws to help divide converts “ from the core of the Christian population by making their integration into Russian society increasingly difĳicult. ” See p. 120. 41 Shatzky 1948 : 152. 42 Tsederboym 1870 : 14 f. 248 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ The writer speaks of the “ exterior ” of such converts versus whatever feelings or convictions reside in their “ hearts, ” and goes so far as to compare apostates favorably with ( unbaptized ) Jews in non-Jewish Russian institutions. Presumably the latter feel the pressure to prove their Russian loyalty, whereas converts are unburdened by this obligation. As to why he pretended to be a Christian, Alonso explains in the ĳifth and ĳinal act of the play : 43 ‫פּראקטיצירן‬ ַ ‫לערמא‬ ָ ‫פּא‬ ַ ‫האב ָאנגעהויבן אין‬ ָ ‫זײט איך‬ ַ ‫רבאטן קריסטן צו קורירן‬ ָ ‫א‬ ַ ‫האט מען‬ ָ ‫און ייִ דן‬ ‫האב עס געמוזט‬ ָ ‫ איך‬,‫האב איך מיך אויסגעגעבן‬ ָ ‫אר ַא קריסט‬ ַ ‫נזא‬ ָ ‫לא‬ ָ ‫נאמען ַא‬ ָ ‫אונטער דעם‬ ‫קאסטן‬ ָ ‫זאל מיך ַאלעס‬ ָ ‫ עס‬,‫פּלאן איז געווען‬ ַ ‫מ&ן‬ ‫פּאסטן‬ ָ ‫באקומען ַא גרויסן‬ ַ ‫בײ דער רעגירונג‬ ַ ‫אום‬ ‫זאל קענען גל&ך ווי אונדזערע‬ ָ ‫אום איך‬ ‫מאל‬ ָ ‫ארשטייער ַא‬ ָ ‫נוצלעך ז&ן אין ַא נויט דעם כּלל ישׂראל‬ Since I began practicing in Palermo And Jews were forbidden to treat Christians I have assumed a Christian identity by the name of Alonso, as I had to. My plan was to achieve even at the greatest personal cost An important position, and, as an agent for our people, One day be of use in a time of need for klal Yisroel. Like the markers of Christianity assumed by the subjects of Tsederboym ’ s editorial, Alonso ’ s Christian mask is justiĳiable and even laudable, since he puts it to the service of his people – Jewish and otherwise. To a mostly Jewish audience in St. Petersburg, Alonso might have been particularly resonant as a Jew who did not convert but exercised a more temporary brand of social opportunism by assuming a Christian name. Nowhere in his explanation does he mention that he was actually baptized, only that he “ impersonated ” a Christian by adopting the name Alonso in place of his Jewish name Menashe. In the 1860s and 70s, administrators in the provinces and in St. Petersburg reviewed “ countless requests from Jews wishing to change their nicknames to their Russian equivalent. ”44 Although such requests were arguably a welcome sign of the Jews ’ acculturation to Russian society, they were denied. As Avrutin explains, “ Like so many members of the Ministry of the Interior [ one ofĳicial ] reasoned that Jews could easily invent ĳictitious identities and avoid recognition by changing their names. ”45 Even baptized Jews were not exempt from this law. In 1850, “ in an effort to increase the visibility of baptized Jews and help distinguish the newly baptized from the core Christian population, ” converts were forbidden to change their 43 Goldfaden 1893: 57. 44 Avrutin 2010 : 153. 45 Ibid. : 152. Alyssa Quint : Avrom Goldfaden’s Sheygets Theater 249 surnames.46 “ If baptized Jews were allowed to change their surnames, reasoned the State Council, then all Jews who [ … ] transgressed the law would “ be able to evade surveillance ” by converting to Christianity, masking their permanent places of residence, and masking their ethnic origin. ”47 Ofĳicial anxiety over distinguishing Jews from Christians ran deep and reveals widespread social chameleonism on the part of Russian Jews, blurring boundaries of identity. And while ofĳicials stated that their worries stemmed from possible crimes, Jews just as often deployed a Christian name to further business and professional interests as well as to reside in a restricted city. Goldfaden ’ s Menashe speaks to both Russian Jews with complicated identities and their less complicated Jewish brothers and sisters. He invites the former to maintain their sense of allegiance to their people and the latter to consider their baptized brothers as uncomplicated, sympathetic crypto-Jews. Conclusion As a kind of performer within the framework of a play, Alonso calls attention to the similarity between a play staged with actors and a social performance. His true Jewish identity lends stability and relief to the romantic narrative between him and Miriam : now her love for Alonso can be consummated. The stability that is achieved in the realm of romantic love, however, results in an instability more broadly felt than that of an isolated episode of intermarriage. Alonso ’ s adoption of a Christian identity extends license to Russian Jews to exercise signiĳicant latitude including baptism, the adoption of a Christian name, and the adoption of Christian behavior in overcoming social and professional barriers or in residing in a restricted city. Especially for a people that underscores observance and the act ( performance ? ) in their religious practice, one would think that behaving like a Christian poses risk to Jewish society. Doctor Almasada, however, endorses it. Still more to the point, the character of Alonso calls into question the integrity of the later Goldfaden ’ s self-righteous indignation regarding the apostates who sought to contribute to the Yiddish theater. It suggests that, at least during those formative years of the theater, Goldfaden sympathized with the complexities of identity upon which baptized Jews acted and felt comfortable justifying their apostasy to his audience by explaining their enduring – if secret – commitment to the needs of the Jewish people. This attitude is consistent with the particulars of Goldfaden ’ s situation in January 1881. He had already succeeded 46 Ibid. : 153. 47 Ibid. 250 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ in obtaining the ĳirst permissions ever granted in the Russian Empire on either the central or local levels to perform Yiddish theater publicly, and he was about to stage Yiddish theater in, of all cities, St. Petersburg. Whether or not audience members noticed the parallel between their lives and the lives of Alonso, Miriam and Dr. Almasada, the operetta also expresses Goldfaden ’ s optimism that life would imitate art in its tolerant denouement. The Goldfaden of the turn of the century, however, knew that what had followed instead was more of what we saw in the play ’ s ĳirst acts, including greater restrictions in key cities and universities, and individual and mass expulsions. But it was Goldfaden ’ s internalization of his critics ’ negative assessment of his work, more than his changing perspective on Russia, that pressed him to don the mantle of the theater ’ s Jewish father. The character of Alonso – which introduces a layer of important cultural history into the operetta unnoticed by the Yiddish theater ’ s observers – suggests that Goldfaden was as wrongheaded in attacking his apostate colleagues as he was in conĳirming the low opinion of his own early work. Doktor Almasada Frontispiece of the Warsaw edition, 1887 Alyssa Quint : Avrom Goldfaden’s Sheygets Theater 251 Bibliography Ashtor, Eliyahu, 1979 : “ Palermitan Jewry in the Fifteenth Century. ” In : Hebrew Union College Annual 50 : 219 – 241. Avrutin, Eugene, 2010 : Jews and the Imperial State. Identiĳication Politics in Tsarist Russia. Ithaca : Cornell University Press. Gorin, Bernard, 1918 : Di geshikhte fun yidishn teater. 2 vols. New York : Literarisher farlag. Goldfaden, Yankev, 1893 : Doktor Almasada : oder di yidn in Palermo, historishe operetta in 5 akten un in 11 bilder. New York : Hebrew Publishing Co. – 1929 : “ Der onfang fun yidishn teater. ” In : Di yidishe velt May 28 : 7 f. Goldfaden-bukh, 1926 : Goldfaden-bukh. New York : Yidisher teatermuzey, 1926. Henry, Barbara, 2011 : Rewriting Russia : Jacob Gordin ’ s Yiddish Drama. Seattle : Washington University Press. Kobrin, Leon, 1925 : Erinerungen fun a yidishn dramaturg. 2 vols. New York : Komitet far Kobrins shriftn. Lerner, Yoysef Yehude ( Osip ), 1868 : Kriticheskii razbor : na evreisko-nemetskom zhargone. Odessa : Hamelits. – 1889 : Der feter Moyshe Mendelsohn : a dramatishes bild in eyn akt. Warsaw : Boymritter ve-khatano Ganshor. Minkov, N. B., 1954 : Zeks yidishe kritiker. Buenos Aires : Yidbukh. Osherovits, M., 1930 : “ Dovid Kesler. ” In : Shatzky 1930 : 302 – 340. Oyslender, Nokhem and Finkel, Uri, 1926 : A. Goldfadn. Materyaln far a biografye. Minsk : Institut far vaysruslendisher kultur. Prager, Leonard, 1990 : Yiddish Culture in Britain : A Guide. Frankfurt am Main – Bern – New York – Paris : Peter Lang. Reyzen, Zalmen, 1926 – 1929 : Leksikon fun der yidisher literatur, prese un ĳilologye. 4 Vols. Vilna : B. Kletskin. Samuels, Maurice, 2008 : “ David Schornstein and the Rise of Jewish Historical Fiction in Nineteenth-Century France. ” In : Jewish Social Studies : History, Culture, Society 14 ( 3 ) : 38 – 59. Shas-Roman [ Sh. Solomon ], 1930 : “ Der repetuar fun yidishn teater in Bukaresht in 1877. ” In : Shatzky 1930 : 280 – 285. Shatzky, Yankev, 1926 : “ Goldfadens oytobiograĳish material. ” In : Goldfaden-bukh. New York : Yidisher teater-muzey, 40 – 68. – ed., 1930 : Arkhiv far der geshikhte fun yidishn teater un drame. Vol. i. Vilna and New York : yivo. – 1948 : Geshikhte fun yidn in Varshe. New York : Biblyotek fun yivo. Shepard, Richard F., 1964 : “ Historian Traces Yiddish Theater ” In : The New York Times ( November 22 ) : 121. 252 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Shomer [ Shaykevitsh, Nahum Meyer ], 1901 : “ Dos yidishe teater. ” In : Mentshnfraynd 14 : 3 – 28. Shtarkman, Moyshe, 1926 : “ Goldfadens a briv fun yor 1904. ” In : Goldfadenbukh. New York : Yidisher teater-muzey, 13. – 1930 : “ Fun Shmendrik biz Ben-Ami. ” In : Shatzky 1930 : 264 – 275. Slobin, Mark, 1982 : Tenement Songs : the Popular Music of Jewish Immigrants. Urbana : University of Illinois Press. Steinlauf, Michael, 1995 : “ Fear of Purim : Y.L. Peretz and the Canonization of Yiddish Theater. ” In : Jewish Social Studies 1 ( 3 ) : 44 – 65. Tsederboym, Aleksander, 1870 : “ Algemeyne bagebnhaytn. ” In : Kol mevaser 2 : 14 f. Warnke, Nina, 2003 : “ The Child Who Wouldn ’ t Grow Up. ” In : Joel Berkowitz, ed., Yiddish Theater : New Approaches. Oxford : The Littman Library of Jewish Civilization, 201 – 216. Westminster, The, 1905 : “ Presbyterian Church in Odessa, Russia. ” In : The Westminster ( New York ) 30 ( 11 ) [ April 1, 1905 ] : 17. Yafe, Mordkhe, 1963 : “ Y. Y. Lerner. ” In : Efraim Auerbakh, Yitskhok Kharlash and Moyshe Shtarkman, eds., Leksikon fun der nayer yidisher literatur. Vol. 5. New York : cyco, Inc. : 362 – 365. yivo, 2009 : Stars, Strikes and the Yiddish Stage : The Story of the Hebrew Actors ’ Union 1899 – 2005. New York : yivo. Zylbercweig, Zalmen, 1941 : Teater-mozaik. New York : Itshe Biderman. – 1931 – 1969 : Leksikon fun yidishn teater. 6 Vols. New York ( Vol. i ) – Warsaw ( Vol. ii ) – New York ( Vol. iii – iv ) – Mexico City ( Vol. v – vi ) : Farlag Elisheve. Nathan Cohen Sherlock Holmes in the Pale of Settlement Yiddish Crime Stories 1860 – 1914 The assumption that any attempt to arrive at a detailed deĳinition of mystery novels, police stories, thrillers, spy, and detective ĳiction relies on subjective distinctions rather than objective criteria has led researchers of these literary genres to prefer the more inclusive term ‘ crime stories, ’ within the framework of which they then distinguish various types of writing.1 In Western Europe and America crime stories have formed a branch of sensational literature since the early nineteenth century : these stories expose readers to varying levels and scopes of violent acts under the guise of mystery ; are guided by one or more of the questions ‘ who,’ ‘ why,’ and ‘ how ’ ; and keep readers in suspense until the mystery is solved and the guilty party/ies punished. The raw material for the plots of many of these works was typically drawn from the pages of the daily newspapers as well as from urban, at times also familial, situations familiar to all ( unlike the forests or isolated castles of the sensational works that were renowned and popular before the advent of crime stories ). The range of crime stories includes works of high literary quality, attesting to the superior writing abilities of their authors, alongside trivial works devoid of literary value. Consumption of crime stories crosses the borders of gender and social class. These works at once incorporate attempts to contend with the evil lurking in every corner and inspire conĳidence in the eventual victory of the good and righteous,2 though some crime stories originating in Western and Central Europe in the ĳirst half of the nineteenth century raised the criminal to the status of hero, leading to the readers ’ identiĳication The titles and quotations of the Yiddish works discussed in this article are reproduced here in the original spelling. 1 The ĳirst to discuss the problematics of the deĳinition and to suggest this inclusive term was Julian Symons ( Symons 1972 : 7 – 11 ). Symons ’ approach has been generally accepted : see the foreword to Steven Knight ’ s work ( Knight 2004 : x – xv ). 2 Symons 1972 : 11 – 19 ; Brantlinger, 1982. The characteristics of the sensational story closely resemble those of the gothic novel ( widespread in eighteenth-century England, France, and Germany ) : they create an atmosphere of dread combined with elements of mystery. On the great demand for this literary genre in Germany and a list of keywords characterizing it ( including, for example, ‘ blood,’ ‘ evil,’ ‘ murder,’ ‘ isolated,’ ‘ waif,’ ‘ imprisonment,’ ‘ demon,’ ‘ ruin ’ , and ‘ dread ’ ) see Schenda 1977 : 210 and 245. For general information on this literary genre, its characteristics, and circulation, see Hogle 2002. 254 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ with him, while at the same time criticizing the injustice of society towards individuals that unintentionally nurtures crime and violence.3 In contrast, works dating from the second half of the nineteenth century, many of which are based upon authentic material, distinguish clearly between heroes – including policemen and detectives – and villains. The inclusion of the word ‘ mystery ’ in the title of a work is an identifying characteristic of sensational literature that can also be applied to crime stories.4 The concept of mystery ( ‫ ) געהיימניס‬penetrated Yiddish literature from the mid-nineteenth century as a means of attracting readers. Before 1918 the term is to be found in the titles of at least 35 books, booklets, and stories serialized in the press ( most of these translated or adapted from foreign languages ). The Yiddish-speaking intelligentsia quickly began to associate sensational works with the socalled ‘ shund ’ literature that in their opinion had no right to exist.5 With the development of police systems in Western Europe and America, the popular press showed increasing interest in police activities. Events involving the police were also utilized as raw material for literary works of different levels and involving varying degrees of crime and sensationalism.6 One of the new types of crime stories were the detective stories focusing on solving murders that began to appear in the second half of the nineteenth century. In these detective stories 3 The earliest and most prominent example which is typically noted in this regard is Caleb Williams, suspected murderer and the hero of the novel bearing his name, written by the British political thinker William Godwin in 1794 ( Knight 2004 : 10 – 19 ). For a distinction between the various levels of violence in German literature of this period see Schenda 1976 : 106 – 116. 4 Symons 1972 : 10 ; Brantlinger 1982 : 1 – 3 ; Pykett 2003 : 32 – 37. In America alone between 1794 and 1854 seventy works were published featuring the word ‘ mystery ’ in the title ( Knight 2004 : 19 ). 5 This number is only partial and is based upon the catalogue of the National Library of Israel in Jerusalem and the Index of Yiddish Periodicals : http ://yiddish-periodicals.huji. ac.il/. Undoubtedly a wider search would reveal additional titles. However, it should be noted that on the one hand booklets such as these were not considered worthy of inclusion in libraries, and on the other, some have been lost due to the great extent to which they were read and circulated. For more on ‘ shund ’ literature see Shmeruk 1983a : 335 – 341. On the active battle against the Hintertreppenroman ( Backstairs Novel ) and other booklets sold by peddlers in Germany at the end of the nineteenth century see Schenda 1976 : 84 – 99 ; and Schenda 1977 : 241 – 247. It is highly likely that ‘ dealers ’ of Jewish culture were aware of this battle and attempted to implement it also in Eastern Europe. It should also be remembered that at times the concept of mystery was employed in order simultaneously to criticize works of which the critic did not approve and to bring to readers ’ attention other qualities entirely. This is the case, for example, in Alexander Zederbaum ’ s important work ‫ איינע קאראקטער שילדערונג דער דארטיגען יודישען געמיינדע‬:‫ ( דיא גיהיימניסע פון בערדיטשוב‬The Mysteries of Berditchev : A character description of the Jewish community there ; Warsaw, 1870 ). 6 Among the prominent authors to write about criminal and police subjects were Alexandre Dumas ( the father ), Emile Zola, Eugène Sue, Émile Gaboriau, Wilkie Collins, Ellen ( Mrs. Henry ) Wood, and Charles Dickens. Nathan Cohen : Sherlock Holmes in the Pale of Settlement 255 the most successful revelations of the guilty party provided the reader with an intellectual experience as he / she followed the process of cracking the case. The origins of the detective story, in all its varieties, are ascribed to the works of mystery and suspense by Edgar Allan Poe ( 1809 – 1849 ), creator of the scholarly detective Auguste Dupin – indeed Poe is regarded as the ‘ father ’ of the detective story ( in addition he is considered to have rejuvenated the gothic style in his suspenseful horror stories ).7 Detective stories reached the height of their development and popularity with the tales of Sherlock Holmes, written by Sir Arthur Conan Doyle ( 1859 – 1930 ).8 These two key ĳigures, Dupin and Sherlock Holmes, together with a range of professional detectives, amateur enthusiasts, lawyers, and policemen, exposed readers, and to a great extent drew them closer, to the distant yet alluring metropolitan cities of Paris, London, and New York. The extent of the popularity of detective stories in the United States in the last decades of the nineteenth century is evidenced by the circulation of 801 weekly booklets of the New York Detective Library in the years 1892 – 1899, and by the ( approximately ) one thousand stories about the private detective Nick Carter published between the end of the nineteenth century and the 1920s.9 In Germany in 1908 the same Nick Carter merited 250 stories in weekly booklets, each of which circulated in 45,000 copies, featuring alongside Carter other heroes ( and heroines ), both original and imported from foreign literatures.10 In the Russian Empire, the last decades of the nineteenth century witnessed a rise in the number of periodical publications of various kinds and levels directed at diverse target audiences11 – mainly in the cities, but also reaching rural areas – the circulation ĳigures of which rose continuously. These numerous publications included sensational, ‘ yellow ’ periodicals which sought to reach the widest possible readership, with prices as low as one kopek. Editors and publishers sought to bring a wide variety of subject matter to readers through the medium of these periodicals ; among other topics, they competed to provide detailed information on city life in general, and on crime in particular. Aside from current ‘ news ’ reports on these subjects, the periodi7 Symons 1972 : 33 – 41 ; Knight 2004 : 26 – 29. 8 Much criticism and research has been published on Poe and Doyle, and their heroes. In addition to the referrals in the indexes of the works by Symons and Knight, see Kayman 2003 : 41 – 58. A recent analysis and additional bibliographical references are available in Handelzalts 2006. 9 Knight 2004 : 54, 77. The stories of Nick Carter were written by various authors. 10 Fullerton 1979 : 499. 11 The statistics demonstrating the rise in the popularity of these periodicals from the 1860s onward, and mainly after 1905, may be found in Brooks 1985 : 112. 256 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ cals also offered serialized novels and collections of stories printed in installments ( in the periodical itself or in accompanying booklets ), the plots of which transpired in the not-too distant past in familiar locales.12 Tales of Cossacks and ‘ bandits ’ achieved great popularity. The most prominent of these were Vaska Churkin ( 1882 – 1885 ) and Krechet ( 1909 – 1916 ), robbers and murderers who chose ( or were forced ) to live outside of society and proceeded to terrorize the general public. Bandits and Cossacks provided thrilling crime stories replete with violence and cruelty, adventures, journeys to distant lands, and even magical and folkloristic elements.13 These stories did not depict heroes reminiscent of Robin Hood or the Count of Monte Cristo who sought to right social injustices ; rather, they contained clear social ( and religious ) messages, designating total loyalty to the Czar and Church as examples of the highest moral values. For this reason it was almost completely impossible for the bandits to enter into society.14 Following the 1905 Revolution, alongside the tales of bandits and Cossacks, there appeared Russian translations and adaptations of European and American detective stories, including those featuring Sherlock Holmes, Nat Pinkerton, and Nick Carter.15 Despite, or possibly due to, the foreignness of the heroes and the setting of events far from Russia ’ s borders, demand for the serials published in these booklets grew steadily. In 1907 the price of a booklet varied from 15 to 20 kopeks, with circulation ĳigures of between 5,000 and 10,000 per booklet. By 1908 the price had fallen to ĳive kopeks or less per booklet and circulation ĳigures increased, on occasion rising as high as 50,000 or even 60,000 copies.16 At the height of circulation in 1908, the number of booklets in each series reached 123 Pinkerton stories and 218 Holmes stories.17 The readers of these stories were for the most part youths, young people and workers. In order to draw the heroes closer to the Russian reader, Nat Pinkerton was given a Russian double bearing his name, and Sherlock Holmes was imported into Russia in a series of booklets and stories in the journal Ogonek ( both 1908 ).18 According to the scholar of 12 Smith and Kelly 1998 : 113 – 125 ; Brower 1990 : 170 – 180 ; Brooks 1985 : 117 – 141. 13 Brooks 1985: 123 – 129, 177 – 195. 14 Ibid. : 169 – 171, 197 – 200. 15 On the last two see Knight 2004 and Priestman 2003. 16 In addition to the approximately ten million copies of detective booklets circulated in 1908, in the same year 26 different novels were published in booklet form. Between 1907 and 1915 6.2 million copies of Nat Pinkerton booklets, 3.9 million copies of Sherlock Holmes booklets, and 3.1 million copies of Nick Carter booklets were sold. See Brooks 1978 : 144 – 146 ; Brooks 1985 : 141 – 143, 148, 366 f. 17 Brooks 1985 : 366, table 18. 18 Ibid. : 116, 146. Nathan Cohen : Sherlock Holmes in the Pale of Settlement 257 Russian literature Geoffrey Brooks, in their Russian garments the western detective stories were transformed into thrillers with detective elements. Although the setting of events remained America or Europe, these works reflected Russian socio-economic reality. Yet at the same time they presented to the Russian reader concepts that differed from the accepted notions of freedom, society, and the state, and the relations between these and the individual. Detectives and other heroes battle corruption and crime for the sake of a more just society and perhaps, to a certain extent, these works even contributed to the revolutionary atmosphere.19 Alongside these ‘ western ’ detective characters there also appeared Russian detectives, similarly endowed with abilities of perception and analytical thinking. In the years following 1908, when these stories reached the peak of their popularity, there was a clear decrease in the demand for detective stories, although even during the First World War they continued to be published and read. Parallel to the upsurge of crime and detective stories in the years 1907 – 1909 in Russia, similar works appeared in the divided Poland. These stories were published in Polish in illustrated booklets with colorful bindings and sold at an affordable price. Four series of Sherlock Holmes stories were printed in Lvov ( Lemberg ), Cracow, and Warsaw and circulated throughout the former Polish territory. The printing of 5,000 copies of each booklet apparently failed to meet demand and accordingly dozens of these booklets were reprinted repeatedly. The series of booklets were bound together in thick volumes numbering thousands of pages in length.20 Aside from Sherlock Holmes, stories printed featured Nick Carter, Nat Pinkerton, Harry Dickson, Ethel King ( Holmes ’ s ‘ partner ’ ), and even Stefan Wenke, the “ famous Warsaw detective. ” In addition to this list of detective stories, westerns and Indian stories, such as Jack Takses and Buffalo Bill, were also published in Polish. As with the Russian market for thrillers and detective stories, works set in locales outside Poland were translated and adapted into Polish ; apart from the names of characters, cities, and streets, these stories do not contain any deĳinite local character. At the same time famous detectives are to be found in stories that have nothing in common with the source texts.21 19 Ibid. : 143 – 146, 207 – 213. 20 This literature was generated in parallel with, and as a continuation of, more established series of sensational stories and romances. On this see Martuszewska 1992 : 580 – 582, as well as Dunin and Mierzwianka 1978 : 5 – 7. The large number of printed copies and their circulation are discussed in Dunin and Knorowski 1984. 21 Martuszewska 1992 : 581. 258 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ A further book market which must be examined in relation to Yiddish publishing is the German-Austrian market. Authors, translators, and adaptors of crime and detective stories were active throughout the German-speaking Empire from the beginning of the nineteenth century. From the 1860s until the outbreak of the First World War tens of millions of booklets on the topics discussed herein were added to the existing, fertile, market of popular booklets directed at readers from the lower classes ; these included Westerns and novels about the ‘ Indians ’ in Central and North America. Seasoned publishers raked in proĳits from employing writers of varying degrees of talent who composed, or adapted, these booklets. For the most part the works were sold not in book shops but rather in market stalls and by peddlers.22 A central milestone in the history of crime stories was the sensational crime novel Les Mystères de Paris by the popular French author Eugène Sue ( 1804 – 1857 ), the ten volumes of which were published in Paris in the years 1842 – 1843. This work is in fact a novel set in contemporary Paris that reveals, in thrilling and suspenseful fashion, life in the poverty- and crime-stricken neighborhoods of that city. It swiftly became a best-seller, caused considerable reverberations, and was translated into a number of languages and published in numerous editions. A relatively short time after its ĳirst publication this work was made available to the Hebrew reader in a shortened version ( four parts in two volumes ), without the descriptions in the original that were considered to be too daring or tastelessly sarcastic for the Jewish reader.23 This Hebrew translation/adaptation by Kalman Shulman ( 1819 ? – 1899 ), a Vilna-based maskilic author, was published in the years 1857 – 1860 and achieved highly coveted circulation ĳigures.24 A few years later a Yiddish translation of the work was published by translator Yehoyshue Gershon Munk entitled ‫פּאריז‬ ַ ‫ דיא געהיימניסע פאן‬: ‫ ( מסתרי פאריז‬Warsaw : Lebenzon, 1865 – 66 ).25 At the same time that Les Mystères de Paris was published in Hebrew, translations of stories featuring the Italian bandit Rinaldo Rinaldini were printed in Hebrew in Warsaw.26 Likewise, simultaneous 22 Fullerton 1979. Hügel provides a bibliographic list of crime and detective stories published before 1919. See Hügel 1978 : 305 – 327. 23 Sha ’anan 1952 : 144 – 147. 24 On the demand for the work and on Avraham Mapu ’ s hostile and prejudiced reaction to this demand, see Sha ’ anan 1952 : 144 f, 149 – 159 ; Miron 1988 : 64, note 66. 25 On this translation and others see Shmeruk 1983a. 26 Lahaqat ha-šōdědīm ašer nō ‘ adū yaḥdāw lě-hit ‘ ōlēl ‘ alīlōt bě-reša ‘, li-šělōl šālal wě-lāvūz baz [ … ] hū ‘ ataq mi-lěšon ‘ āmīm [ pōlanīt ] ‘ al yědēy Ḥayim ben Ẓěvī Hīrš Goldšteyn ( The Group of Bandits Famous for Carrying out Evil Deeds, Plundering Spoil and Their Scorn [ … ], copied from the language of other peoples <Polish> by Hayim ben Zevi Hirsh Goldsteyn ; Warsaw, 1859 ). Nathan Cohen : Sherlock Holmes in the Pale of Settlement 259 with the publication of Sue ’ s work in Yiddish, a Yiddish work featuring Rinaldo Rinaldini was published in Warsaw, translated from Polish by Avigdor Berachiah Ruf ( four parts, 1865 – 1866 ).27 This work is a ‘ Robber Novel ’ ( Räuberroman ), written by the German author Christian August Vulpius ( 1862 – 1927 ), the events of which take place in eighteenth-century Italy.28 The Yiddish translation substantially shortens the text and includes a foreword containing a warning of typically maskilic character. The fact that the hero of the tale embarks on his evil path as a result of idleness is used as a moral lesson on the value of study : “ You, young people, occupied [ too ] little with study, and lacking sufĳicient supervision, it is preferable that you should study and not go about unoccupied [ … ]. Everyone must know [ how to study ] to the best of their abilities. ” Apart from this edition, and a partial one printed in Lvov in 1875, no further editions of the Yiddish novel have been found.29 The heroes of these stories commit acts considered criminal according to general human moral standards. They wreak fear and terror on their surroundings, and therefore they are pursued as criminals. Yet in actual fact, many of these criminal acts were committed according to the Robin Hood principle : they constituted an attempt to repair social injustices and to assist those suffering as a result of others ’ crimes.30 The potential of attractive titles was exploited in modern Yiddish literature by both popular writers and respected authors. Alongside princes and princesses, disappointed or realized loves, and wondrous events of various kinds, deliberate use was made of titles containing words from the vocabulary of mystery and crime, even though they do not always accurately reflect the content of the work ; at times there is no link whatsoever between the two.31 27 Avigdor Berachiah Ruf, ‫ בעשרייבונג פאן דעם שרעקליכען איטאליענישען‬:‫רינאלדא רינאלדיני‬ ‫ איבערזעצט פאן פאלנישען דורך אביגדור ברכיה רוף‬,‫ ( רייבער ער וואר איין רייבער ־ הויפטמאן‬Rinaldo Rinaldini : The Story of the Terrible Italian Robber, He Was a Robber-Chieftain, translated from Polish by Avigdor Berachiah Ruf ; Warsaw : Shriftgiser, 1865 – 66 ). In 1875 a copy of the ĳirst part was published in Lemberg, but the translator ’ s name was removed and instead of the Polish source indicated in the ĳirst printing, this later edition claims that the work was translated from German. On Ruff and his literary works see Oyslender 1993 : 252 – 263. 28 Rinaldo Rinaldini der Räuber-Hauptmann, 1799. 29 However, the hero ’ s name was used in a series of booklets printed by the Warsaw publisher Yehude Leyb Morgenshtern in 1902, the ĳirst of which is entitled ‫געשיכטע פון א גרויסען‬ ‫גראסטער רויבער ־ הויפטמאן פון גאנץ איטאליען‬ ֶ ‫ דער‬:‫ ( ֶמארדער רינאלדי רינאלדיני‬The Story of the Great Murderer Rinaldo Rinaldini : The Greatest Robber-Chieftain in All of Italy ). The details of the author and the source of the original story were not included in the ĳirst Yiddish translation, but it is noted that this is “ an Italian story translated from French. ” 30 On this novel and the genre see Hart 2008. 31 A number of examples : a story in installments entitled “ ‫ ( „ דער שרעקליכער ֶמארדער‬The Terrible Murder ) by Khayim Molits ( 1861 – 1924 ) was published in issues 5, 6, and 7 of the ‫בלאט‬ ַ ‫אלקס ־‬% ָ ‫ ( יודישעס‬1888 ), yet before the suspenseful plot even began to be revealed pub- 260 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Nokhem Meyer Shaykevitch ( 1846 – 1905 ), better known by his pseudonym Shomer, is considered to have been one of the most proliĳic and popular writers of Yiddish literature in the last two decades of the nineteenth and the beginning of the twentieth century. In the literary environment of his time he was considered a writer of ‘ shund ’ ; one should be cautious of reading his works, and warn others against them.32 Shomer is known for the fantastic and appealing titles which he sometimes attached to his stories, among them ‫ ָאדער דער‬,‫שודד ישר‬ ‫ ( פרומער מערדער‬The Righteous Bandit or the Pious Murderer ; ĳirst edition, Vilna, 1879 ; at least two further editions were printed ). This is the story of a ‘ modern ’ Jewish family exposed to the criminal activities of a gang of criminals ( also Jews ) in which the criminals eventually receive their due punishment. During the course of events, lost family members are discovered, while others meet their deaths. The work contains numerous Biblical verses, axioms of the sages, and Yiddish proverbs, the didactic purpose of which is clear ; the accompanying crime story is nothing more than a tactic to increase suspense and arouse the curiosity of the reader, thus ensuring continued reading. Other works by Shomer with similar titles include ‫ ָאדער‬,‫ריכארד‬ ַ ‫דער שרעקליכער מערדער‬ ‫ ( דער זיגעל‬The Terrible Murderer Richard, or The Seal ; ĳirst edition Vilna, 1895 ; two further editions ), a historical work concerning the intrigues of the royal house of Portugal at the end of the eighteenth century ; or ‫די‬ ‫יאקוב‬ ַ ‫ ( צוויי ֶמארדערישע ברידער לעווי אונ‬The two Murderous Brothers Levi and Jacob ; Warsaw, 1904 ), which reveals a failed murder plot, together with other familial complications. However, the work ends on a note of ‘ happily ever after ’ and offers the reader a message on the importance of reading. lication ceased, in all likelihood due to the migration of the writer. A booklet by the popular author Avraham Yitshak Bukhbinder ( 186 ? – 1897 ), ‫ ( דער קינדער מערדער‬The Infanticide ; Vilna, 1891 ), is a tale of disappointed love and revenge which culminates in the tragic deaths of its heroes. ‫ ( דיא גיהיימע ליבע אדער דיא שרעקלעכע מערדערייא‬The Secret Love or the Terrible Murder ; Lublin 1895 ) is a complex story by Shimen Voltsonek ( 1856 – ? ? ), a competitor of Shomer in the 1880s and 1890s. At the center of the story lie attempts to take control of property and earn money through guile. Another example is ‫דער גרויסער העלד צווישען‬ ‫ ( רויבער אויף דעם ים‬The Great Hero Amidst the Sea-Robbers ; Warsaw, 1903 ). ‫דיא שיינע מער־‬ ‫ ( דערין אדער דער פעראיהרטער‬The Beautiful Murderess, or The One who Goes Astray ; Vilna, 1911 ) bears the title of a work by Gavriel Rubin ( 1870 – ? ? ) and contains elements from the original genre, but is melodrama rather than crime. In ‫דער פרעזידענט אלס מערדער אדער די‬ ‫ ( אונגליקליכע פאמיליע‬The President as Murderer, or The Unhappy Family ; Piotrków, 1908 ) the author, Khayim Eliezer Mushkat, according to his foreword, attempts to exploit an attractive title in order to provide his readers with an interesting historical tale, the likeness of which is not to be found amongst ‘ simple novels. ’ 32 Leading the battle against Shomer and his works was Sholem Aleichem. See Leksikon 1956 – 1981 ( 8 ) : 733 – 745 ; Grace-Pollack 1999 : 109 – 160 ; and the memoirs of Shomer ’ s daughter : Shomer-Batsheles 1950. Nathan Cohen : Sherlock Holmes in the Pale of Settlement 261 Another popular writer, a contemporary of Shomer, Sholem Lederer ( 1860 – 1952 ), also utilized sensational titles containing messages of violence and crime in order to provide his readers with stories of romance, separation, family intrigue, and adventure.33 The protagonists of most of the stories are Jews, and the setting of events, as indicated by the titles, moves between Poland, London, and New York. Like Shomer, Lederer addresses his readers directly within his narrative. Thus, for example, in the introduction to ‫דאס גערויבטע קינד‬ ָ ,‫ ָאדער‬,‫די יודישע ציגיינערין‬ ( The Jewish Gypsy, or The Kidnapped Child ; 1901 ) he declares that this work is a response to the Captain Dreyfus stories ( see below ), novels in twenty parts imported from America, and “ Paul de Kock ” stories.34 On page 23 of the same book, one of the protagonists asserts to his beloved the importance of reading good books as medicine for the suffering soul. He complains of the relative lack of good books in Yiddish and the fact that the “ Jewish Alexander Dumas ” ( Shomer ) is unjustly attacked. A thin booklet bearing the promising title ‫קאנ־‬ ַ ‫געהארגעטער‬ ַ ‫דער‬ ‫פאן פייגעלעס‬ ָ ‫ ָאדער דער אונגערעכנטער טויט‬,‫טא רשציק‬ ָ ( The Murdered Counting Clerk, or The Unjust Death of Feygeles ; Warsaw, 1896 ) which, exceptionally, includes the name of the author ( Moshe Shleyfsteyn, c.1850 – c.1917 ), is in fact a rhymed lament for the young Jew Avraham Feygeles, who was drugged, murdered, and robbed in Warsaw by two of his friends. His body was packed in a crate and sent ĳirst to Lodz and then to Odessa. The murderers, two youths of ‘ good family ’ ( one Jewish, the other Christian ), were caught and tried for their crime.35 One historical event of global scale which left its impression on Yiddish crime stories was the Dreyfus trial. The dramatic events in Paris and their implications for Jewish life throughout Europe provided a source of income for a number of entrepreneurs. Following the pub33 Of Lederer ’ s stories ( collected in dozens of booklets ) I would like to point out : ‫דער‬ ‫מאן אין פיער‬ ַ ‫רא‬ ָ ‫אינטרעסאנטר‬ ַ ‫ איין העכסט‬:‫געמאכטע אלמנה‬ ַ ‫ ָאדער דיא‬,‫שרעקליכער פערברעכער‬ ‫מעריקאנישען יודעשען לעבען‬ ַ ‫פּאלנישען און ַא‬ ָ ‫ ( טהייל אויס דעם‬The Terrible Criminal, or The Fake Widow : A Highly Interesting Novel in Four Parts Concerning Polish and American Jewish Life ; Vilna : Katsenelenbogen, 1897 ) ; ‫אינטערעסא נטער‬ ַ ‫ איין‬:‫באנדיט‬ ַ ‫ראכע פון ַא‬ ַ ,‫ ָאדער‬,‫דיא ציגײנער‬ ‫מעריקאנשיען יודעשען לעבען‬ ַ ‫פאלנישען אונ ַא‬ ָ ‫מאן פון‬ ַ ‫רא‬ ָ ( The Gypsy, or The Vengeance of a Bandit : An Interesting Novel Concerning Polish and American Jewish Life ; Vilna : Katsenelenbogen, 1898 ) ; ‫פאלנישען‬ ָ ‫מאן פון‬ ַ ‫רא‬ ָ ‫אינטערעסאנטער‬ ַ ‫ איין‬: ‫דאס גערויבטע קינד‬ ָ ,‫ ָאדער‬,‫די יודישע ציגײנערין‬ ‫מעריקאנישען יודישען לעבען‬ ַ ‫ ( און ַא‬The Jewish Gypsy, or The Kidnapped Child : An Interesting Novel Concerning Polish and American Jewish Life ; Vilna : Katsenelenbogen, 1901 ). 34 The works of Paul de Kock ( 1793 – 1871 ), a French writer famous for his works depicting Parisian life, were translated into various European languages and considered extremely popular. I have not been able to locate any translations of his works into Yiddish ; thus it would appear that Jews read them in Russian. On the topic of de Kock see also Sholem Aleichem ’ s ĳirst Yiddish story, “ ‫ ( „ צוויי שטיינער‬Two Stones, Sholem Aleichem 1883 ). 35 The event took place on 13 / 25 November 1896. News reports on the event were published in ‫ הצפירה‬, 18 / 30 November 1896 : 1235, and 19 November/1 December 1896 : 1239. 262 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ lication of a German novel in installments concerning Alfred Dreyfus and the accusation of spying leveled against him, Mordkhe Spektor, Leyzer Zuckerman ( the son and heir of the bookseller and publisher Avraham Zuckerman ), and two investors invited Meyer Yankev Freyd ( 1871 – 1940 ) to translate the German novel in weekly installments in return for appropriate ĳinancial compensation. Freyd accepted the project and, despite his concerns about the character of Dreyfus as depicted in the German novel, carried out the task. As Freyd wrote later, in the second booklet he already began to deviate from the German source and continued the story in his own fashion, creating “ thousands [ ? ] of protagonists, each one worse than the last. ”36 The Yiddish novel is entitled ‫ ווירקליך אינ־‬: ‫ן טײוועלס ־ אינזעל‬%‫ערשיקטער אוי‬% ‫ דער‬,‫וס‬%‫פּיטאן דרײ‬ ַ ‫קא‬ ַ ‫מאן‬ ַ ‫רא‬ ָ ‫פּאריזער‬ ַ ‫טערעסאנטער‬ ַ ( Captain Dreyfus Who Was Sent to Devil ’ s Island : A Truly Interesting Parisian Novel ; Warsaw : Tursh, 1898 ). In other words, this is another ‘ Parisian ’ novel, a kind of continuation of the famous Mystères de Paris. In this novel Dreyfus is depicted as the cheating lover of an innocent young girl who bears his son and then, when Dreyfus abandons her in favor of his wife and legitimate son, swears to take revenge upon him. At this point Esterhazy ( a relative of the abandoned lover ) sets in motion the well-known story of espionage. Freyd continues to spin a complicated tale over the course of dozens of booklets, moving between Devil ’ s Island ( île du Diable, the small island off the coast of French Guiana where Dreyfus was imprisoned ) and the Parisian underworld, and for the sake of solving the mystery he furnishes the Paris police with an experienced female detective. The novel was printed in 53 booklets with continuous pagination. Its publication ceased when the project ’ s initiators stopped paying Freyd the agreed-upon wage.37 Freyd did not completely abandon the Dreyfus affair and in 1899 published a new series of booklets, this time 46 letters supposedly written by Dreyfus to his wife from prison : ‫ פון פראנצאזישען כתב ־ יד‬: ‫ ( דרײפוס ‘ ס בריעף‬Dreyfus ’ Letters : from the French manuscript, translated by M. Y. Freyd ; Warsaw : Boymritter, 1899 ). 36 Freyd 1926 : 341. 37 Ibid., 342. In the same year, 1898, a number of other works were published in Warsaw concerning the Dreyfus affair : ‫דיא מלחמה פון אמת מיט דעם שקר ָאדער דרייפוס אויף דער טייפעל‬ T. Bernarde ‫ פאן‬,‫ ( אינזעל‬The war of truth and lies or Dreyfus on Devil ’ s Island ; this work lacks the sensational elements and concerns only the legal and familial drama ). A further, apparently serious, book was written by M. Gradzensky : ‫ ריכטיגע‬,‫ גענויע‬: ‫דער אמת איז ארויס‬ ‫[ עמיל זאלא‬...] ‫ עסטערהאזי אונ‬,‫ ( בעשרייבונג פון די דריי פראצעססען דרייפוס‬The Truth Comes Out : An Exact, Truthful Description of the Three Frenchmen Dreyfus, Esterhazy and [ … ] Emile Zola ). Nathan Cohen : Sherlock Holmes in the Pale of Settlement 263 In the ĳirst years of the twentieth century, the Warsaw publisher Yehude Leyb Morgenshtern ( 1869 – ? ) published and circulated dozens of booklets of serialized stories. Among these are some bearing appealing titles, including stories of crime and romance involving intricate plots of kidnapped children discovered after many years, usually in tragic circumstances ; sons and daughters discovering that their mothers and fathers are not their biological parents ; violent kidnappings ; property takeovers ; inheritance theft ; false testimonies ; acts of robbery, murder and more.38 The names of the protagonists are generally international, 38 The booklets which include crime stories are : First series : ‫ דער גראסטער רויבער ־ הויפ טמאן‬: ‫רינאלדינא‬ ַ ‫דיא געשיכטע פון א גרויסען מארדער רינאלדי‬ ( ‫ ( פון גאנץ איטאליען ) איין איטאליענישע ערצאהלונג איבערזעצט פון פראנצעזישען‬The Story of a Great Murderer Rinaldi Rinaldina [ ! ] : The Greatest Robber-Chieftain in the Whole of Italy, [ an Italian story translated from French ] ; 1902 ) ; ‫דער אריסטאקראטישער מארדער אלב ערט‬ ‫ וויא ער האט געשאססען דעם רייכען גוט ־ בעזיצער אדאלף רייכערט מיט א פיסטאלעט אונ‬: ‫שווארץ‬ ‫ ( האט בייא איהם צוגערויבט הונדערט אונ זעכציג טויזענד פראנק‬The Aristocratic Murderer Al- bert Shvarts : How he Shot the Rich Landowner Adolf Reykhert with a Pistol and then Stole 160,000 francs ; 1902 ) ; ‫דיא ירושה פון צוועלף מיליאן דאלאר אדער דער רייכער אמעריקאנישער פע־‬ ‫ דאס איז גראסארטיגע געשיכטע וויא א געוויסער באנדיט האט ערמארדעט זיין רייכען פעטער פון‬:‫טער‬ ‫ [ אמעריקא ווענן‬. . . ] ‫ [ כדי ער זעלבסט זאלל בלייבען דער יורש‬. . . ] ‫ ( זייא זענען געפאהרען אויף דעם ים‬The Inheritance of 12 Million Dollars or the Rich American Uncle : A Magniĳicent Story of how a Certain Bandit Murdered His Rich Uncle from America When They Were Sailing at Sea with the Purpose of Becoming His Sole Heir ; 1902 ). ‫דיא קלוגע עליזאבעטא אדער דאס בלוט פון‬ ‫ ( איהר אומשולדיג געמארדעטען ברודער שווייגט נישט‬The Clever Elizabeta or the Blood of Her Innocent Murdered Brother Will not Be Silent ; 1902 ). Second series : ‫ ( דאס קינד אין וואלד צווישען אכט אונ דרייסיג גזלנים‬The Child in the Forest amidst 38 Thieves ; 1902 ). ‫ אין דעם וואלד‬: ‫דער ראזבאיניק מיט דרייצעהן קאפ אונ א שטיינערנע הארץ‬ ‫ ( וואו ער איז געזעסען האט מען פונפציג מייל ארום אונ ארום פאר איהם געציטערט‬The Murderer with Thirteen Heads and a Heart of Stone : In the Forest where He Lived People Shuddered at the Thought of Him for 50 Miles Around ; 1902 ) ; ‫דיא מלחמה מיט א באנדע גזלנים אין ליווער וואלד‬ ‫ זעהר א שרעקליכע ערצאהלונג וויא א באנדע מארדער זיינען איבער געפאללען א‬:‫אין מיטטען דער נאכט‬ [ . . . ] ‫ ( רייכען גראף מיט זיין פאמיליע אויף זייער רייזע אונ האבען זייא אללעמען אויסגעקוילעט‬The War Against a Band of Thieves in “ Liver Forest ” in the Middle of the Night : A Terrible Story of How a Band of Murderers Fell Upon a Rich Count and His Family During their Journey and Shot Them All ; 1902 ). ‫ וואס האט פארגאסען מענשען ־ בלוט אזוי‬: ‫דער גראסטער מארדער פון פאריז‬ ‫ [ האט זיך איהם פארגלוסט צוא שפיללען דיא ראליע פון א גרויסען מאנן אין דער‬. . . ] ‫ נאר‬,‫ווי וואססער‬ [ . . . ] ‫ ( וועלט ־ בעריהמטע שטאדט פאריז‬The Great Murderer of Paris : Who Spilled Human Blood Like Water, and Only Wanted to Play the Role of a Great Man in the World-Famous City of Paris ; 1902 ). ‫ וויא ער איז אוועק מיט זיין גאנצע באנדע אויף דעם ים אונ האט‬:‫דער רויבער ־ הויפטמאן‬ ‫ [ זיך געאפענט א קאנטאר אין פאריז ביז מען האט איהם‬. . . ] ‫ נאכדעם האט ער‬.‫זיי אללעמען דערטרונקען‬ ‫ ( דערקענט אונ מען האט איהם אויפגעהאנגען אין מיטטען שטאדט‬The Robber-Chieftain : How He Sailed the Sea with His Whole Band of Thieves and He Drowned Them All. After that he opened an ofĳice in Paris until he was recognized and hanged in the middle of the town ; 1902 ). ‫ ראמאן‬: ‫ ( דאס גערויבטע קינד אדער דער אטאמאן איבער די וואלד רויבער‬The Kidnapped Child, or The Ataman [ Cossack leader ] of the Forest Robbers : A Novel ; 1902 ). Third series : [ . . . ] ‫ א ביישפיעל פון אמת ‘ ע טרייע ליעבע‬:‫דיא געטרייע ליעבע פון א פּאריזער סטודענט‬ ( The True Love of a Paris Student : An Example of True Love ; 1904 ) ; ‫ רוצחים מיט‬,‫גזלנים‬ ‫ אין דיעזע געשיכטע קומט עס פאר ווי א גרויסע מיליאנער‬:‫שווערדען און ביקסען אין מיטטען דער גאס‬ ‫איז אומגליקליך געווארען דאפיר וואס זיין שאנע פרוי וועלכע איז געוועזען פארבעטען אויף א באלל האט‬ 264 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ with no deĳinable national identity ( Peter, Adolf, Max, Franz, Anton, Charlotte, Margarita, Adela, and so forth ), and the geographic settings move between Galicia, France, and even New York. There is a signiĳicant lack of religious identiĳication. The ĳirst series of stories published by Morgenshtern is a convoluted crime story involving murder and attempted murder for the purpose of ĳinancial gain. The plot, which takes place in central and western Europe and on a boat sailing to the United States of America, relates a complex family tale of separation and re-uniĳication. The police play only a marginal and passive role in the story. The plot of the third series is located in these same geographical settings and also includes kidnapping and enforced separation of family members, who are then thought to be lost forever, as well as detailed descriptions of interrogation ( not by the police ) employing methods of severe torture. In this series the police and legal authorities play no role whatsoever. The plot of the second series also unfolds in various countries and involves murder, robbery, and a family saga. However, in opposition to the other two series, in the last booklet an anonymous detective from the Cracow ( ! ) police appears. As a result of his involvement, the mystery of an attempted murder in Paris is solved and lost family members are reunited in an emotional meeting. Superĳicially, these booklets, their titles and plots, are similar to series of booklets printed in German in the second half of the nineteenth century in the format of Die schwarze Bibliothek ( The Black Library, published in Dresden between 1853 and 1871 ).39 These stories and others like them inspired writers and publishers in Eastern Europe to adapt and suit them to the Yiddish reading public. Some of the stories underwent a process of Judaization, and at times social and religious messages were integrated, as will be demonstrated shortly. ‫ ( זיך געלאזט איינריידען אז גזלנים געהען ארום אין מיטטען שטאדט‬Robbers, Murderers with Swords and Rifles in the Middle of the Street : This Story Tells How a Great Millionaire Became Unlucky When his Beautiful Wife, Who Was Invited to a Ball, Was Convinced that Robbers were Running Around in the Middle of the City ; 1904 ) ; ‫פאר צוואנציג קאזאקען מיט ראפניקעס‬ ‫ אפילו וואס מען האט אונטער דעם לונג און לעבער‬,‫ ( מוז מען זיך שוין מודה זיין אלץ‬Before Twenty Cossacks with Whips one Must Admit Everything, Even One ’ s Innermost Secrets ; 1904 ). Fourth series ( two issues only ) : ‫ פרייא איבערזעצט‬,‫ אדער צווישען גזלנים‬,‫דיא קרעטשמע אין וואלד‬ ‫ ( פון יהושע מזח‬The Inn in the Forest, or Amidst Robbers, freely translated by Yehoyshue Mezakh ; Warsaw : Lebenzon, 1891 ) ; ‫ אדער גענוג געזאגט‬,‫דער מארדער מיט א האק אין דער האנד‬ ‫ ( ודוי ! דיין צייט איז שוין געקומען צו שטארבען‬The Murderer with an Axe in His Hand, or Enough Saying Confession ! The Time Has Come for You to Die ; 1904 ). It should be noted that one of the pen names used by Yehoyshue Mezakh was Yahalom. This pen name appears on many of the stories published by Morgenshtern publishing house, but Yahalom are also the initials of Yehude Leyb Morgenshtern. In every catalog entry these initials are linked to the latter. 39 Each series in this collection numbers 20 booklets. Most of the stories were written by Gustav Adolf Berthold ( 1818 – 1894 ), some by other authors. Many more titles were published in Die schwarze Bibliothek than in the Yiddish series. Nathan Cohen : Sherlock Holmes in the Pale of Settlement 265 The ĳirst booklet in the fourth series, ‫וואלד‬ ַ ‫ ( דיא קרעטשמע אין‬The Inn in the Forest ),40 is the shortest and is exceptional for the Morgenshtern publishing house : it bears a neutral title, lacking any appealing elements, and Yehoyshue Mezakh ( 1834 – 1917 ) is named as translator and adapter of the story. Mezakh was a Vilna Jew, a pious maskil, famous for his popular folk tales. The ĳirst booklet of this series was in fact published twelve years before the second, which was given a signiĳicantly more meaningful title – ,‫דער מארדער מיט א האק אין דער האנד‬ ‫ ( אדער גענוג געזאגט ודוי ! דיין צייט איז שוין געקומען צו שטארבען‬The Murderer with an Axe in His Hand, or Enough Saying Confession ! The Time Has Come for You to Die ).41 These booklets tell the story of the kidnapping of a Jew, a moneylender from the city of Hanau, as a means of extorting money from his brothers and business partners. Thanks to the cunning of the kidnapped brother and the faithfulness of one of the prince ’ s servants, whose name the kidnappers attempt to use in the extortion, the kidnapped Jew is saved and becomes a generous giver of charity. Both installments of the story have a Jewish character and guide the reader to a clear moral lesson : “ ‫רומקייט און חכמה איז דעם מענטשנס גליק‬% „ ( [ only ] piety and wisdom are man ’ s bliss [ and not money ] ).42 Likewise, moral messages are woven into the third booklet of the second series ( ‫פאר‬ . . . ‫ צוואנציג קאזאקען מיט ראפניקעס‬Before Twenty Cossacks with Whips... ),43 including the importance of studying and the value of speaking the truth, the latter with the justiĳication ‫וואס ער‬ ָ ‫גאט‬ ָ ‫דא ַא לעבעדיקער‬ ָ ‫„ עס איז‬ “ ‫ון ַאלעס‬% ‫ ( ווייסט‬there is a living God who knows all ).44 Certain stories were chosen for the purposes of voicing social and / or cultural criticism. For example, amidst the dramatic events of ‫ ( דער ראזבאיניק מיט דרייצעהן קאפ אונ א שטיינערנע הארץ‬The Murderer with Thirteen Heads and a Heart of Stone ; Warsaw, 1903 ), seeking to illustrate the extent to which the inhabitants of Cracow are paralyzed by fear of the murderers in the city, the writer describes how, as a result of this terror, Jews have ceased to purchase any books apart from tkhines. The writer goes on to claim that when Shomer noticed a decline in the purchase of his books he began to write about the tragedy of the Spanish exile and then later, when readers became bored with this topic, he moved on to theatre.45 One story, ‫דער פרומער מערדער אדער דער וועג צום‬ 40 See note 37 above. 41 It is reasonable to suggest that Morgenshtern reprinted the ĳirst booklet close to the publication of the second, but I have not been able to locate a copy. 42 [ . . . ] ‫ דער מארדער מיט א האק אין דער האנד‬, 5. 43 Cf. Fn. 38. 44 [ . . . ] ‫ פאר צוואנציג קאזאקען מיט ראפניקעס‬, 14, 15. 45 A signiĳicant number of works bearing the name of Shomer were published by Morgenshtern. For example an 1885 edition of ‫ די אנטלאפענע טאכטער‬published by Morgenshtern attributed the work to Shomer, but the text is in fact a reprint of Ayzik Meyer Dik ’ s 1856 novel of the same name. It would seem that the writer did not ĳind each and every use of 266 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ‫ ( גליק‬The Pious Murderer, or The Way to Happiness ; Warsaw, 1904 ) ( dif- ferent from Shomer ’ s story of the same title, discussed above ), includes attempted murder for romantic reasons, but most of the work focuses on criticizing Hasidism and preaching the importance of acquiring knowledge, especially learning languages. Disparagement of Hasidim is also alluded to in the story ‫פון לאנדאן קיין אינדיע אדער פון איין חתן מאקס‬ ‫ ( מיט זיין כלה הדסה‬From London to India, or Concerning the Bridegroom Max and His Bride Hadassah ; Warsaw, 1894 ). This complex family saga of love and crime condemns arranged marriages and the religious zeal that prevents the widening of horizons. At the close of the story, following the revelation that a certain Baʿal shem ( wonder-worker ) is a wanted criminal – in addition to his other crimes he has also left behind an agune ( an abandoned wife unable to obtain a divorce ) – the bathhouse attendant is forced to empty the ritual bath ( ‫ ) מקוה‬of its putrid waters, and since this event Jews ( including Jewish women ) have not immersed themselves in the shtetl ’ s mikve.46 A typical title for stories in these series – ‫ ( דער רויבער הויפטמאן‬The Robber-Chieftain ) – appears in the second series published by Morgenshtern and, completely independently, also in Piotrków in 1904, here also similar to the Räuberhauptmann in German stories. The story from Piotrków carries an additional subtitle, ‫דער געשטאכענער פאטער‬ ( The Stabbed Father ), certainly adding a dramatic aspect to a story that weaves social messages into a tense, sensational plot. The plot, set in the ĳirst third of the nineteenth century, concerns a loaded and violent meeting between the leader of a gang of forest-based bandits and his father, a well-known philosopher. In the exchange of words between the two, the son calls his father “ a murdering capitalist ” ( 9 ), accusing him of possessing an uncontrollable appetite for money, as a result of which the son was prevented from marrying his chosen bride. It becomes apparent that the son ( Yohan Nordhaym ) has already succeeded in ending the lives of a number of family members, and the tale concludes with a tragic ĳinale in which the son kills the father and then proceeds to take his own life. ‫אינטערעסאנטער‬ ַ ‫מאריע אין טיורמע ) ַא העכסט‬ ַ ‫ ָאדער‬,‫רומע מערדערין‬% ‫דיא‬ ( ‫וואס דיע לעזער וועלען זיין זעהר צופרידען‬ ָ ‫מאן‬ ַ ‫רא‬ ָ ( The Pious Murderess, or Ma- ria in the Tower – A Highly Interesting Novel Which Will Please Readers ) by Leon Shvarts ( dates unknown ) was also published in Piotrków in 1904 / 5. Although the title of this serialized crime story is sensational, his name acceptable and sued the publisher on account of this ( see the entry on Morgenshtern, Leksikon 1956 – 1981 ( 5 ) : 493 f ). 46 This anonymous work also uses the name of Shomer on the title page, as one who “ took much from it ” for his own stories – “ ‫ „ דער גרויסער מחבר שמר האט פון דעם פיעל ארויס גענומען‬. Nathan Cohen : Sherlock Holmes in the Pale of Settlement 267 the content is quite restrained.47 At the centre of the plot, which takes place in Sachsen, Germany, is a betrayed wife ( Maria ) seeking to cause harm to her husband, but due to confusion and bad luck she is caught shooting at two policemen. Maria is then imprisoned and her husband leaves town with his young lover. The role played by the policemen is minor and the chapters of the story that have reached us do not include any mystery requiring a solution. One of the last crime stories published before the outbreak of the First World War was ‫ון בערדיטשעוו‬% ‫סאנקע‬ ָ ( Sonke from Berditshev ), printed in installments in the Warsaw weekly newspaper ‫ערב‬ ‫ ( שבת‬1913 – 1914 ).48 The real-life heroine of the story, the Jewish Soniya ( Soĳiya ) Bliuvshtein, nicknamed “ ‫דאס גילדערנע הענטל‬ ָ „ ( The golden hand ; Sonka zolotaya ruchka ), became famous in the second half of the nineteenth century as a sophisticated robber into whose life story ĳictional elements are woven : daring and fantastic journeys, the seduction of numerous men, and the amassing of an enormous fortune, at least part of which she apparently actually gave to the poor and oppressed. Sonka of Berditshev ended her life as a prisoner in a penal colony on the island of Sakhalin. A ĳilm about Sonka, described by Richard Stites as “ one of the greatest hits of early cinema, ” was screened in Russian cinemas in 1914, one of many dramatizations of Russian crime stories for theater and cinema.49 The written adventures of Sonka, published in Russian in 1903, apparently had no influence on Yiddish literature. The ĳilm, on the other hand, found an immediate response in the story discussed above. An early Yiddish detective story – set in an unidentiĳied location, although all the protagonists are given titles in Russian and Polish – was published in Warsaw in 1884 under the title ‫דער קלוגער סליעדאוואטעל‬ ( The Wise Detective ), without the name of an author, translator or source text. This is a classic although quite primitive story, in which a quick-witted police detective succeeds in revealing the truth behind the apparent attempt of a woman to murder her husband and then kill herself. Thanks to his sharpened senses and acumen, the detective succeeds in discovering, stage by stage, that the husband is a violent and 47 This title is given to two booklets. At the end of the second booklet the readers are directed to the conclusion of the story in a third booklet entitled ‫אוגאסטין‬ ָ ‫דער טויט פון‬ ( The Death of Ogostin ), which was apparently never printed. It appears that in these years Piotrków took Warsaw ’ s place as the center of crime publishing, but the market was not dominated by a single publishing house and the levels of success achieved by Morgenshtern were not replicated. 48 The story was printed in 13 installments between 18 April/1 May 1914 and 11/24 July 1914. 49 Stites 1992 : 24. For more on the ĳilm and its heroine see Brooks 1985 : 203 f ; Smith and Kelly 1998 : 120 ; and Von Geldern and McRynolds 1998 : 161 – 269. 268 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ adulterous man who, with the encouragement of his sister, murdered both his wife and a man who witnessed the deed. At the conclusion of the tale, the murderer is sent to Siberia and his sister loses her mind. Apart from the thrilling kernel of the story, the plot is also exploited to voice implicit criticism of the tradition of arranging marriages at a young age, solely according to the wishes of the parents, and without taking into consideration the feelings of the couple.50 Identiĳied and Translated Detective Stories Emile Gaboriau ( 1832 – 1873 ), a French writer influenced by Poe and well known for his commercial success, focused his works on depictions of intricate police investigations and developed the character of the sophisticated detective.51 His work La Corde au cou ( 1873 ) was translated into Yiddish by Philip Krants ( 1858 – 1922 ), at the time residing in the United States, as ‫האלדז‬ ַ ‫ ( ַא שטריק ַארום‬A Rope Around the Neck ; Vilna, 1901 ). Krants was known as the adaptor and author of popular scientiĳic works and the editor of the New York Yiddish socialist newspaper, ‫צײטונג‬ ַ ‫ ַארבעטער‬, in which he published ‫ ( די ערמארדערטע אלמנה‬The Murdered Widow – a translation of the 1866 novel L ’Affaire Lerouge, Gaboriau ’ s ĳirst detective story ) as early as 1893. Other translations of French detective novels included the translation of a story by Marie François Goron, commander of the Parisian secret police from 1887 to 1894, ‫קאסטן‬ ַ ‫ ( דער טויטער אין‬The Dead Man in a Chest ),52 published in the ‫געבלאט‬ ַ ‫טא‬ ַ ‫לאדזער‬ ָ , but for some reason which remains unclear, the story was not translated in its entirety. Crime stories set in Paris, the names of the authors or translators of which are unknown, were printed in the competing Lodz newspaper ‫לאדזער‬ ָ ‫נײעס‬ ַ ‫רגענבלאט‬ ַ ‫מא‬ ָ . These included ‫באנדיט אין עקספּרעס צוג‬ ַ ‫ ( דער‬The Bandit on the Express Train ) and ‫ ( שרעק‬Fear ).53 The ĳinal series of crime and police stories printed in serialized form before the outbreak of the First World War, also appearing in Lodz in the winter of 1914, was 813, from the stories about Arsène Lupin,‫בארימטער דזשענטעלמען ־ גנב “י‬ ַ ‫ “ ( י„ דער‬the 50 This story was printed at least twice in Vilna, in 1897 and 1910. 51 Schutt 2003 : 63 – 68 ; Knight 2004, 48 – 52. 52 The translation was published twice weekly ( with breaks ) between 2/15 January and 19 March/1 April 1909, as part of a planned series ‫טאגבוך פון דעם דירעק־‬ ָ : ‫אין די טיפענישן פון לעבן‬ ‫פּאליציי‬ ָ ‫פּאריזער געהיים ־‬ ַ ‫טאר פון‬ ָ ( In the Depths of Life : The Diary of the Director of the Paris Secret Police ). This story, and the whole series, were adapted from the writer ’ s memoires, Les mémoires de M. Goron, ancient chef de la Sûreté ( Paris, 1897 – 1898 ), which had appeared in Polish translation within a year of their original publication. 53 The ĳirst story was published on 9 / 22 October and 10 / 23 October 1912 and the second on 16 / 29 October and 17 / 30 October 1912. Nathan Cohen : Sherlock Holmes in the Pale of Settlement 269 famous gentleman-thief ” ), by Maurice Leblanc, translated and adapted by Avrom Leyb Yakobovitch ( 1882 – 1964 ).54 As in the source text, here too a conflict takes place between the ‘ honest criminal ’ Lupin and Sherlock Holmes, yet while in the original the name of the British detective is only hinted at, in the Yiddish translation it is clearly stated.55 The Lodz newspapers also brought to their readers echoes of events taking place in the American underworld. The ĳirst to do so was the ‫געבלאט‬ ַ ‫טא‬ ַ , which in October 1911 published a serialized novel entitled ‫מאן‬ ַ ‫רא‬ ָ ‫שפּאנענדער‬ ַ ‫אינטערעסאנטער און‬ ַ ‫ ַא העכסט‬: ‫האנד‬ ַ ‫שווארצע‬ ַ ‫דיא‬ ‫יארקער לעבען‬ ָ ‫ון ניו ־‬% ( The Black Hand : A highly Interesting and Thrilling Novel about New York life ). The name of the novel is taken from the name of gangs of extortionists ( Black Hand [ Mano Nera ] ) who terrorized New York and Chicago at the beginning of the twentieth century, for the most part the communities of Sicilian immigrants in both these cities.56 In order to arouse the interest of the Jewish reader, the plot depicts the murder of a New York Jewish millionaire by the gang ’ s members. A competing newspaper, ‫רגענבלאט‬ ַ ‫מא‬ ָ , also used the title ‫דיא‬ ‫ ( שווארצע האנד‬The Black Hand ), but preferred to bring the setting of events ‘ home ’ – ‫לאדזער לעבען‬ ָ ‫מאן פון‬ ַ ‫רא‬ ָ ‫שפּאנענדער‬ ַ ‫ ( ַא‬A Thrilling Novel about Life in Lodz ) – providing the reader with a love story totally disconnected from the world of crime.57 From the beginning of its publication ( in May 1907 ), the weekly literary journal ‫צײטונג‬ ַ ‫מאנ ־‬ ַ ‫רא‬ ָ ( Warsaw, 1907 – 1908 ), edited and published by the educator and businessman Magnus Krinsky ( 1863 – 1916 ), printed three stories by Edgar Allan Poe 58 and four by Arthur Conan Doyle, clearly indicating the names of these writers, but usually without the name of the translator( s ). The hero of Conan Doyle ’ s stories is Sherlock Holmes, but only the title of the last story is similar to that of the source 54 Maurice Leblanc, ( ‫פּאריזער לעבן‬ ַ ‫בארימטן דעטעקטיוו ) פון‬ ַ ‫ די וווּנדערליכע מעשׂה פון ַא‬: 813 „ ( 813 : The Wonderful Story of a Famous Detective [ from Parisian life ] ), ‫געבלאט‬ ַ ‫טא‬ ָ ‫לאדזער‬ ָ , 10/23 January – 27 March/9 April 1914. Another story by the author, lacking the element of crime, was published under the title ‫ ( דער שרעקלעכער געלעכטער‬The Horrible Laughter ), ‫ ערב ־ שבת‬25 ( 1913 ), 2 f. 55 Ibid., 11 / 24, 12 / 25, 13 / 26 February 1914. For more on the meetings between Lupin and Holmes see Knight 2002 : 72 ; Schutt 2003 : 70 f. 56 The novel was published between 14/27 October 1911 and 11/24 January 1912. On the Black Hand gangs and their deeds of iniquity see Lombardo 2002 : 394 – 409. 57 ‫רגענבלאט‬ ַ ‫מא‬ ָ ‫לאדזער‬ ָ ‫נײעס‬ ַ , 23 September / 5 October 1913 – 13 / 26 November 1913. In the National Library of Israel in Jerusalem there exists a book entitled ‫האנד‬ ַ ‫שווארצע‬ ַ ‫ ( די‬The Black Hand ), lacking date and place of publication. An examination of the contents demonstrates that there is no link between it and the topic discussed herein. 58 Eight additional stories by Poe were published slightly later ( 1910 ) in the monthly journal ‫ליטראטור‬ ַ ‫אייראפּעישע‬ ָ , edited by Avrom Reyzen ( 1876 – 1953 ). Another story by Poe was published in a booklet entitled ‫ווילסאן‬ ָ ‫ווילליאם‬ ַ ( William Wilson ; Warsaw : Progres, 1914 ), and ĳive more appeared in the booklet ‫ ( אויסגעוועהלטע ערצעהלונגען‬Selected Stories ; Warsaw : Progress, 1913 ). ‫לקט‬ ‫‬ ‫הײנט‬ ‫ייִ דישע שטודיעס ַ‬ ‫‪270‬‬ Nathan Cohen : Sherlock Holmes in the Pale of Settlement 271 text – ‫ון רייגעט‬% ‫גוטבאזיצער‬ ַ ‫ ( די‬The Landowners of Reigate ; the title of the English original is “ The Reigate Squires ” ).59 The other stories carry more enticing titles than the original texts : ‫ ( די שרעקליכע געהיימניס‬The Terrible Mystery ; originally “ The Adventure of the ‘ Gloria Scott ’ ” ) ;60 ‫די פרוי מיטן‬ ‫רעוואלווער‬ ָ ( The Woman with a Revolver ; originally “ The Adventure of Charles Augustus Milverton ” ) ;61 and ‫ ( מיס אירענע ַאדלער‬Miss Irene Adler ; originally “ A Scandal in Bohemia ” ).62 Apart from the changes in titles, the translations, apparently the fruit of the editor ’ s pen, contain only minor alterations, the most prominent of which is the transliteration ( rather than translation ) of the name of the street on which Sherlock Holmes resided, Baker Street, to ‫דער בעקער ־ סטריט‬. In the second story, instead of “ port wine, ” the Yiddish sufĳices itself with “ wine ” only. The name of the ship “ Hotspur ” in the third story is written “ Gotspur ” in the Yiddish, so too “ Hudson ” has become “ Gudson. ” The use of ‘ g ’ instead of ‘ h ’ may indicate that the stories were translated from Russian. In 1907 the ĳirst and ( apparently ) last booklet in what was intended to be the collected stories of Sherlock Holmes was published : a precise translation of the story “ The Resident Patient ” entitled ‫דער שטענדיקער‬ ‫פּאציענט‬ ַ ( The Permanent Patient ).63 Prompted by the appearance of a new daily newspaper in Warsaw, ‫הײנט‬ ַ , in January 1908, the title pages of the existing popular daily ‫געבלאט‬ ַ ‫טא‬ ַ ‫אידישעס‬i( 1906 – 1911 ) announced that it was to publish a new series of stories, ‫די גרעסטע וועלט ־ געהיימניסן‬ ( The Greatest World Mysteries ), from the tales of Sherlock Holmes, Nat Pinkerton, and others. The ĳirst story, serialized in 13 installments, was a further translation of the story “ A Scandal in Bohemia, ” entitled in Yiddish ‫קארטע‬ ַ ‫גראפישע‬ ַ ‫טא‬ ָ ‫פא‬ ָ ‫ ( ַא קעניגליכע‬A Royal Photographic Card ), without the opening of the source story.64 It would appear that the decision to begin the series with this story was motivated by the fact that it does not contain an act of murder and the Warsaw origins of the heroine, who succeeds in deceiving the acclaimed detective. For unknown reasons this story was also the last in this promising series. 59 Issues no. 5 – 7 ( 1908 ), 139 – 146, 177 – 182, 207 – 212. 60 Issues no. 1 – 5 ( 1907 ), 21 – 26, 57 – 60, 85 – 90, 119 – 124. 61 Issues no. 26 – 27 ( 1907 ), 821 – 826, 849 – 858. 62 Issues no. 29 – 32 ( 1907 ), 919 – 923, 941 – 946, 967 – 976, 999 – 1004. It should be noted that as in the following publication of this story ( see below ), the editors almost completely avoided the explicit use of the term ‘ Bohemia ’ in the title and body of the story, apparently for political reasons. 63 ‫ דער שטענדיגער פאציענט‬: ‫ זיינע כתבים פון קאנאן דויל‬:‫שערלאק חאלמס דער בעריהמטער סישציק‬ ( Sherlock Holmes the Famous Detective : The Writings of Conan Doyle – The Permanent Patient ; Warsaw : Edelsteyn, 1907 ). 64 The announcement was published almost daily in the second and third weeks of May 1908. The story was published between 22 May/4 June and 19 June/2 July 1908. 272 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ At the same time as these publications appeared, other booklets appeared in Yiddish ( likewise in Russian and Polish ) bearing the name of the famous detective, but lacking the name of the author, and with a ‘ new ’ assistant, Harry Taxon. Into these booklets were inserted stories of various bizarre murders lacking any connection to the original hero and his surroundings. One series of these booklets was published at the initiative of the Vigoda publishing house and Ha-ẓěf īrāh publishers in Warsaw ( c. 1907 – 1908 ). Each story was divided into three booklets of 47 pages, sold for the minimal sum of three kopeks each.65 Another series was published in Cracow and circulated across the border. These stories appeared in single booklets of 21 pages each, sold at the relatively high price of ten kopeks per booklet.66 These stories and their predecessors were translated from two similar series in Polish, one published in Warsaw in the years 1907 – 1909 ( 52 booklets ) and the other in Cracow, 1908 – 1909 ( 86 booklets ). The Polish Cracow series was translated from a German series, Aus den Geheimakten des Weltdetektivs ( from 1907, 230 booklets ), with Sherlock Holmes as its main hero and Harry Dickson as 65 The series as a whole is entitled : ‫אינטערעסאנטע וואונדערליכע‬ ַ ‫ העכסט‬: ‫האלמס‬ ָ ‫שערלאק‬ ָ ‫האלמס‬ ָ ‫שערלאק ־‬ ָ ‫ ( ערצעהלונגען פון וועלט בעריהמטען גיהיים ־ ַאגענט‬Sherlock Holmes : A Highly Interesting Wonderful Tale of the World-Famous Secret Agent Sherlock Holmes ). The title page of the booklet includes a portrait of Holmes and next to him portraits of Nat Pinkerton and Nick Carter ( although I am not aware of translations of any of the stories concerning Pinkerton and Carter into Yiddish ) and also an illustration characteristic of the title of the story. In the Israel National Library in Jerusalem and in the yivo Institute for Jewish Research in New York I was able to ĳind three series ( totaling seven booklets ) bearing the titles : ‫ ( דער פרויען ־ מערדער‬The Women-Murderer ; nos. 1 – 3 ) ; ‫באנדיט‬ ַ ‫קראטישער‬ ַ ‫ריסטא‬ ָ ‫דער ַא‬ ( The Noble Bandit ; nos. 4 – 6 ) ; and ‫לקאלם‬ ָ ‫מא‬ ַ ‫מארד פון פירשטין‬ ָ ‫ ( דער‬The Murder of Duchess Malcolm ; nos. 7 – [ 9 ] ). On the custom of employing the names of famous detectives as a technique of sales promotion for other stories see above. It should be noted that the name Harry Taxon was ‘ adopted ’ from a German series with the hero Harry Dickson, as Holmes ’ friend ( about which see note 66 below ). 66 This series is entitled ‫בארימטער וועלטדעטעקטיוו‬ ַ ‫ דער‬: ‫האלמעס‬ ָ ‫שערלאק‬ ָ ( Sherlock Holmes : The Famous World-Detective ). The title page features only a portrait of the detective and an illustration suited to the story. The price is noted in heler and in kopeks. It would seem likely that the relatively high price resulted from the distance between the place of printing and the market itself and it is possible that this is a slightly later publication than that discussed above ( c. 1909 ). The titles which I have been able to see are : ‫האלמעס אין ווין‬ ָ ‫שערלאק‬ ָ ( Sherlock Holmes in Vienna ; no. 1 ) ; ‫נגעלא‬ ָ ‫דאס צירקוס ַא‬ ָ ‫האלמעס און‬ ָ ‫שערלאק‬ ָ ( Sherlock Holmes and the Angelo Circus ; no. 2 ) ; ‫ ( צווישן הימעל און ערד‬Between Heaven and Earth ; no. 3 ) ; ‫דער‬ ַ ‫ ( דער‬The Mass-Murderer ; no. ‫פּיטאן‬ ַ ‫קא‬ ַ ‫פארלוירענער‬ ַ ( The Lost Captain ; no. 4 ) ; ‫מאסענמערדער‬ 9 ), in which Sherlock Holmes is studying medicine in Brooklyn, New York ; and ‫די מפלה‬ ‫פלאקס‬ ַ .‫פראפ‬ ָ ‫ ( פונ ’ ם‬The Overthrow of Prof. Flax ; no. 10 ). On the German series see http :// www.sherlockiana.dk/hjemmesider/Om%20museet/hefteserier/Om%20hefteserier/hefteserier.htm and http ://www.sherlockiana.dk/hjemmesider/Om%20museet/hefteserier/ Original%20German/Tysk%20original.htm. Last access : 20 April 2012. Nathan Cohen : Sherlock Holmes in the Pale of Settlement 273 his friend. The Yiddish stories of this series were translated either from the original German or the Polish translation. The colorful cover pages of the Yiddish booklets were also copied from the German ( or Polish ) series ( Russian publications of the series had the same format ).67 At the same time, in Congress Poland other booklets of a format similar to those discussed above circulated featuring the hero ‫מאקס‬ ַ ‫האלמעס‬ ָ ‫שערלאק‬ ָ ‫ דער ווינער‬,‫ דער קעניג פון די דעטעקטיווס‬:‫שפיצקאפף‬ ָ ( Max Shpitskop [ or Spitzkopf ] : The King of Detectives, the Viennese Sherlock Holmes ). Shpitskop is a Jewish detective with a Jewish assistant, Fuks ; the two work from an ofĳice in Vienna named “ Blits. ” Shpitskop ’ s work is not connected in any way to his religion, but according to the advertisement for the booklets, when presented with the opportunity he immediately comes to the defense of his people.68 Information on the circulation of these booklets in Warsaw may be found in the childhood memories of Isaac Bashevis Singer, who mentions them together with the Sherlock Holmes booklets he also read at the time.69 In opposition to the series discussed above that, inspired by similar booklets in Polish, ‘ adopted ’ the character of Sherlock Holmes, it would seem that the anonymous initiators of the stories about Detective Shpitskop were inspired by popular stories about the Viennese detectives Josef Müller ( created by the writer August Groner, 1850 – 1929 ) or Dagobert Trosler ( by Balduin Groller, 1848 – 1916 ) ; the latter is similar to Sherlock Holmes in terms of character and the plots in which he is involved.70 It is signiĳicant that in the years during which Yiddish detective stories reached the height of their popularity ( 1908 – 1914 ), Rabbi Yehuda Yudl Rosenberg ( 1859 – 1935 ) published a number of original stories, written in Hebrew and Yiddish. Aside from their clearly pious context, Rosenberg ’ s works demonstrate the influence of the detective story. One of these stories even mentions the name of Conan Doyle.71 67 Dunin and Mierzwianka 1984 : 84 – 86 ; 89 – 91. 68 According to the advertisement on the back cover of the booklets, 12 were published in the series. I have seen ‫מיליאנער‬ ָ ‫דאס געהיימניס פון ַא‬ ָ ( The Mystery of a Millionaire ) and ‫ַא‬ ( The Mysterious Murder ). The year of publication is not noted on ‫מארד‬ ָ ‫רעטהזעלהאפטער‬ ַ the booklets, which were published in Cracow by Jüdischer Roman-Verlag in the publishing house of Yosef Fisher. It should be noted that these booklets were the source for a later reincarnation of detective booklets that appear to have been published in the 1920s, entitled ‫האלמעס‬ ָ ‫שערלאק‬ ָ ‫פאריזער‬ ַ ‫ דער‬,‫ דער קעניג פון די דעטעקטיווס‬: ‫מסאן‬ ָ ‫וויליא‬ ַ ( Williamson : The King of Detectives, the Parisian Sherlock Holmes ; Warsaw : Goldfarb publishing ). 69 Bashevis Singer 1963. 70 On these writers and their heroes see Tannert and Kratz 1999. 71 See Yasif 1991 : especially 10 – 28. 274 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Criticism Responding to an angry letter from a reader of ‫ראמאנ ־ צייטונג‬ ָ complaining about the inclusion of ‘ shund,’ in the form of detective stories, in a serious newspaper, the acting editor and prominent translator A. L. Yakobovitch seized the opportunity to acquaint readers with the writers Arthur Conan Doyle and Edgar Allan Poe, the character Sherlock Holmes, and the contribution of the last of these to society, and to specify that these stories were considered ‘ literature for its own sake. ’ Yakobovitch warned readers against the widely circulating booklets translated from Russian and Polish bearing the name of the famous detective but not attributed to any speciĳic author : in his opinion these booklets constituted a danger to the relatively inadequate Yiddish literature, and it was necessary to avoid them as much as possible.72 An anonymous review in Odessa, ( purportedly ? ) written by a woman, condemned stories of terror because depressed young readers, due to their age, were not able to cope with the negative content contained therein. Pinkerton, Carter, and other damaging publications, the reviewer writes, corrupt readers ’ taste and their estimation for the written word. Young people need an enriching literature which will support and nurture them at the outset of their lives.73 A satirical review, in the form of a short story set in the ofĳice of a well-known London detective, portrayed Sherlock Holmes as an arrogant person whose faith in his abilities to detect the hidden characteristics of others eventually results in a humiliating defeat that shows him to be nothing more than an empty vessel. The review ends with wish, “ Let us hope that he will no longer rule over minds. ” 74 A similar motivation inspired another satirical story by the writer Zalman Vendrof ( 1879 – 1972 ). The hero of the story, Khone, the son of Getsl the money lender in the shtetl of “ Pupkeve, ” does nothing but “ sit all day long and half the night reading detective stories and crime chronicles, together with newspaper reports about the courthouses. ” 75 Khone knows by heart the most intimate details of all the criminal events of the preceding decade. He keeps detailed lists of victims of crime and of the histories of “ all the great murderers and bandits, money forgers, cheats, blackmailers, arsonists, forgers of wills, bank swin72 Noel ( A. L. Yakobovits ) 1907. It should be noted that Yakobovitch himself, a known translator, was forced to translate ‘ shund ’ novels for the daily popular press as a source of income ( see Shmeruk 1983 b ). 73 ‫טאכטער‬ ָ ‫ ַא אידישע‬1910 a and 1910 b. I would like to thank Dr. Nurit Orchan for bringing this review and others mentioned here to my attention. 74 Zhaliklerk 1910. 75 Vendrof 1913. Nathan Cohen : Sherlock Holmes in the Pale of Settlement 275 dlers, thieves and other criminals ” about whom he reads in the newspapers in his collection. Khone also knows every detail concerning the characteristics of Russian and foreign secret agents and detectives. Khone, nicknamed “ The Pupkeve Sherlock Holmes, ” decides to exploit a series of ĳires which break out across the shtetl and expose the arsonist terrorizing the shtetl ’ s Jews. Vendrof describes Khone ’ s actions and his humiliating defeat in a ridiculing manner, with the clear intent of warning potential readers against the superĳiciality and worthlessness of reading unrealistic detective stories and reports in the newspapers from police stations and courthouses.76 In January 1909 a theater troupe starring Ester Rokhl Kaminsky staged a drama in four parts entitled “ Sherlock Holmes ” in the “ Muranov ” theatre in Warsaw.77 On Shabbat, the day before Tisha B ’Av 1910 ( 13 August ), the play “ Sherlock Holmes, ” a comedy in four acts staring Julius Adler, translated from the German by Anshel Shor, premiered at the “ Great Theatre ” in Lodz managed by Y. G. Zandberg.78 The editor of the ‫לאדזער טאגעבלאט‬ ָ , Lazar Kahan, described the latter as a refreshing innovation in the dull landscape of current Yiddish theatre. He added that the play could not be compared with the common ‘ shund ’ booklets so detrimental to the literary value of both the hero and writer.79 Conclusion Various types of crime stories have existed in Yiddish since the 1860s, undoubtedly inspired by similar literature in the surrounding languages ( Russian, Polish, and German ). Just as European belles lettres found their way to Yiddish readers through translations and adaptations even before the invention of the printing press, so too in the second half of the nineteenth and the ĳirst decade of the twentieth century Yiddish readers were exposed to this popular genre. At a time when newspapers, in all languages, were becoming more readily available to growing readerships and providing up-to-date information on a variety of topics, including detailed reports from the diaries of police stations and courthouses, this information, combined with the development of European crime stories and the existence of folk tales concerning bandits 76 A similar motivation caused another writer to depict a Jewish coachman / carter with detective abilities who supposedly surprises the great Sherlock Holmes himself ( L. B., ‫ווי‬ ‫האט דערקענט דעם גרויסן סיסטשיק‬ ָ ‫איזוואשטשיק‬ ָ ‫ [ ַאזוי דער‬How the Coachman Recognized the Great Detective ], ‫מארגען‬ ָ ‫גוט‬i, 13 / 26 June 1911, 3 ). 77 According to announcements in the newspaper ‫ אונדזער לעבען‬from 9 / 22 January. 78 ‫ לאדזער טאגעבלאט‬, 31 July / 13 August and 12 / 25 August 1910. 79 Lazar 1910. 276 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ and criminals, motivated writers, translators, adaptors, and publishers to print Yiddish tales of suspense and drama from the ‘ big wide world, ’ the events of which take place far away from familiar Eastern European shetls and towns. At times these stories included a didactic message, but usually they were intended to entertain and to convince readers to buy the next installment in the dramatic story. Their circulation, in the form of detective booklets and stories serialized in newspapers and journals in Yiddish ( and Polish ), reached a peak in the years 1907 – 1910. Following this there was a marked decline in demand and, in the period after the First World War, this literature was pushed to the sidelines of the Yiddish book market in Poland. It is possible that, due to the increased use of Polish in daily life, Jewish readers began to read works such as these in Polish. However, there is no doubt that the cinema became the principal supplier of crime and detective stories for entertainment purposes for both the general and Jewish audiences. Translated by Rebecca Wolpe Bibliography A yidishe tokhter, 1910 a : “ Lebedike shotns. ” In : Gut morgn, 14 / 26 May. – 1910b : “ Lebedike shotns. ” In : Gut morgn, 3 / 15 June. Bashevis Singer, Isaac, 1963 : “ Fun der alter un nayer heym. ” In : Forverts 15 November. Brantlinger, Patrick, 1982 : “ What Is ‘ Sensational ’ about the ‘ Sensation Novel ’ ? ” In : Nineteenth Century Fiction 37 : 1 – 28. Brooks, Jeffrey, 1978 : “ Readers and Reading at the End of the Tsarist Era. ” In : William Mills Todd iii, ed., Literature and Society in Imperial Russia, 1800 – 1914. Stanford : Stanford University Press, 97 – 150. – 1985 : When Russia Learned to Read : Literacy and Popular Literature, 1861 – 1917. Princeton : Princeton University Press. Brower, Daniel R., 1990 : The Russian City between Tradition and Modernity, 1850 – 1900. Berkeley, Los Angeles and Oxford : University of California Press. Dunin, Janusz and Knorowski, Zdzisław, 1984 : Polskie Powieściowe serie zeszytowe : Materiały bibliograĳiczne. Łódź : Universytet Łódzki. – and Mierzwianka, Krystyna, 1978 : Polska powieść zeszytowa : Materiały bibliograĳiczne. Wrocław : Wydawnictwa Universytetu Wrocławskiego. Nathan Cohen : Sherlock Holmes in the Pale of Settlement 277 Freyd, M. Y., 1926 : “ Der ershter yidisher sensatsyoneler roman. ” In : Literarishe bleter 18 : 340 – 342. Fullerton, Roland, 1979 : “ Toward a Commercial Popular Culture in Germany : The Development of Pamphlet Fiction, 1871 – 1914. ” In : Journal of Social History 12 :4 : 489 – 511. Grace-Pollack, Sophie, 1999 : “ Šōmēr lě- ʼ ōr Shomers mishpet lě-ŠālōmAlēykhem. ” In : Ḥuliot 5 : 109 – 160. Handelzalts, Michael, 2006 : Taʿalūmat ha-ballāš ben hā- ʼ almāwet. Tel Aviv : Mapa. Hart, Gail, 2008 : “ Robbers, Readers, and Security : Christian August Vulpius and the Art of Mass Appeal. ” In : Seminar 44 ( 3 ) : 318 – 333. Hogle, Jerrold E. ( ed. ) 2002 : The Cambridge Companion to Gothic Fiction. Cambridge : Cambridge University Press. Hügel, Hans-Otto, 1978 : Untersuchungsrichter, Diebsfänger, Detektive : Theorie und Geschichte der deutschen Detektiverzählung im 19. Jahrhundert. Stuttgart : J. B. Metzlersche Verlagsbuchhandlung. Kayman, Martin A., 2003 : “ The Short Story from Poe to Chesterton. ” In : Martin Priestman, ed., The Cambridge Companion to Crime Fiction. Cambridge : Cambridge University Press, 41 – 58. Knight, Stephen, 2004 : Crime Fiction 1800 – 2000 : Detection, Death, Diversity. New York : Palgrave Macmillan. Lazar [ Kahan ], Y., 1919 : “ Teater un muzik : ‘ Sherlok Kholms [ … ].’” In : Lodzher tageblat, 4 / 17 August. Leksikon, 1956 – 1981 : Leksikon fun der nayer yidisher literatur. 8 Vols. New York : Alveltlekher yidisher kultur-kongres. Lombardo, Robert M., 2002 : “ The Black Hand : Terror by Letter in Chicago. ” In : Journal of Contemporary Criminal Justice 18 ( 4 ) : 394 – 409. Martuszewska, Anna, 1992 : “ Literatura obiegów popularnych. ” In : Alina Brodzka et al., eds., Słownik Literatury Polskiej xx Wieku. Wrocław – Warsaw – Kraków : Zakład Narodowy im Ossolińskich Wydawnictwo, 577 – 587. Miron, Dan, 1988 : Bōdědīm bě-mō ‘ adām. Tel Aviv : Am Oved, Sifriat ʼAĳikim. Noel [ A. L. Yakobovits ], 1907 : “ Vegn der Sherlok Holms-literatur. ” In : Roman-tsaytung 29 : 923 – 926. Oyslender, Nokhem, [ 1930 ] 1993 : “ Varshever mekhabrim in di 50er – 60er yorn. ” In : Chava Turniansky, ed., Di yidishe literatur in nayntsntn yorhundert : zamlung fun yidisher literatur-forshung un kritik in Ratn-farband. Jerusalem : The Department of Yiddish at the Hebrew University of Jerusalem and Magnes Press, 241 – 288. 278 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Priestman, Martin, 2003 : The Cambridge Companion to Crime Fiction. Cambridge : Cambridge University Press. Pykett, Lin, 2003 : “ The Newgate Novel and Sensation Fiction, 1830 – 1868. ” In : Martin Priestman, ed., The Cambridge Companion to Crime Fiction. Cambridge : Cambridge University Press, 32 – 37. Schenda, Rudolf, 1976 : Die Lesestoffe der Kleinen Leute : Studien zur Populären Literatur im 19. und 20. Jahrhundert. München : C. H. Beck. Schutt, Sita A., 2003 : “ French Crime Fiction. ” In : Martin Priestman, ed., The Cambridge Companion to Crime Fiction. Cambridge : Cambridge University Press, 59 – 76. Sha ’anan, Avraham, 1952 : ‘ Iyyūnīm bě-sifrūt ha-haśkālāh. Merhaviah : Sifriyat hapoalim. Sholem Aleichem, 1883 : “ Tsvey shteyner. ” In : Yudishes folks-blat 28 : 387 – 392 ; 29 : 423 – 426 ; 30 : 455 – 458. Shomer-Batsheles, Roza, 1950 : Undzer foter Shomer. New York : Ikuf. Shmeruk, Chone, 1983a : “ Lě-tōlědōt sifrūt ha-‘ šūnd ’ bě-yīdīš. ” In : Tarbiẓ 52 : 325 – 350. – 1983b : “ Tě ‘ ūdāh nědirāh lě-tōlědōteyāh šel sifrūt ha-lō ’ q ʼ anōnīt běyīdīš. ” In : Ha-sifrut 32 : 13 – 33. Smith, Steve and Kelly, Catriona, 1998 : “ Commercial Culture and Consumerism. ” In : Catriona Kelly and David Shepherd, eds., Constructing Russian Culture in the Age of Revolution : 1881 – 1940. Oxford : Oxford University Press, 106 – 164. Stites, Richard, 1992 : Russian Popular Culture : Entertainment and Society since 1900. Cambridge : Cambridge University Press. Symons, Julian, 1972 : Bloody Murder : From the Detective Story to the Crime Novel, A History. Harmondsworth, Middlesex : Penguin. Tannert, Mary W. and Kratz, Henry, trans. and eds., 1999 : Early German and Austrian Detective Fiction : An Anthology. Jefferson, North Carolina and London : McFarland & Company. Vendrof [ Wendroff ], Zalmen, 1913 : “ Sherlok Holms fun Pupkeve. ” In : Haynt 3 / 16 May : 3 and 5 / 18 May : 2. Von Geldern, James and McReynolds, Louise, eds., 1998 : Entertaining Tsarist Russia. Bloomington : Indiana University Press. Yasif, Eli, 1991 : Yěhūdāh Yūdl Rōzenberg, ha-gōlem mi-pra ’ g ū-ma ‘ aśīm niflā ’ īm aḥērīm. Jerusalem : Mosad Bialik. Zhaliklerk, Etienne, [ ? ] 1910 : “ Der sof fun Sherlok Holms. ” In : Vokhnzhurnal “ Di naye velt ” 158 : 481 – 486. ‫עלטערע טעקסטן‬ Ältere Jiddistik Early Yiddish Erika Timm Abraham ibn Ezra und das Maiśebuch Der folgende Beitrag ist einem jüdischen Volkserzählungs-Typ gewidmet, der durch zwei inhaltliche Elemente deĳiniert wird : ( 1 ) In einem nichtjüdischen Staat besteht ein Gesetz, wonach jährlich zu einem gewissen Feiertag der herrschenden Religion ein durch das Los bestimmter Jude zu töten ist ( selten : deren zwei ). ( 2 ) Eine große Gestalt der jüdischen Tradition ( am häuĳigsten Abraham ibn Ezra ) erscheint unerwartet, erzwingt durch ihre Klugheit, verstärkt durch übernatürliche Kräfte, die Abschaffung des Gesetzes und rettet dadurch zugleich den ( oder die beiden ) soeben ausgelosten Juden. Dov Noy hat diesen Typ der jüdischen Volkserzählung schon 1960 1 ausdrücklich als ‘aẓmā ’ ī und měqōrī, als selbständigen Typ und als originär jüdisch, bezeichnet.2 Nicht zu diesem Typ gehören also alle – wenn auch verwandten – Erzählungen, in denen sich die antijüdische Aktivität unmittelbar gegen ein jüdisches Kollektiv als Ganzes, etwa eine Gemeinde oder › die Juden ‹ schlechthin, richtet ; ebenso wenig jene, in denen ein oder mehrere Juden einer bestimmten Straftat bezichtigt werden. Im ersten Teil des Beitrages werden zwei engstens miteinander verwandte, bisher unbekannte altjiddische Versionen des so deĳinierten Typs ediert, die beide der Tradition des Maiśebuchs zuzurechnen sind, obwohl sie weder in dessen Erstauflage von 1602 noch in einer späteren Auflage erscheinen, und die zudem zu den ältesten erhaltenen Zeugen des Typs gehören, wahrscheinlich sogar die ältesten erhaltenen Zeugen sind. Der zweite Teil bringt dann eine Auswertung dieser Befunde. Zum einen soll sehr kursorisch versucht werden, diese beiden Zeugen in die Gesamtüberlieferung des Typs einzuordnen. Zum andern sind aus unseren Textfunden Schlüsse für die frühe Maiśebuch-Tradition zu ziehen. 1 Noy 1960 : 116. 2 Inzwischen ist dieser Typ als Teiltyp eingegangen in einen breiter deĳinierten Typ der Israel Folklore Archives ( ifA ), der dort ( als Ergänzung des Katalogs von Aarne / Thompson ) die Bezeichnung at * 730 a trägt ; vgl. Dov Noy, » Notes to the Tales «, im engl. Vorwort zu Avitsuk ( 1965 : 184 ). 282 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Zunächst zu dem deĳinitorischen Rahmen des Typs. Dass ein Einzelner sich für sein Volk opfern soll oder muss, ist ein gängiges Motiv der Weltliteratur und der internationalen Folklore. Aber es macht einen entscheidenden Unterschied, ob die Notwendigkeit dazu als schicksalhaft zwingend anerkannt werden kann oder ob sie erkennbar der menschlichen Bosheit einer Gegenpartei entspringt. Hier ist sehr klar Letzteres der Fall. Von einem Gesetz, das die jährliche Tötung eines durch das Los bestimmten Juden beföhle, weiß die Geschichte zwar nichts. Dennoch ist dieses Motiv leicht zu verstehen. Dazu genügt es, auf den nichtjüdischen Festtermin zu blicken, auf den sich fast alle Versionen und zweifellos schon die Urform des Typs beziehen : es ist der christliche Ostertermin, genauer in einigen Versionen der Karfreitag. Wie schon Ben-Amos kurz betont,3 handelt es sich um eine Gegengeschichte zu dem Schema der Ritualmordlegenden. Genauer kann man sagen : Gleich bei der ersten historisch bekannten Ritualmordbeschuldigung, nach dem Tode des zwölĳjährigen William von Norwich am Karsamstag 1144, hören wir bei Thomas von Monmouth die Behauptung, die Juden müssten, um ihre Freiheit wiederzuerlangen, jährlich unter Verhöhnung Jesu einen Christen opfern, wobei das Opfer auf Grund eines Losverfahrens ausgewählt werde : durch Los werde zunächst das Land, dann die dortige Judengemeinde bestimmt, die die Tat zu vollziehen hätte.4 Hier haben wir also schon alle wesentlichen Motive beisammen, und dass sie fortwirkten, hat vor allem Friedrich Lotter gezeigt : 5 Im Weiterwirken der Blutbeschuldigung der Juden von Blois im Jahre 1171 erinnerte sich 1182 König Philipp August von Frankreich, dass ihm in seiner Jugend das Gerücht zu Ohren gekommen war, die Juden zu Paris töteten alljährlich am Gründonnerstag einen Christen ; er ordnete darauf die Vertreibung aller Juden aus seinem Herrschaftsbereich an.6 Und 1187 mussten dann die Mainzer Juden anlässlich einer neuen Blutbeschuldigung schwören, dass » sie am Vortag von Pessach keinen Christen umbrächten «.7 Das Blutbeschuldigungsmuster breitete sich also schnell von Land zu Land aus auf dem Hintergrund der schon älteren, speziell im Ersten Kreuzzug virulent gewordenen Vorstellung, die Christen müssten auch heute noch Jesu Tod rächen.8 Man 3 Ben-Amos 2011 : 160. 4 Ausführlicher bei Yuval 2007 : 181. 5 Lotter 1993 : passim ; vgl. auch Yuval 2007 : 172 – 180. 6 Lotter 1993 : 51 f. ; Yuval 2007 : 180. 7 Yuval 2007 : 179. 8 Vgl. z. B. das Kapitel » Kreuzestod und Gottesmord « bei Rohrbacher / Schmidt 1991 : 218 – 268. Erika Timm : Abraham ibn Ezra und das Maiśebuch 283 kann nachvollziehen, dass dieses Beschuldigungsmuster geeignet war, Erzählungen unseres Typs zu provozieren.9 Schließlich lässt sich der Typ aus der Perspektive der internationalen Märchenforschung – wiederum mit Ben-Amos – auffassen als jüdische Sonderentwicklung des Märchentyps at 300 : 10 Wo der nichtjüdische Held den Drachen, der jährlich eine Jungfrau fordert, durch seine Körperkraft und sein Schwert tötet, da erzwingt der jüdische Held das Ende des Gesetzes, das jährlich ein jüdisches Menschenleben fordert, durch seine Klugheit, gesteigert durch göttliche Hilfe. Und damit kurz zur Frühgeschichte des jiddischen Maiśebuchs. Ihre Kenntnis hat in den vergangenen achtzig Jahren große Fortschritte gemacht. Während Steinschneider 1860 noch kein einziges Exemplar der Erstauflage Basel 1602 ( im Folgenden kurz : › mb ‹ ) angeben konnte, kannte Meitlis 1933 deren drei.11 Zudem konnte er die kleinen Maiśesammlungen genauer untersuchen, die aus dem letzten Drittel des 16. Jhs. erhalten sind, aber schon auf Grund ihres geringen Umfangs nur als Vorboten, nicht als Frühformen › des ‹ großen Maiśebuches gelten können. Dessen Geschichte begann immer noch 1602 mit ihm selbst, und man konnte weiterhin spekulieren, wie viel oder wie wenig davon sein Herausgeber Jakob b. Abraham Meseritsch erst durch eigene Sammel- und / oder Übersetzungsarbeit zusammengetragen haben mochte. Eine eindeutige Frühform des großen Werkes wurde dann 1957 bekannt und erst 1960 von S. A. Birnbaum richtig datiert, als Ilse Zimt Sand ein von ihr aus Privatbesitz erworbenes Exemplar vorstellte, geschrieben laut Kolophon 1596 von einem Samuel Bak aus › Rovere ‹ für seine Tante in Innsbruck ( im Folgenden kurz : › mi ‹ ) ; 12 es gehört seit 1970 der Jerusalemer Nationalbibliothek ( Signatur Heb. 8 º 5245 ). Im Herbst 1991 erwarb dann die Bayerische Staatsbibliothek ( als jetzigen Cod. hebr. 495 ) ebenfalls aus Privatbesitz ein undatiertes Schwestermanuskript von mi, geschrieben laut Kolophon von einem Moses in 9 Die im mutmaßlichen zeitlich-räumlichen Entstehungsbereich unserer Erzählung wirkungsmächtigste Blutbeschuldigungs-Legende betrifft den 1475 zu Tode gekommenen Simon von Trient, der in der katholischen Kirche bis 1965 als Märtyrer galt, vgl. Treue 1996 : passim. 10 Ben-Amos loc. cit. ; vgl. Aarne / Thompson 1961 : Nr. 300 ; s. auch den Abschnitt » Menschenopfer « bei Roehrich 1974 : 129 – 131 ; ders. 1981 : Art. » Drache «, speziell 5 . 2 » Drache und Menschenopfer «. 11 Steinschneider 1852 – 1860 : Nr. 3893 ; Meitlis 1933 : 21. – Heute lesen wir mb in der Faksimile-Ausgabe mit französischer Übersetzung und Kommentar von Astrid Starck ( 2004 ) ; auch Starck kennt keine weiteren Exemplare. 12 Birnbaum 1960 : 9 f ; Sand 1965 : 25. 284 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ › Rovere ‹ selbst ( im Folgenden : › mr ‹ ). Das einheitliche Wasserzeichen von mr steht Briquet 653, 662 und 663 ( Ferrara 1584, Udine 1587, Ferrara 1588 ) am nächsten. Die Handschriften der Schreiber von mi und mr ähneln sich so sehr, dass ich sie erst nach einiger Zeit als nicht-identisch erkennen konnte. Ich habe dann die 130 Maiśes von mr auf ihre Quellen untersucht und zugleich mit dem Bestand von mi und mb verglichen ; 13 dabei zeigte sich eine frappante Übereinstimmung von mr und mi auch im Bestand. Von den Maiśes in mr sind nur 3 weder in mi noch in mb zu ĳinden, 14 weitere nicht in mi, 7 weitere nicht in mb ; umgekehrt fehlen von den 120 Maiśes von mi nur 2 in mr und mb, 5 weitere in mr und 7 in mb. Jede Handschrift enthält also mindestens 85 % des Bestandes der anderen ( und beide zusammen knapp die Hälfte der bei genauer Zählung 258 Maiśes von mb, wobei die meisten › neuen ‹ Maiśes von mb in der zweiten Hälfte des Werkes, vor allem im letzten Viertel, stehen ). Von zweien der drei Einzelgänger in mr ließ sich die hebräische Quelle im Babylonischen Talmud leicht ĳinden. Umso rätselhafter blieb damals die dritte Maiśe, die zugleich die letzte in mr ist : ihr Inhalt stimmte nur – und auch das nur in grober Annäherung – zu der lakonischen Inhaltsangabe, die Moses Gaster in seinen Exempla of the Rabbis als Nr. 347 aufführt : » A story about the annual sacriĳice of a Jewish child by the Christians. Ben Ezra called up Mary and Jesus and everything changed «, mit Verweis nur auf einen unveröffentlichten Text in Ms. 66 von Gasters eigener Bibliothek.14 Den Text dieser letzten Maiśe von mr ( fol. 155 r – 156 v ) ediere ich hier in Transkription in der linken Spalte ( die Transliteration in Quadratschrift ist jeweils unten auf der Seite hinzugefügt ). In der rechten Spalte erscheint parallel dazu › dieselbe ‹ Maiśe in Johann Buxtorfs d. Ä. eigenhändiger lateinschriftlicher Niederschrift ( im Folgenden : mbux ) aus seinem Nachlass in der Basler Universitätsbibliothek.15 Ich verdanke schon das Wissen um die Existenz dieser Niederschrift, dann eine Fotokopie davon der exemplarischen Hilfsbereitschaft von Joanna Weinberg ( University of Oxford ), die gegenwärtig Buxtorfs Nachlass erforscht und die sich bezüglich dieser Maiśe mit einer Frage an meine Freundin und Kollegin Chava Turniansky gewandt hatte. Auch an dieser Stelle möchte ich Joanna Weinberg noch einmal meinen herzlichen Dank aussprechen. 13 Timm 1995 : 260, 273 – 276. – Auf diesen Aufsatz darf ich auch für alle anderen Fragen zu mr verweisen. 14 Gaster 1924 : 127 ; im Register p. 247 mit dem Zusatz » No Parallels «. 15 Zu dem Kollektaneen-Band (Signatur: a xii 20), in den die Maiśe (p. 242 – 248) eingegliedert ist, vgl. Willi 1994 : passim. Erika Timm : Abraham ibn Ezra und das Maiśebuch 285 Uf ain zeit ging der köśtlich mȯrênu / horav̄ Ov̄i ho ‘ Esri, sichrȯne liv̄ roche, un` wolt ken Rȯm / gên sein gėschefte̍n noch. un` as er kam nȯhe̍nt bei ’ / di ’ štat, do sach er zwên knabe̍n size̍n, di ware̍n / 5 ungėferlich zêhe̍n jor alt. un‵ si ’ ware̍n ga̍ nz schwa̍ rz / gėklaide̍t un‵ ha̍ te̍n ain kap uf, gleich wi ’ si ’ e̍v̄êlim / were̍n, un‵ trou ’e̍rte̍n un‵ wainte̍n ser un‵ hube̍n irė / auge̍n uf gêge̍n dêm hime̍l un‵ tribe̍n grȯś raḥmoness. / do vrogt si ’ der rav̄, wer si ’ were̍n un‵ warum / 10 si ’ asȯ trou ’e̍rig were̍n un‵ übe̍l zu mut were̍n. / » ḡȯt jissborech sȯl eich helfe̍n ous al öu̇ ere̍m laid. « un‵ / si ’ schrai ’e̍n i lenge̍r i mên un‵ sa̍ gte̍n : » libe̍r re̍bi, mir /sein jüde̍n-kinde̍r. un‵ eś is uf ain zeit ain bêse̍r / apiĳjȯr gėwese̍n zu Rȯm, der hȯt ein-gėschribe̍n in / 15 sein Rabbi Aben Haezri gieng ein mal spazieren / und wolt darnach gen Rom ziehen seiner geschefft / halben. und wie er nahend bei die stat Rom kam, / da fand er zwen Juden knaben sitzen, die waren /  ungeferlich zehen oder elff iar alt, die hatten ein / schwarz kappen umb den halß und waren ganz / schwarz angethon alß die abhelim oder leidtra / genden, und trawrten und weineten gar jemerlich / und huben ihr augen gegen den himel auff, neigten /  und bucketen sich gegen den himmel. Da fragte / sie der Rabh, weßhalben sie so gar trawrig / weren, und sagt : » Was ist euch doch geschehen, daß / ihr so jemerlich thut ? Gott sol euch helfen / von all ewrem unglück und grossem leid, von allen /  denen, die auff euch sehen. « Und sie schreyeten / ie lenger ie mehr. Da fragt sie der Rabbi gar / lang, biß sie anhuben und erzelleten ihm das / maaseh und geschicht und sagten : » Es ist auff / ein zeit gewesen alhie ein böser Apiphior oder /  Pabst, der hat lassen in sein buch schreiben, daß / wir Juden sollen alle iar auff den ‫ אונ ׳‬. ‫ ֵגין זײן גישעטן נאך‬/ ‫ ָה ַר ָא ִי ָה ֶעזְ ִרי ז ״ ל אונ ׳ וואלט קען רום‬/ ‫מוֹרינו‬ ֵ ‫אוף אײן צײט גינג דער קוישטליך‬ ‫ אונ ׳‬. ‫ ( אונגיערליך ֵציהן יאר אלט‬5 ) / ‫ די ווארן‬. ‫ דא זאך ער ְצווֵ ין קנאבן זיצן‬. ‫ דיא שטאט‬/ ‫אז ער קאם נוהנט בײא‬ ‫ ווערן אונ ׳ טרויארטן אונ ׳ ווײנטן‬/ ‫ילים‬ ִ ֵ ‫קאפ אוף גלײך וויא זיא ְא‬ ַ ‫ אונ ׳ הטן אײן‬. ‫ גיקלײדט‬/ ‫זיא ווארן גנץ שוורץ‬ . ‫ דא וראגט זיא דער ַר ווער זיא ווערן‬/ . ‫נוֹת‬ ֿ ‫ אווגן אוף ֵגיגן ֵדים הימל אונ ׳ טריבן גרוש ַר ְח ָמ‬/ ‫ אונ ׳ הובן אירי‬. ‫זער‬ ‫ית׳ זול אײך העלן אויז אל אוייערם‬ ֿ ‫ ֿגוֹט‬/ . ‫ ( זיא אזו טרויאריג ווערן אונ ׳ אויבל צו מוט ווערן‬10 ) / ‫אונ ׳ ווארום‬ . ‫ זײן יֻ ודן קינדר אונ ׳ עש איז אוף אײן צײט אײן‬/ ‫ אונ ׳ זגטן ליבר ְר ִבי מיר‬. ‫ זיא שרײאן ֵאי לענגר ִאי ֵמין‬/ ‫ אונ ׳‬. ‫לײד‬ ‫ ( זײן‬15 ) / ‫ דער הוט אײן גישריבן אין‬. ‫ייוֹר גיוועזן צו רוֹם‬ ְ ‫ ַא ִפ‬/ ‫ֵביזר‬ Bemerkungen zur Textgestaltung: mr ist transkribiert nach dem › Trierer ‹ Transkriptionssystem, das sich bemüht, den jeweiligen Lautstand des Originals, soweit er erschließbar ist, kenntlich zu machen. Unbetonte Endvokale in Wörtern hebräischer Herkunft sind abgeschwächt transkribiert, da der Schreiber bereits ‫ ־וּת‬und ‫ ־וֹת‬verwechselt bzw. im Reim ( 89 ff ) den Unterschied ignoriert. Die zusätzliche, gelegentlich ungewöhnliche Punktierung sowie die genaue Schreibung der hebr. Komponente ist der Transliteration in Quadratschrift zu entnehmen. – Zu mbux : Buxtorf schreibt in deutscher Kurrentschrift ( oben in der Transliteration recte wiedergegeben ), Wörter nicht-deutscher Herkunft aber in lateinischer Schrift ( kursiv wiedergegeben ). Groß- und Kleinschreibung ist oft ( bei K / k meist ) nicht zu unterscheiden, dasselbe gilt für die u- und ü-Haken ( Jud- könnte mehrfach auch als Jüdinterpretiert werden ). Langes ſ ist als rundes s wiedergegeben. – Moderne Zeichensetzung ist in mr hinzugefügt ( das Original hat gelegentliche, individuell gesetzte Punkte ), in mbux orientiert sie sich weitgehend an Buxtorfs Senkrechtstrichen ( unregelmäßiger Länge ) und gelegentlichen Punkten. Worterklärungen. Im Hinblick auf eine möglichst interdisziplinäre Leserschaft wird die Glossierung etwas großzügiger gehandhabt. – Im Folgenden : r = mr, ( b ) = mbux. r 1 köśtlich › hochangesehen, hochgebildet ‹ [ s. Timm 2005 : 351 – 353 ] ; mȯrênu horav̄ › unser Lehrer, der Rabbi ‹. r 2 Ov̄ i ho ’Esri ( b 1 Aben Haezri ) s. Kommentar, unten S. 288 f ; sichrȯne liv̄ roche › sein Gedenken zum Segen ‹. r 6 e̍v̄êlim ( b 7 abhelim ) › Trauernde ‹. r 8 raḥmoness treibe̍n › trauern ‹. r 11 jissborech ( b 13 jisborach durchgestrichen ) › er sei gepriesen ‹. ( b 18 maaseh › Geschichte ‹ ). r 12 re̍bi › Herr ‹ [ zur Graphie und Lautform s. Timm 1987 : 341 f ]. r 14 apiĳiȯr ( b 19 apiphior ) › der Papst ‹ [ s. Timm 1975 : 52– 55 ]. 286 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ gėsez-buch, ma̍ n sȯlt al jor un‵ jor uf dêm / selbe̍n tag, da̍ s ir tholui wer gėbȯre̍n, an der selbige̍n / ḥȯge zwên jungė jüdim, di zêhe̍n jor alt were̍n, / neme̍n un‵ sȯlt si seze̍n uf ain ka̍ ra̍ n un‵ sȯlt si ’ / füre̍n uf ain hȯche̍n berg, der is nȯhe̍nt bei ’ / 20 der štat. un‵ uf dêm selbe̍n berg wa̍ r der / apiĳjȯr un‵ vil here̍n un‵ vil volk un‵ auch sein / krigś-fȯlk. di selbige̍n ha̍ te̍n blȯs̀ė schwerte̍r in ire̍n / hende̍n un‵ schluge̍n uf di zwên junge̍n knabe̍n, bis da̍ s si ’ / si ’ zu štüke̍n zu-ha̍ kta̍ n. un‵ sölche̍ś lośt der apiĳjȯr / 25 alė jor tun, den er sagt, er wel asȯ ne̍kome tun an / dên jüde̍n v̄un wege̍n deś tholui. un‵ di jude̍n müse̍n in alė / jor zwên gebe̍n ; di werfe̍n gȯrel unte̍r dên junge̍n, welchė / zwên si gebe̍n söle̍n. un‵ dise̍ś jor is da̍ s gȯrel uf uns / zwai ’ e̍n gėfale̍n ba ‘ e̍vȯness horabim. da̍ rum schrei ’ e̍n mir un‵ / 30 sein asȯ trou’ e̍rig, den nima̍ nt kan uns helfe̍n fun dêm / jeme̍rliche̍n tȯt, sunde̍r hakodeš borech hu’ mit seine̍r gėnȯd un‵ barm-/ herzikait, der grȯśe̍n. « do der rav̄ irė klag, di grȯś / un‵ di ’ schwer, hȯrt, do de̍r-hize̍gte̍n sich sein de̍r-ba̍ rmikait tag, den die / Christen nennen Nittal ( natalis sc. christi, Christi / geburts tag ) zwen junge Juden knaben / nemmen, die da zehen oder elff iar alt seyn, und /  sollen sie auff einen wagen setzen, und sollen sie / vor die stat hinauß auff einen hohen berg führen / nahent bei der Statt. und auff dem berg waren / der Apiphior, der Bapst, und alle seine joatzim / oder rhäte und all seine knechte, und das Statt/  volck jung und alt. Daß volck all miteinander / hatten blosse messer und schwerter in ihren händen. / und dieweil denselben tag der Tolah, ihr Gott, / were auffgehenkt worden, so wollten sie mit / nekamah und raach thun. Giengen also hin /  und schlugen die zwen junge Jüden knaben, / biß sie zu kleinen stücken waren gehacket. / solches ließ der Pabst alle iahr thun auff dem / selben tag und vermeinete, er thete ein grosse / raach von wegen des Talui oder gehenck /  ten Christi und dem Talui oder gehencketen / Christo ein groß wolgefallen davon. Nun muß / ten die Juden solches alles geschehen lassen / mit grossem herzenleid und wurffen alle / iar goral oder das loß unter den Juden kna / ben. und nun, beavona harabba, umb unser / sünd willen, ist das loß auff uns gefallen / ( sagten die Jungen knaben ), daß wir müssen / also jung sterben, und uns kan niemand vor dem / grossen leid beschirmen, das uns jetzund zu handen /  kommen ist. denn allein bei Gott dem almechtigen / ist gnade und barmherzigkeit, uns davon zu / helffen. « Als nun der Rabbi dieß von den / knaben hörte und das groß leid, das ihnen war / zugefallen, ‫ ְצווֵ ין‬. ‫חוֹגה‬ ָ / ‫ זעלבן טאג דז איר ָתלוּי ווער גיבורן אן דער זעלביגן‬/ ‫ מן זולט אל יאר אונ ׳ יאר אוף ֵדים‬.‫גיזעץ בוך‬ ‫ן בערג‬4‫ וירן אוף אײן הו‬/ ‫ן אונ ׳ זולט זיא‬6ַ ‫ אוף אײן‬. ‫ נעמן אונ ׳ זולט זי זעצן‬/ ‫ודים די ֵציהן יאר אלט ווערן‬ ִ ֻ‫יונגי י‬ ‫ייוֹר אונ ׳ ויל הערן אונ ׳ ויל ואלק‬ ְ ‫ ַא ִפ‬/ ‫ אונ ׳ אוף ֵדים זעלבן בערג וור דער‬. ‫ ( דער שטאט‬20 ) / ‫דער איז נוהנט בײא‬ ‫ הענדן אונ ׳ שלוגן אוף די ְצווֵ ין יונגן קנאבן‬/ ‫ די זעלביגן הטן בלוסי שווערטר אין אירן‬. ‫ קריגש ולק‬/ ‫אונ ׳ אווך זײן‬ ‫ דען ער זאגט ער וועל‬. ‫ ( אלי יאר טון‬25 ) / ‫יפיוֹר‬ ְֿ ‫ אונ ׳ זוילכש לאשט דער ַא ִפ‬. ‫ צו שטויקן צו ַה ְק ַטן‬/ ‫ביז דז זיא זיא‬ ‫ל אונטר‬:‫ די ווערן גוֹ‬. ‫ יאר ְצווֵ ין געבן‬/ ‫ אונ ׳ די יודן מויזן אין אלי‬. ‫ ֵדין יֻ ודן ון וועגן דעש ָתלוי‬/ ‫אזו ְנ ָק ָמה טון אן‬ ‫ דרום‬. ‫בים‬6 ִ ‫ווֹנוֹת ָה‬ ֿ ‫ צווײאן גיאלן ַב ְע‬/ ‫ל אוף אונז‬:‫ איז דז גוֹ‬. ‫ אונ ׳ דיזש יָ אר‬. ‫ ְצווֵ ין זי געבן זוילן‬/ ‫י‬4‫ וועל‬. ‫ֵין יונגן‬ ‫ זונדר ה ׳ ק ׳ ב ׳ ה ׳‬. ‫ן טוט‬4‫ יעמרלי‬/ ‫ דען נימנט קאן אונז העלן ון ֵים‬. ‫ ( זײן אזו טרויאריג‬30 ) / ‫שרײאן מיר אונ ׳‬ ‫ דא‬. ‫ אונ ׳ דיא שווער הורט‬/ ‫ אירי קלאג די גרוש‬6 ‫ דא דער‬. ‫הערציקײט דער גרושן‬/‫מיט זײנר גינוד אונ ׳ בארם‬ ‫דר היצגטן זיך זײן דר ברמיקײט‬ ( b 22 Nittal [ nj. nitl ] › Weihnachten ‹ [ s. Weinreich 1973 ( iii ) : 203 f, Timm 1987 : 362 ], b 28 joatzim › Ratgeber ‹, b 33 mit = › damit ‹ ). r 16 tholui ( b 32 Tolah, 39f. Talui ) › der [ ans Kreuz ] Gehängte ‹. r 17 ḥoge › nichtjüdischer Feiertag ‹. r 18 ka̍ ra̍ n › Karren ‹. r 25 ne̍kome ( b 34 nekamah ) › Rache ‹. r 27 gȯrel ( b 44 goral ) › Los ‹. r 29 ba ’e̍vȯness horabim ( b 45 beavona harabba ; s. dazu unten Anm. 18 ) › der großen Sünden wegen ‹. r 31 hakodeš borech hu ’ Erika Timm : Abraham ibn Ezra und das Maiśebuch 287 / übe̍r si ’ , un‵ šprach zu in : » vrid zu öu̇ ch! nit ir / 35 sölt öu̇ ch ferchte̍n, den mit hülf deś bȯre jissborech wil / ich wol da̍ s gėbȯt me̍v̄atel sein. « un‵ er ging fun in un‵ ging / in di šta̍ t un‵ ging in den paliśt zum apiĳjȯr / un‵ sagt zu im un‵ sagt : » ich bin der gröśt her unte̍r / den jüde̍n, so biśtu der gröśt her unte̍r dên kriśte̍n, / 40 un‵ ma̍ n haiśt dich pa̍ tur. ich wil mit dir študire̍n. / warum tuśtu aine̍s un‵ ve̍r-gis̀t alė jor unschuldig / blut fun dên jüde̍n üm-sünśt ? ve̍r-wor, der jüde̍n / blut schrei’ e̍t rochung übe̍r dich fun der erde̍n, un‵ du / muśt rêd un‵ entwe̍rt uf ȷ̈ene̍r welt müse̍n da̍ rum / 45 gebe̍n. « do entwe̍rt im der apiĳjȯr un‵ šprach, / er tu’ eś da̍ rüm, da̍ s er sein ḡȯt an dên jüde̍n reche̍n / welt, den er vend eś asȯ gėschribe̍n in seine̍m gėsez- /buch. da erhitzet sich seine grosse barm /  herzigkeit uber sie / und sprach zu / ihnen : frid sey zu euch, nicht ihr solt euch / fürchten, denn mit der helff des Bore, des / schöpfers himmels und der erden, wil ich euch / davon helffen und wil die Gezerah mebhattel seyn, /  daß unglück abschaffen und verhinderen. / Da ging der Rabbi von ihnen in die Statt / Rom und ließ sich ansagen vor dem Apiphior, / es were einer da, der gern mit ihm reden wölt. / also ( daß ich bekitzur und kurz rede ) ward /  er vorgelassen. und wie er vor den Bapst / kam, sprach der Rabbi : » Hochgeborner Erwirdiger Herr, Ich bin der grössest herr unter / den Juden und ihr seit der grössest Herr unter / den Christen, und man heißt euch den Vatter. /  Ich will mich unterstehen, mit euch zu dispu / tieren. da sprach der Apiphior : » Ich bin des / wol zu frieden. aber welcher den anderen uber / wind, der sol ihm mit leib und leben verfallen / seyn. « Da sprach der Rabbi : » Ich bin des auch /  wol zu frieden. « Da hub der Rabbi an wider / den Apiphior oder Pabst und sagte : » Warumb ver/ giesset ihr alle jar so viel und groß unschuldig / blut der Jüden ? fürwar, es schreytt alle iar / raach uber dich das blut von den juden unter /  der erden, und du wirst müssen red und antwort / darumb geben auff iener welt. « da antwortet / der Pabst, Er thäte es alle iar, daß er die ju / den umbrächte seinem Gott zu lieb und zu ehren, / und er wißte es auch gewiß, daß er seinem /  Abgott ( dieß ist Judische art zu reden von / Christo ) ein wolgefallen an der raach thäte, / denn es were eben derselb weg, daß die Juden / seinen Abgott auch gehenkt heten. auch fände / ‫ית׳‬ ֿ ‫ דען מיט הוילף דעש בוֵֹא‬. ‫טן‬4‫ ( זוילט אוײך ער‬35 ) / ‫ ניט איר‬. ‫ אונ ׳ שפראך צו אין וריד צו אוײך‬. ‫ אויבר זיא‬/ ‫אלישט צום‬ ִ ‫ אונ ׳ גינג אין דען ַפ‬. ‫ אין די שטט‬/ ‫ אונ ׳ ער גינג ון אין אונ ׳ גינג‬. ‫ איך וואל דז גיבוט ְמ ַ ֵטל זײן‬/ ‫וויל‬ ‫ זא בישטו דער גרוישט הער‬. ‫ דען יֻ ודן‬/ ‫ אונ ׳ זאגט צו אים אונ ׳ זאגט איך בין דער גרוישט הער אונטר‬/ ‫ייוֹר‬ ְ ‫ַא ִפ‬ ‫ אונ ׳ ור‬. ‫ ווארום טושטו אײנז‬/ . ‫ איך וויל מיט דיר שטודירן‬. ‫ ( אונ ׳ מן הײשט דיך ַפטור‬40 ) / ‫אונטר ֵין קרישטן‬ ‫ונג אויבר דיך‬4‫ בלוט שרײאט רא‬/ ‫ ור וואר דער יֻ ודן‬. ‫ ון ֵין יֻ ודן אוים זוינשט‬. ‫ בלוט‬/ ‫גיסט אלי יאר אונשולדיג‬ ‫ דא ענטוורט אים דער‬. ‫ ( געבן‬45 ) / ‫ מושט ֵריד אונ ׳ ענטוורט אוף ײענר וועלט מויזן דרום‬/ ‫ אונ ׳ דו‬. ‫ון דער ערדן‬ ‫ דען ער וענד עש אזו גישריבן‬. ‫ וועלט‬/ ‫ן‬4‫ ער טוא עש דרוים דז ער זײן ֿגוֹט אן ֵין יֻ ודן רע‬/ ‫ייוֹר אונ ׳ שפראך‬ ְ ‫ַא ִפ‬ . ‫ בוך‬/ ‫אין זײנם גיזעץ‬ › der Heilige, gesegnet sei er ‹. r 35 bȯre ( b 57 Bore ) › Schöpfer ‹. r 36 me̍v̄atel ( b 59 mebhattel ) sein › zunichte machen ‹. ( b 64 bekitzur › in Kürze ‹ ). r 40 patur, wohl als lat. pater gemeint. r 43 rochung › Rache ‹. ( b 84 / 85 seinem Abgott und 88 Abgott von Buxtorf unterstrichen, 288 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ do sagt der rav̄ wide̍r zu im : » ve̍r-wor, öuer / ḡot hot kain bėgerniś an dem unschuldige̍n blut- / 50 ve̍r-gis̀ung. un‵ ir tüt ser wide̍r in mit dêm / dȯsige̍n. « do sagt der apiĳjȯr : » wer sagt mirs, / da̍ s eś wor is ? « do sagt der rav̄ : » wilśtu mirs / nit glȧube̍n, so tu ’ aine̍ś un‵ lȯś mit mir gên / zwelf deine̍r öbe̍ršte̍n ka̍ rdinale̍n an der selbige̍n / 55 na̍ cht, so du eś as mȯrge̍ns da̍ s selbig bês werk / tun wilśt. so wil ich un‵ si ’ gên in dein / kirch, un‵ wil si ’ lose̍n selbśt höre̍n fun deine̍m / ḡot, da̍ s er zu sölche̍m bês kain lib un‵ bėgerung / hot. « der apiĳjȯr entwe̍rt im wide̍r un‵ sa̍ gt : / 60 » so da̍ s meinė ka̍ rdinal höre̍n, so wil ich gėwiślich / da̍ s gėbȯt ab-tun un‵ ve̍r-štöre̍n. « do nun di selbig / na̍ cht kam, do gab im der apiĳjȯr zwelf / ka̍ rdinal un‵ si ginge̍n mitana̍ nde̍r in di thifle. un‵ / der rav̄ ma̍ cht mit hašbo ‘ ess un‵ hailige̍n šêmess / 65 un‵ vrogt dên tholui, ȯb er ain lib un‵ bėgerung / an er es in seinem Sepher zichronos, in seiner / Chronik, daß seine Vorfaren auch also mitt /  diesem tag gethon hetten. derhalben thäte ers / auch und wolle den brauch nicht lassen abgehen. / da sprach der Rabbi : » fürwar, ewer / Gott hat keinen wolgefallen daran, und er /  hat kein begerung an dem unschuldigen blut, / das ihr alle iar so jemerlich vergießt. « da / sprach der Pabst : » wer will mirs sagen, ob du war / hast oder nicht ? « da sagt der Rabbi : » Ich will dirs / weisen, daß du groß leid deinem Gott zu wegen /  mit brengest mit dem unschuldigen blutvergiessen. « / Da sprach der Pabst : » Wenn du mir solches weisest, / wil ich davon absehen und sol so[ l ]ches nicht mehr / geschehen. « Da sprach der Rabbi : » das wil / ich dir wol weisen. thu eines und gib mir dei / ner Cardinäl zwelff, denen du gar wol ver / trawest, an derselbigen nacht, da du das böse / maaseh und Missethat thun wilt. da wil ich mit / ihnen gehen in ewer Bethauß oder kirch / und wil sie selbst von deinem Gott lassen hören, /  daß er solches nicht von dir begeret und daß du / ihm kein wolgefallen daran thust.« da sprach / der Pabst : » Wenn solches meine Cardinäl von / meinem Gott werden hören, so wil ich das / Mandat und gebott gleich zerstören und abschaffen. « /  Wie es nun an die nacht kam, da gab der / Pabst seine besten Cardinäl, denen er gar wol / vertrawete, dem Rabbi, und sie giengen miteinander in das / Bethauß. da machte der Rabbi mit viel / Beschwerungen und heiligen schemos oder ‫ ( ור‬50 ) / ‫ ֿגאט האט קײן ביגערניש אן דעם אונשולדיגן בלוט‬/ ‫ ור וואר אויער‬. ‫דא זאגט דער ַר ווידר צו אים‬ ‫ דז עש וואר איז דא‬/ ‫ייוֹר ווער זאגט מירז‬ ְ ‫ דא זאגט דער ַא ִפ‬. ‫ דוזיגן‬/ ‫ אונ ׳ איר טויט זער ווידר אין מיט ֵים‬. ‫גיסונג‬ ‫ינאלן‬ ַ ‫ צוועלף דײנר אויברשטן ַק ְר ִד‬/ ‫ ניט גלויבן זא טוא אײנש אונ ׳ לוש מיט מיר ֵגין‬/ ‫זאגט דער ַר ווילשטו מירז‬ ‫ זא וויל איך אונ ׳ זיא ֵגין אין‬. ‫ טון ווילשט‬/ ‫ט זא דו עש אז מורגנז דז זעלביג ֵביז ווערק‬4‫ ( נ‬55 ) / ‫אן דער זעלביגן‬ . ‫ האט‬/ ‫ ֿגאט דז ער צו זוילכם ֵביז קײן ִליב אונ ׳ ביגערונג‬/ ‫ אונ ׳ וויל זיא לאזן זעלבשט הוירן ון דײנם‬. ‫ קירך‬/ ‫דײן‬ ‫ דז גיבוט אב‬/ ‫ינאל הוירן זא וויל איך גיווישליך‬ ַ ‫ ( זא דז מײני ַק ְר ִד‬60 ) / ‫דער אפייור ענטוורט אים ווידר אונ ׳ זגט‬ ‫ינאל אונ ׳ זי גינגן מיט‬ ַ ‫ ַק ְר ִד‬/ ‫ דא גאב אים דער אפייור צוועלף‬. ‫ט קאם‬4‫ נ‬/ ‫ דא נון די זעלביג‬. ‫טון אונ ׳ ור שטוירן‬ ‫ ( אונ ׳ וראגט ֵדין ָתלוי אוב ער אײן‬65 ) / ‫עות אונ ׳ הײליגן ֵשמוֹת‬ ֿ ָ ‫ט מיט ַה ְש‬4‫ דער ַר מ‬/ ‫אננדר אין די ִת ְ ָלה אונ ׳‬ ‫ אן‬/ ‫ליב אונ ׳ ביגערונג‬ b 89 Sepher zichronos › Chronik ‹ ). r 61 ab-tun › aufheben ‹ [ vgl. nj. opton ] ; ve̍r-štöre̍n › zunichte machen ‹ [ vgl. nj. farštern ]. r 63 thifle › Kirche ‹ ( Weinreich 1973 ( i ) : 202 –204, ( iii ) 203 – 206. ). r 64 hašbo‘ess › Beschwörungen ‹ ; šêmess ( b 119 schemes ) › Gottesnamen ‹. Erika Timm : Abraham ibn Ezra und das Maiśebuch 289 dêm un-schuldige̍n blut-ve̍r-gis̀ung het der jüde̍n / un‵ ȯb sein sin asȯ de̍r-mit zu-vride̍n wer. do / entwe̍rt er un‵ sa̍ gt : » ovê, ovê, ve̍rmeide̍t fun zu gên / in dise̍m weg u n’ seit gėwarnt an öu̇ ere̍m / 70 leib, da̍ s ir sölche̍ś nit mên tüt. den alė jor, do ir sölche̍ś gėtȯn ha̍ t, in der selbige̍n zeit hȯt ma̍ n / mich gėricht in der hele̍n mit vil-e̍rlai ’ plog, d i’ / ich öu̇ ch nit al de̍r-zêle̍n kan. darum, so ir an mich / glȧube̍n welt, so tüt dên jüde̍n kain laid an nȯch kain / 75 schmȯchhait zu-mol nit. do tut ir mir ain wol-/ gėfale̍n un‵ lib an. « un‵ as di ka̍ rdinal disė rêd v̄um / tholui hȯrte̍n, do ginge̍n si’ zum apiĳjȯr un‵ / sa̍ gte̍n im, was si ’ gėhört hate̍n. un‵ / v̄un štunde̍n an war er da̍ s bös gėbȯt / 80 me̍v̄atel. un‵ zu aine̍m gėdechtniś / liś er al jor uf dên selbe̍n / tag zwên ȯchśe̍n neme̍n un‵ / liś di’ selbige̍n zu klaine̍n / štüke̍n hake̍n an der / 85 judim šta̍ t. hakodeš borech hu’ / sȯl fun unś / ve̍r-štȯre̍n / alė bêsė / ge̍sêress / 90 un‵ sȯl uns ba̍ ld / de̍rlêse̍n le̍ḥêress, da̍ s sȯl ba̍ ld / gėschehe̍n, de̍rmit da̍ s eś unse̍rė ȧuge̍n auch söle̍n sehe̍n. omen. ve̍chen je̍hi rozen omen. /  Namen, daß der Talui oder Gehenkt / Christus selbst mit ihm müßt reden. Und der / Rabbi fragte den Talui, ob er ein wolgefallen / daran hette, daß der Bapst alle iar so viel / rein juden blut vergiessen thäte. da ant / wortet der Talui Christus : » O wee! o wee! /vermeid solche sachen zu thun, vermeid von / zu gehen den dassigen weg und seit gewar / net, daß ihr solches nicht mehr thut. denn / alle iar, dieweil ihr solches gethon haben, /  da hat man mich auff denselbigen tag gericht / im Gehinnam, in der helle, mit viel Iissurim, / mit viel grossen straffen, die ich euch nicht / erzellen kan. derhalben so ihr an mich / wölt glauben und mir ein wolgefallen thun, /  so thut den Juden kein leid mehr / an. da thut ihr mir ein wolgefallen dran. « / Und wie die Cardinäl solche reden von dem / Talui, von Christo, höreten, da sagten sie / solches dem Bapst wider an, was sie gehört /  hatten. und alß bald ließ der Bapst das / Mandat von den zwen Jungen Juden kna / ben abschaffen. aber doch ließ er auff / denselben tag zur gedechtnuß zwen / ochsen führen und zuhacket sie zu kleinen stücken, / wie man den Juden hat gethon. und solches haben /  leute gesehen, daß es noch heutiges tages geschicht / mit den ochsen. Also wurden die / zwen junge knaben durch den Rabh poter / und frey gelassen. Gott sol uns sein zechus / und verdienst zu allen zeiten auch geniessen /  lassen und böse gezeros und Mandat / mebhattel, zerstöret laßen seyn. Amen. ‫ ענטוורט ער אונ ׳‬/ ‫ דא‬. ‫ אונ ׳ אוב זײן זין אזו דר מיט צו ורידן ווער‬/ ‫ֵים און שולדיגן בלוט ור גיסונג העט דער יֻ ודן‬ ‫ דז איר זוילכש ניט ֵמין‬. ‫ ( לײב‬70 ) / ‫ אונ ׳ זײט גיווארנט אן אוײערם‬. ‫ אין דיזם וועג‬/ ‫זגט ָאוֵ י ָאוֵ י ור מײדט ון צו ֵגין‬ ‫ט אין דער העלן מיט ויל‬4‫ מיך גירי‬/ ‫ אין דער זעלביגן צײט הוט מן‬. ‫ דא איר זוילכש גיטון הט‬/ ‫ דען אלי יאר‬. ‫טויט‬ ‫ גלויבן וועלט זא טויט ֵין יֻ ודן קײן לײד‬/ ‫ איך אוײך ניט אל דר ֵצילן קאן דארום זא איר אן מיך‬/ ‫ארלײא ְפ ָלאג דיא‬ ‫ינאל דיזי‬ ַ ‫ אונ ׳ אז די ַק ְר ִד‬. ‫ גיאלן אונ ׳ ליב אן‬/ ‫ דא טוט איר מיר אײן וואל‬. ‫הײט צו מאל ניט‬4‫ ( שמו‬75 ) / ‫אן נוך קײן‬ ‫ ון שטונדן אן וואר‬/ ‫ אונ ׳‬. ‫ זגטן אים וואז זיא גיהוירט האטן‬/ ‫יפיוֹר אונ ׳‬ ְֿ ‫ ָתלוי הורטן דא גינגן זיא צום ַא ִפ‬/ ‫ֵריד ום‬ ‫ טאג צווֵ ין אוכשן נעמן‬/ ‫ליש ער אל יָ אר אוף ֵדין זעלבן‬/ ‫ אונ ׳ צו אײנם גידעכטניש‬. ‫ ( ְמ ַ ֵטל‬80 ) / ‫ער דז בויז גיבוט‬ / ‫ ור שטורן‬/ ‫ זול ון אונש‬/ ‫ ה ׳ ק ׳ ב ׳ ה ׳‬. ‫יודים ְש ַטט‬ ִ ( 85 ) / ‫ שטויקן ַהאקן אן דער‬/ ‫ ליש דיא זעלביגן צו קלײנן‬/ ‫אונ ׳‬ ‫ אויגן‬/ ‫ דר מיט דז עש אונזרי‬. ‫ גישעהן‬/ ‫ דז זול בלד‬/ . ‫ירוּת‬ ֿ ‫ דר ֵליזן ְל ֵח‬/ ‫ ( אונ ׳ זול אונז בלד‬90 ) / ‫ירוֹת‬ ֿ ֵ‫ ְגז‬/ ‫אלי ֵביזי‬ ‫ ו ׳ כ ׳ י ׳ ר ׳ א‬. ‫ ָא ֵמן‬. ‫אווך זוילן זעהן‬ ( b 131 Gehinnam › Gehenna, Hölle ‹ ; Iissurim › Qualen ‹ ). r 75 schmȯchhait › Schmach ‹. ( b 147 poter › frei ‹, b 148 zechus › Verdienst ‹ ). r 89 ge̍sêress ( b 150 Gezeros, vgl. 59 Gezerah ) › Gesetz[ e ], speziell gegen die Juden ‹. r 91 le̍ḥêress › in Freiheit ‹. r 93 ve̍chen je̍hi rozen › und so geschehe Gottes Wille ‹. 290 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Die große Nähe beider Versionen zueinander braucht nicht erst betont zu werden. Obwohl mbux um mehr als ein Drittel länger ist als mr, stimmen beide in der Struktur und in den wesentlichen Elementen der Handlung – meist wörtlich – überein. Die Ampliĳikationen von mr gegenüber einer noch gemeinsamen Vorstufe halten sich in dem Rahmen, den wir auch sonst im Verhältnis der Überlieferung mb / mr / mi kennen. Was mbux in der überlieferten Fassung an Erweiterungen aufweist, geht wohl zum größeren Teil schon auf das Konto des von Buxtorf transkribierten Manuskripts ( im Folgenden * mbux ),16 zum anderen Teil darf man sie Buxtorf selbst zuschreiben. Letzteres betrifft nahezu sicher die Synonymenzusätze, mit denen er jüdische Ausdrücke erklärt : » der Apiphior oder Pabst « steht sichtlich für bloßes » der Apiphior «, ähnlich » bekitzur und kurz «, » abhelim oder leidtragende «, » zechus und verdienst « und vieles andere mehr ; 17 ja bei » des Bore, des schöpfers himmels und der erden « ist ihm bis in die grammatischen Endungen hinein eine Luther-Formel in die Feder gekommen. Doch scheint er sonst die Erzählung nicht verändert zu haben. Das Auffälligste und sehr Sympathische an dieser Erzählung ist – anders als in manchen der übrigen Versionen –, dass für die jüdischen Menschenleben der vergangenen Jahre keinerlei Vergeltung verlangt wird, sondern nur allem weiteren Unheil sofortiger Einhalt geboten werden muss durch Rettung des bzw. der beiden jetzt Bedrohten und durch Abschaffung des mörderischen Gesetzes. Damit aber diese Abschaffung nachhaltig ausfällt, so sieht es der Erzähler, muss der Retter sie im doppelten Sinne › zentral ‹ durchsetzen : er muss die ideologische Wurzel des Gesetzes zerstören, den Wahn nämlich, Jesus ĳinde Gefallen am Rachetod von Juden, und er muss sich die Abschaffung des Gesetzes von zentraler Stelle, nämlich vom Papst selbst, bestätigen lassen. Beides schafft der Erzähler insgesamt recht geschickt. Doch sehen wir uns die Einzelheiten an. Dass es hier um zwei Judenknaben geht, in allen anderen Versionen nur um einen Juden ( wechselnden Alters ), ist als Neuerung leicht verständlich : es verstärkt unser Mitgefühl. Die beiden Knaben sprechen 16 So hat z. B. wohl schon * mbux – und nicht erst Buxtorf – verkannt, dass der Erzähler in der Diskussion des Juden mit dem Nichtjuden ( mr 37 – 62 mit dem Papst ; vgl. auch 68 – 76 die Worte Jesu ) alle hebräischen Elemente vermeidet ( zu Parallelen vgl. Timm 1975 : 83, Neuberg 2008 : 45 f ) ; in mbux ist das Prinzip einige Male ( vgl. Z. 89, 107, 131 ) gestört. 17 Dasselbe Prinzip ĳinden wir durchgehend in Buxtorfs Synagoga Judaica ( 1603 ), selbst bei Mehrfachvorkommen, z. B. » Vikkuach und Disputation « 23, » Chachamim und ( hoch ) weise Rabbiner / n « 27, 93, 174, 175, 176, » die Chachamim und Weisen « 78, 87, 170 u.ö., » Galus und Gefengnuß « 41, » Sechel und Verstand « 87, » Mitzvos oder / und Gebott « 43, 44, 181, » zaddik oder Gerechter « 48, » Gojim und andere Völcker « 65, 67, » Umos und Völcker « 65, » Panim oder/ und Angesicht « 175, 185 usw. Erika Timm : Abraham ibn Ezra und das Maiśebuch 291 zwar schon, wie jeder fromme Jude in einer Notsituation, die traditionelle Formel ba ‘ avonot( enu ) ha-rabbim ( mbux : beavona harabba 18 ) › um unserer großen Sünden willen ‹. Aber sie sind erst › ungefähr zehn ( mbux fügt hinzu : oder elf ) ‹, also noch nicht dreizehn Jahre alt und damit noch nicht religionsmündig ; somit kann bei ihnen schon aus Altersgründen nicht von irgendeiner persönlichen Schuld gesprochen werden, und das Gesetz zeigt gerade hierin seine absurde Grausamkeit. Doch scheint die Einführung der beiden Knaben zugleich zum Verzicht auf zwei weitere Motive geführt zu haben, die in den meisten anderen Fassungen des Typs auftreten und somit zu seinem festen Bestand zu gehören scheinen. Dort pflegt nämlich der Retter an die Stelle des Opfers zu treten, und es ist Sitte, dem Opfer einen letzten Wunsch zu erfüllen ; eben dadurch, dass man ihm seinen Wunsch erfüllt, kann der Retter dann unerwartet in Aktion treten. Sehr auffällig ist in unserer Fassung ferner, dass zunächst ( mr 15 f, mbux 21 f ) – abermals im Gegensatz zu allen anderen Versionen – der Geburts- statt des Todestages Jesu als Tag der Hinrichtung der Losopfer genannt wird. Er kann schon deshalb nicht ursprünglich sein, weil die Christen ja nicht Jesu Geburt, sondern seinen Tod › rächen ‹ wollen. In der Tat bezeichnen dann die beiden Knaben in mbux kurz darauf ( 32 f ) den Tag ihrer drohenden Tötung vielmehr als den Tag der Kreuzigung Jesu. Diese zweite Aussage steht im krassen Widerspruch zur ersten, und so kurz danach kann man sie nicht plausibel als Neuerung eines Kopisten erklären, wohl aber als gedankenloses oder sklavisches Abschreiben ; man muss sie also der ( wohl noch gemeinsamen ) Vorstufe zuweisen. mr hingegen hat an der zweiten Stelle den Widerspruch bemerkt und dort den Termin unterdrückt. Der Vorstufe ist somit an der ersten Stelle ein bloßer Lapsus unterlaufen – › geboren ‹ statt › gestorben ‹, den wir ad acta legen dürfen.19 Das Menschenopfer ĳindet jeweils auf einem hohen Berge statt. Hier können verschiedene Assoziationen zusammengeflossen sein. 18 Buxtorfs Form ist ungrammatisch ; möglicherweise hat er eine Abkürzung sachlich richtig, aber grammatisch unrichtig aufgelöst. 19 Falls doch eine bewusste, wenn auch unpassende, Änderung vorliegen sollte, so dürfte dem jüdischen Erzähler bekannt gewesen sein, dass Weihnachten immerhin – aus theologischer Perspektive – das zweitwichtigste Fest im Jahreslauf ist ; es hat als einziges christliches Fest im ganzen Aschkenasentum einen eigenen und einheitlichen Namen, eben nitl. Im Vorgriff wäre dann darauf hinzuweisen, dass in einigen anderen Versionen unserer Erzählung ein zweiter Festtermin ( einmal das jüdische Purimfest, ein anderes Mal das christliche Osterfest des Vorjahres ) ins Spiel kommt ; schon dort wird das Los geworfen und das Opfer gefangen gesetzt, erst zum folgenden Ostertermin dann getötet. Es ist nicht ganz auszuschließen, dass dem Weihnachtsfest in unserer Geschichte zunächst eine ähnliche Funktion zugedacht war, die aber spätestens in der letzten gemeinsamen Vorstufe von mr und mbux missverstanden wurde. 292 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Nicht nur standen die Galgen der mittelalterlichen Städte meistens auf einem Berg vor der Stadt, auch Märchen wie khm 60 20 ( › Zwei Brüder ‹ ) verlegen das Menschenopfer auf einen Berg. Für unsere Erzählsituation speziĳischer ist zum einen, dass die ‘aqēdat Yiẓḥāq ( Genesis 22 ) auf dem Berg Morija stattfand. Zum andern stellten sich aber auch die Christen Golgotha als Hügel oder gar Berg vor, eine Vorstellung, die in den Städten selbst den Nichtchristen in Form der Kalvarienberge vor Augen trat ; die Idee kann also sein, dass der Ort der › Rache ‹ dem Ort der Kreuzigung gleichen sollte. Der Erzähler weiß, dass Papst ( ~ papa ) › Vater ‹ bedeutet oder dass der Papst von den Christen als › ( Heiliger ) Vater ‹ angeredet wird ( mr 40, mbux 69 ). Bemerkenswerterweise ist dieser Papst weder als böse aus eigenem Antrieb noch als unbelehrbar dargestellt. Im Gegenteil, der hohe Herr ist sogleich zu einer Disputation bereit. Denn ihm schwebt dabei wohl – im Denken des Erzählers – eine jener großen christlichjüdischen Disputationen vor, die besonders in Spanien beliebt waren, weil der › Sieg ‹ der christlichen Seite, wie vordergründig auch immer, von Anfang an feststand.21 Dass der Papst dabei in mbux ( 72 – 74 ) sogar sein und seines Opponenten › Leib und Leben ‹ zum Pfand setzt, bleibt hier allerdings blindes Motiv und dürfte ein müßiger Zusatz der von Buxtorf transkribierten Handschrift sein, einer jener Zusätze, mit denen Kopisten glauben, die Erzählung noch dramatischer gestalten zu können. Bei den Kardinälen kann die Zwölfzahl, wie sonst im Märchen, einfach Vollständigkeits- bzw. Bekräftigungszahl sein. Doch ist unserem Erzähler auch zuzutrauen, dass er ihre Gruppe, als engste Vertrauensleute des Papstes, der Zahl der Jünger Jesu nachgebildet hat. Denn eine ähnliche Kenntnis des christlichen Glaubens zeigt er nun im Hauptteil der Erzählung. Der Rabbi und die Kardinäle begeben sich in die Kirche, und der Rabbi bringt durch Beschwörungen mit dem heiligen Gottesnamen die Jesusĳigur zum Reden.22 Diese gesteht, dass sie keineswegs Wohlgefallen bei der Hinrichtung der Juden empĳindet, sondern eben dafür jedes Jahr gleichzeitig Höllenqualen auszustehen hat. Hier hat der Erzähler – zum einen – dem christlichen Motiv von 20 Vgl. Röhrich 1974 : 129. – khm = Grimms Kinder- und Hausmärchen, zitiert nach Röllecke 1999. 21 Doch ist dieses Motiv – erfolgreiche Disputation mit einem Papst – auch in der aschkenasischen Überlieferung zumindest noch einmal, und zwar etwa gleichzeitig, verwendet worden in der Erzählung von Beria und Simra, vgl. Timm 1975 : 20 – 27 und 52 – 55. 22 Das internationale Märchen kennt ähnliche Motive ( Thompson 1955 – 1958 : D 435 . 2 . 1 : » Picture comes to life « ), aber da der jüdische Glaube das Bildnisverbot des Dekalogs ( 20 :4 ) sehr ernst nimmt, so dass zumindest jede plastische Figur ein pesel, ein Götzenbild, ist, wird daraus in den jüdischen Volkserzählungen ein ( Heraus- ) Beschwören der im jeweiligen Bild sitzenden ( › Götzen ‹- ) Gestalt mit Hilfe des heiligen Gottesnamens. Erika Timm : Abraham ibn Ezra und das Maiśebuch 293 der › Höllenfahrt Christi ‹, die sich ja unmittelbar an das KarfreitagsGeschehen der Kreuzigung anschloss, eine unerwartete Wendung gegeben. Die Höllenfahrt wurde seit dem frühen Mittelalter in der christlichen Kunst und seit dem Spätmittelalter sogar in den öffentlichen Mysterienspielen dargestellt ; 23 spätestens dadurch musste sie auch den Juden bekannt werden.24 Wenn nun Christus › die Sünden der Welt ‹ auf sich nimmt, wie die Christen verkündeten, so hat er hier eben auch die Sünde der Judenmorde auf sich zu nehmen. So weit hat der Erzähler also – im Hinblick auf eine mögliche christliche Zensur – wohl nichts Anstößiges gesagt. Zum anderen kommt aber im Hintergrund unverkennbar eine im Talmudtraktat Gittin ( fol. 57 a ) verankerte Erzählung zum Zuge : Der konversionswillige Onkelos lässt durch Nekromantie Jesus erscheinen und fragt ihn, wer in jener Welt am geachtetsten sei. Jesus antwortet : › Israel ‹. Auf die nächste Frage, ob man sich ihnen anschließen solle, antwortet er diplomatisch : › suche ihr Bestes und nicht ihr Böses ‹, und auf eine weitere Frage, womit er gerichtet werde, antwortet er : › mit glühendem Kot ‹. Ein Meister erklärt : das sei die Strafe für einen, der über die Worte der Weisen spottet.25 In der spätmittelalterlichen oder frühneuzeitlichen Welt unseres Erzählers, wo jeder Christ auf Grund des Nulla salus extra ecclesiam jedem Juden erklären konnte, dass er außer im Fall der Konversion zu den Qualen der Hölle verdammt sei, musste der Rekurs auf die Talmudstelle zudem als ein willkommenes › Umdrehen des Spießes ‹ keineswegs maßlos erscheinen. Ein guter Erzähler rundet manchmal seine Darbietung noch durch eine nette Schlusspointe ab, so auch der unsere. Wie allgemein in der Menschheitsgeschichte für die Menschenopfer allmählich Tieropfer eintraten und wie speziell bei der ‘aqēdāh Abraham statt des Isaak einen Widder opfern durfte, so › seitdem ‹ der Papst statt der beiden Judenknaben zwei Ochsen. In mbux wird dieser Schluss noch durch eine Gewährsangabe besiegelt, die vielleicht vom Erzähler stammt : › Leute ‹ können bezeugen, dass die Ochsen noch heutigen Tags geschlachtet werden. ( Also muss die Geschichte ja wahr sein… ) In allen Versionen unseres Typs kommt der Retter aus der Ferne, ist nie ein einheimischer Jude ; das verstärkt den Eindruck des Schicksal23 Vgl. etwa das Lexikon der christlichen Ikonographie, Art. » Höllenfahrt Christi «. 24 Zudem hatten die Christen gerade bei Disputationen mit Juden allen Grund, auf sie einzugehen ; denn ihr theologischer Sinn ist ja, dass Christus die Gerechten des Alten Bundes aus der Unterwelt mit sich in die Seligkeit hinaufführt. 25 Ich zitiere nur den Teil des Textes, der unseren Erzähler beeinflusst haben dürfte. – Zu der seit Jahrhunderten strittigen theologischen Interpretation dieser Talmudstelle vgl. z. B. Schäfer 2010 : Kap. 8, » Die Höllenstrafe Jesu «. Auch Buxtorf kennt und kommentiert diese Stelle, s. dazu weiter unten. 294 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ haften. Problematisch bleibt freilich in den beiden oben betrachteten Versionen die Identität des Retters. In mr heißt er Avi ha-‘ Ezri.26 Dies war zunächst der Titel der großen Dezisionen-Sammlung des Eliezer ben Joel von Bonn ( gest. um 1235 ), die für ihre Zeit neue Maßstäbe setzte und im aschkenasischen Bereich erst seit dem späten 16. Jh. allmählich durch den Šulḥān ‘Arūkh verdrängt wurde ; doch wurde der Buchtitel früh – unverändert oder als Avi ha-‘ Ezer 27 – zum ehrenden Übernamen des Autors. Dem aschkenasischen Leser um 1600 musste die Erzählung mit diesem Namen also konsistent erscheinen. Heute allerdings muss man sich über den Namen etwas wundern – weniger, weil Avi ha-Ezri auf seinen Wanderungen höchstens bis in die Lombardei,28 nicht bis nach Rom gekommen zu sein scheint, als vielmehr, weil er sonst nicht als Trägergestalt aschkenasischer Volkserzählungen bekannt ist. Denn für eine solche Rolle braucht man doch einen Mann mit bekanntem Charisma. mbux liest stattdessen Aben Haezri. Da Jod und ĳinales Nun nicht zu verwechseln sind, kann man nicht einen bloßen Lesefehler Buxtorfs oder seiner Vorlage für Avi ha-‘ Ezri annehmen. Zwar mögen jüdische Leser der damaligen Zeit die Buchstabenfolge ‫ אבן‬nicht mit Buxtorf als Aben, sondern als even gelesen haben ; denn Even ha-‘ ezer ( wenn auch nicht -‘ ezri ) ist immerhin der Name der Dezisionen-Sammlung des Raban ( R. Eliezer ben Natan von Mainz, gest. um 1170 ) und des dritten Teils zweier weiterer Dezisionen-Sammlungen, nämlich der Arba ‘ ah Ṭurim und des darauf aufbauenden Šulḥān ‘Arūkh. Doch scheint Even ha-‘ ezer, › Stein der Hilfe ‹ – anders als Avi ha-‘ Ezri / ‘ Ezer – in der jüdischen Tradition nie als Personenname, insbesondere nicht eines der drei Autoren, gebraucht worden zu sein. Even kann hier also nicht gut die primär gemeinte Lautung der Buchstabenfolge ‫ אבן‬gewesen sein ; vielmehr scheint Buxtorf mit seinem Aben, also dem arabischen Patronymikon-Signal Aben ~ Ibn, das Richtige zu treffen.29 Man kann sich dann des Eindrucks nicht erwehren, dass sich hier der Name Ibn Ezra 26 Im Manuskript mr steht ‫ ָא ִי‬irrtümlich mit Qameẓ. 27 Letztere Form laut Encyclopaedia Judaica 1928 – 1934 : Art. » Elieser ben Joel ha-Levi aus Bonn «. 28 So die Encyclopaedia Judaica 1972 : Art. » Eliezer ben Joel Ha-Levi of Bonn «. 29 Da ursemitisch bin › Sohn ‹ zugrunde liegt, ist der Initialvokal von aben / ibn nur ein Vorschlagvokal, dessen Färbung geschwankt haben muss : die mittelalterlichen Übersetzer in Toledo glaubten aben zu hören, doch die Sefarden brachten bei ihrer Ausweisung die kanonische Form ibn mit. Da Buxtorf in seinen Werken von Aben spricht, u.a. von Aben Ezra ( in Synagoga Judaica [ 1603 ], 36, 37, 63, 73, bzw. Aben Eſra, z. B. in Bibliotheca Rabbinica [ 1613 ], 28, 35, 91, 128, 151, 163, 218 ; in De Abbreviaturis. [ 1613 ], 192 ‫ ַר ִבּי ַא ֵבּן ֶעזְ ָרא‬unter dem Stichwort ‫) רא ״ בע‬, vokalisierte er das ‫ אבן‬natürlich auch hier nicht als Ibn, sondern als Aben. – Die Aussprache evn-ezre im modernen Oj. ( vgl. Groyser verterbukh ( i ) : 23, anscheinend regional beschränkt ) ist wohl von evn › Stein ‹ sekundär beeinflusst. Erika Timm : Abraham ibn Ezra und das Maiśebuch 295 eindrängt oder dass er sogar wieder eindringt, wobei an Abraham ibn Ezra zu denken ist, der ja schon zu einer Lieblingsgestalt der sefardischen Folklore geworden war,30 nicht an die viel weniger bekannten Moses oder Isaak ibn Ezra. Zwar sehe ich keinen genügenden Grund, dieses Aben schon der noch gemeinsamen Vorstufe von mr und mbux zuzuschreiben ; denn mr hat ja das in sich konsistente Avi ha-Ezri. Doch handelt es sich keineswegs um eine bloße Caprice von mbux, da uns das Aben im nächsten Textzeugen ( aus Italien, von 1775 ) abermals begegnen wird, also schon um 1600 eine breitere und dauerhafte Basis gehabt haben muss. Damit kommen wir zu den anderen Versionen. Sechs von diesen kenne ich aus einem Aufsatz, den Elisheva Sheynfeld 1968 unserem Erzähltyp gewidmet hat.31 Da sie nur gedrängte Inhaltsangaben gibt, habe ich mir, um sicherer urteilen zu können, die Volltexte beschafft, ferner ein Foto des oben erwähnten Textes aus dem Manuskript Gaster 66.32 Dazu kommen noch einzelne weitere Versionen aus dem 2011 erschienenen Band iii der großen Sammlung Folktales of the Jews.33 Doch zeigte sich, dass für den jetzigen Zweck eines Überblicks über die Entwicklung des Typs bei der Mehrzahl der Texte eine kursorische Besprechung ausreicht. Die folgende Maiśe stammt aus einer handschriftlichen hebräischen Sammlung, die 1775 von einem Arie Ḥai ‫ ינײסי‬34 in Lugo ( 20 km westlich Ravenna ) 35 angelegt wurde. Der Retter heißt jetzt Rabbi ‫אבן‬ ‫ העזר‬Aben ( bzw. Even ) ha-‘ Ezer – hier der Inhalt : 30 Vgl. Alexander-Frizer 1990 : passim, dies. 2008 : 209 – 223, speziell 213. 31 Da Sheynfeld ( 1968 : 58 – 64 ) unsere beiden Versionen und den Text im Ms. Gaster 66 nicht kennt, macht sie sich von der Entstehung des Typs zwangsläuĳig andere Vorstellungen als die hier vorzutragenden. Sie spricht unter anderem von der Möglichkeit, dass die harten Aufnahmeprüfungen des spätantiken Mithraskultes als geforderte Menschenopfer missverstanden und von Mithras auf Jesus übertragen sein könnten und dass auch der Hahn, der manchmal in Mithras ’ Begleitung erscheint, das Urbild des Hahnes in den osteuropäischen und orientalischen Fassungen unseres Typs sein könnte. Ich gehe im Folgenden auf diese Hypothesen nicht ein, da ich die Erĳindung des Typs bis zum Beweis des Gegenteils erst im mittelalterlichen Sefardentum vermute und auch für den Hahn eine andere Erklärung vorzuschlagen habe. 32 Moses Gaster gibt nicht an, wo in dem umfangreichen Manuskript die Erzählung aufgezeichnet ist. Um so mehr bin ich Claudia Rosenzweig für die Beschaffung einer Fotokopie zu Dank verpflichtet : Sie hat für mich im Institute of Microĳilmed Hebrew Manuscripts in Jerusalem ( das Original beĳindet sich heute in der John Rylands Library, Manchester ) den Text am Film gesucht und auf Fol. 46 r – 47 r gefunden, und mich außerdem auf den Artikel von E. Sheynfeld hingewiesen. 33 Ben-Amos 2011 : 158 – 164 ( Tale 12 und Kommentar dazu ). 34 Die lateinschriftliche Entsprechung des Namens ‫ ינײסי‬scheint unbekannt zu sein. 35 Der Text der Maiśe ist abgedruckt bei Ginzberg 1960 : 234 f. – Sheynfeld ( 1968 : 63 a ) schreibt versehentlich Lugan ( Iṭalyah ), aber Ginzbergs Lugo ist richtig. Lugo hatte damals ( laut Encyclopaedia Judaica 1972 : Art. » Lugo « ) eine recht angesehene Judengemeinde 296 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ › Vor vielen Jahren ‹ kam der Rabbi nach Rom, wo man jeweils zu › deren Pascha ‹ ( dem der Nichtjuden ) einen Juden ausloste und in ein Fass steckte, in das man von außen Nägel einschlug, deren Spitzen bis in das Innere drangen. Indem man das Fass durch die Stadt rollte, kam der Jude elend um. Diesmal hatte das Los einen Bräutigam getroffen, der in der folgenden Woche heiraten wollte. Rabbi Aben ha-‘ Ezer trat an seine Stelle. Es war üblich, dem Opfer einen letzten Wunsch zu erfüllen. Der Rabbi wünschte sich nur, dass man ihm das Gerät für eine Fußwaschung bringe. Und obwohl Götzenbilder doch lebloser Stoff sind und sich nicht bewegen können [ in diesem Sinn wird emphatisch Ps 115 : 5 – 7 zitiert ], ließ er nun mit Hilfe von heiligen Namen die Zuschauer es so sehen, › als ob ‹ er aus der nahen Kirche › Götzenbilder ‹ herbeiriefe, die die Waschung vorbereiteten, und schließlich dem großen Götzen, der oto ha-iš › jenen Menschen ‹ darstellte, beföhle, ihm die Füße zu waschen. Schreiend bat das entsetzte Volk, eloqehem › ihrem Gott ‹ eine weitere Demütigung zu ersparen. Das tat der Rabbi auch, als man auf der Stelle das Gesetz widerrief. Der Widerruf wurde in das Gesetzbuch eingetragen. Der Witz der Erzählung besteht also darin, dass Aben ha-‘ Ezer das Volk, wie wir heute sagen würden, einer Massenhypnose unterzog. Die Maiśe lässt sich verstehen als zeitbedingte Weiterentwicklung der oben besprochenen Version mr / mbux. Volkserzähler machen eine vorgefundene Erzählung gern noch spektakulärer, so auch hier : die grundsätzliche narrative Neuerung, die dann auch in den osteuropäischen und orientalischen Versionen erhalten bleibt, besteht darin, dass der Rabbi mit Hilfe von geheimen Gottesnamen das Jesusbild nicht nur zu reden, sondern zu handeln zwingt. Doch Lugo gehörte 1775 zum Kirchenstaat. Die Juden waren hier zwar ihres Lebens sicher, lebten aber materiell in ziemlich beschränkten Verhältnissen, kulturell sogar in einem Überwachungsstaat.36 In Lugo hatte Anfang des 17. Jhs. der berühmt-berüchtigte Zensor Camillo Jagel gelebt,37 und auch 1775 gab es im Kirchenstaat sicher mehr als genug Geistliche, die mit ihrem Bibelhebräisch eine konĳiszierte hebräische Maiśe-Sammlung leidlich verstanden hätten. Das führt zu verhüllendem Sprachgebrauch ( › deren Pascha ‹ ohne vorherige Deĳinition des › sie [ Pl. ] ‹, › jener Mensch ‹ für Jesus u.ä. ) ; ferner dazu, dass der Erzähler ( zum innerjüdischen Kulturleben vgl. Volli 1957 : passim ), allerdings nicht allein aus eigener Kraft, sondern z. T. dadurch, dass die Päpste die Juden des Kirchenstaates in nur drei Ghettos, nämlich in Rom, Ancona und eben Lugo, konzentriert hatten ( Volli 1957 : 69 ). 36 In welchem unglaublichen Maße Kleinigkeiten des täglichen Lebens in Lugo der staatlichen Kontrolle unterlagen, zeigt Sierra 1958 : passim. 37 Volli 1957 : 67. Erika Timm : Abraham ibn Ezra und das Maiśebuch 297 den Herrn von Rom lieber nicht nennt : › das Volk ‹ handelt ; schließlich dazu, dass er die Maiśe ausdrücklich › vor vielen Jahren ‹ spielen lässt. Denn selbst im Kirchenstaat durfte man inzwischen das ferne Mittelalter eine dunkle und inhumane Epoche nennen. Da konnte dann sogar ein Motiv wie das vom Tod im rollenden Nagelfass den Weg in nur diese Fassung ĳinden. Wir kennen es als Märchenschluss aus khm 13 › Die drei Männlein im Walde ‹, 89 › Die Gänsemagd ‹ und 135 › Die weiße und die schwarze Braut ‹, und schon die Grimms kannten es laut ihren Anmerkungen ( von 1822 ) zu khm 13 auch aus anderen europäischen Märchen und historischen Liedern.38 Doch unser Erzähler kann es durchaus aus jüdischer Quelle haben. Denn während in der Maiśe h [ a-šem ], die seit 1708 mehrfach im Raum Frankfurt a.M. und anderswo gedruckt wurde, immerhin geschildert wird, wie bei der Wiener Gesera von 1421 jüdische Jünglinge den Märtyrertod in durch die Stadt gerollten, allerdings nicht mit Nägeln versehenen Fässern auf sich nahmen,39 erzählt Salomon ibn Verga im Ševet Yěhūdāh,40 dass einst ein französischer König fünfzig Juden in mit Nägeln ausgeschlagene Fässer gesperrt habe, um sie einen Berg hinunterrollen zu lassen ; er wurde aber von einem seiner Untertanen aufgefordert, das erste Fass selbst anzustoßen, und verstauchte sich dabei so sehr den Fuß, dass er in Ohnmacht ĳiel ; wieder aufgewacht, befahl er, die Juden aus den Fässern zu holen. Schwerer zu beurteilen ist, ob die Wirkung der › Namen ‹ als Phänomen der Massenhypnose, wie sie in keiner anderen Version explizit gemacht wird, erst vom Erzähler hinzugefügt ist. Auch wenn es damals den Begriff der Hypnose noch nicht gab, interessierte man sich ja im Europa der zweiten Hälfte des 18. Jhs. sehr für alle paranatürlichen Erscheinungen wie den damals gerade modern werdenden › Mesmerismus ‹ und Ähnliches, und es gab zweifellos Personen, die die Hypnose praktisch handhaben konnten. Auch hier ist die zudem nur vorgetäuschte Demütigung der Christen ein unblutiges Schockerlebnis, um weitere blutige Taten zu verhindern. Woher hat der Erzähler das Motiv der Fußwaschung ? Zwar dürfte ihm der altorientalische Brauch schon aus der hebräischen Bibel bekannt gewesen sein.41 Doch kann man mit ziemlicher Sicherheit davon ausgehen, dass er sich an einer Szene aus dem Johannes-Evangelium ( 13 : 1 – 17 ) orientiert hat : Dort wäscht Jesus ja kurz vor seinem Tod allen 38 Röllecke 1999 : 883 f. 39 Z. B. in der Ausgabe Frankfurt a. M. ( oder Homburg ) 1724 / 25, fol. 77 r. 40 Schon im hebr. Original ( gedruckt ab der Mitte des 16. Jhs. ; hier Nr. 17 ), aber auch in der jiddischen Übersetzung, Krakau 1591, fol. 46 v f. 41 Als Geste der Ergebenheit, vgl. z. B. 1 Sam 25 : 41 : Abigail ist bereit, Davids Frau zu werden und seinen Boten die Füße zu waschen. 298 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ zwölf Jüngern die Füße, um sie durch seine Demut zu ähnlichem Verhalten gegeneinander zu verpflichten ; hier nun soll er – scheinbar – auch einem Juden die Füße waschen. Aber überschätzen wir damit nicht die Kenntnisse des Erzählers vom Christentum ? Keineswegs. Denn im 18. Jh. mussten die Juden von Lugo jeweils in den Tagen der christlichen Fastenzeit in der dortigen Karmeliterkirche Zwangspredigten über sich ergehen lassen ; 42 1751 und 1771 wurde für alle männlichen, über zwölf Jahre alten Juden die Anwesenheitspflicht erneut eingeschärft.43 Und gerade in der Fastenzeit wurde und wird in der katholischen Kirche traditionell das Johannes-Evangelium ( sowie die Passionsgeschichte nach den anderen Evangelien ) gelesen und darüber gepredigt.44 Doch selbst wer es damals schaffte, sich vor der Teilnahme zu drücken oder konsequent wegzuhören, erfuhr von der Fußwaschung. Denn einmal im Jahr, am Gründonnerstag, waren ja seit dem Mittelalter und speziell gemäß dem Pontiĳikale von 1570 alle Bischöfe ( also auch der Papst ) und alle Äbte verpflichtet, die Fußwaschung persönlich im Gottesdienst zu vollziehen,45 und sicherlich sorgte der Klerus des Kirchenstaates dafür, dass diese Ostentation der Demut in der Öffentlichkeit gebührende Beachtung fand. Ostaschkenasische Versionen unseres Typs liegen im Druck nur in Aufzeichnungen aus der Mündlichkeit ( seit dem späten 19. Jh. ) vor,46 kön42 Wie allgemein die Juden des Kirchenstaates. Auf das Mittel der Zwangspredigten war zuerst Papst Nikolaus iii. 1278 in seiner Bulle Vineam Soreth verfallen ; vgl. Sierra 1958 : 453. 43 Sierra, loc. cit. 44 Im Laufe des 20. Jhs. haben sich die Schriftlesungs-Pläne der katholischen Messe zwar in den Details sehr geändert, nicht aber in den großen Linien : spätestens seit dem Missale Romanum ( 1570 ) galt für den gesamten Bereich der katholischen Kirche das oben Gesagte ; vgl. etwa das Dictionnaire d ’ archéologie chrétienne et de liturgie, Art. › Évangiles ‹, speziell Tabelle S. 522. 45 Vgl. z. B. Kunzler 1995 : 585. 46 Nämlich : eine Version aus Litauen bei Cahan ( 1938 : 138 ) ; eine von Jacob Avitsuk aufgezeichnete Version aus dem Munde eines rumänischen Juden aus Vaslui ( rumänische Moldau ), der sie dort vor dem Ersten Weltkrieg hörte, in extenso abgedruckt bei Noy ( 1960 : 114 – 116, zur Herkunft S. 114, Anm. 10 ) und Avitsuk ( 1965 : 24 – 29 ), heute IFA 842 ( ähnlich nach Ben-Amos 2011 : 162 wohl die ungedruckte Version IFA 2690 ) ; die bei Karlinger / Mykytiuk ( 1969 : 180 – 182 ) abgedruckte Version, die zuerst 1895 von Ivan und Ol’ ha Franko in ukrainischer Sprache veröffentlicht wurde ( vgl. Karlinger / Mykytiuk 1969 : 303 ) und deshalb vielleicht mit einiger Vorsicht zu betrachten ist. ( Die beiden Versionen aus dem ostjiddischen Süden enden, offenbar unter der Nachwirkung der Chmielnicki- und HaidamakenErfahrungen, weniger versöhnlich ; das wirkt zum Teil bis in die orientalischen Versionen nach. ) Die Version bei Ben-Amos ( 2011 : 158 –160 ) schließlich stammt zwar aus dem Mund einer in Israel in eine irakisch-jüdische Familie geborenen Erzählerin, die sie aber » from any number of sources « ( ibd. S. 161 ) haben kann ; da der Retter hier der Baal-Shem-Tov ist, der in der Ukraine lebte und dort 1760 starb, und da die Erzählung nicht die geringsten orientalischen Züge enthält, neige ich dazu, sie der Sache nach zu den aschkenasischen Versionen zu stellen. Erika Timm : Abraham ibn Ezra und das Maiśebuch 299 nen natürlich in der Substanz um Jahrhunderte älter sein. Da der einfache Jiddischsprecher mit Namen wie Avi ha-Ezri oder Aben ha-Ezri nichts und selbst mit dem Namen Ibn Ezra – wie es scheint – wenig verbinden konnte, ist an deren Stelle ein anonymer Rabbi, der Prophet Elija oder ein anonymer Engel getreten. Zugleich weitet sich das Streben nach Spektakularität aus : der Retter gebietet außer Jesu auch Maria und sogar – als drittem lebendig gemachten › Götzenbild ‹ – einem Kirchturmhahn ; 47 andere Erzähler kennen aus ihrer Gegend keinen Turmhahn mehr, behalten aber den Hahn bei, der nun untermotiviert erscheint. Mit Jesus, Maria und dem Hahn ist die Erzählung dann – vielleicht schon vor Jahrhunderten – in den islamischen Orient gewandert, wobei wir Zeugnisse nicht aus türkischsprachigen, sondern nur aus persischund arabischsprachigen Gebieten haben.48 Dass alle drei Elemente zufällig dort erneut erfunden worden seien, oder gar, dass der ganze Erzähltyp mit diesen für das Christentum speziĳischen Elementen überhaupt im islamischen Orient ersonnen und dann westwärts gewandert sei, wird wohl niemand annehmen. Doch halten die Versionen aus dem persischen und arabophonen Bereich noch eine Überraschung für uns bereit : in allen ist der Held der Sefarde Abraham ibn Ezra aus dem fernen Westen. Zwar passt inhaltlich Abraham ibn Ezra ausgezeichnet : er ist ja auch sonst primär der außerordentlich Kluge, in der Folklore mit übernatürlichen, gottgegebenen Kräften, und er hat schon im realen Leben vierundzwanzig 47 So in der Fassung bei Noy ( 1960 : 114 – 116 ). Da es Turmhähne im Bereich der orthodoxen Kirche anscheinend nie gegeben hat und da sie im katholischen Bereich zwar im Mittelalter normaler Teil der Kirche waren ( vgl. vor allem Novati 1904 – 1905 : passim, Sauer 1924 : 143 – 145 und 396, sowie Kretzenbacher 1958 : passim ), aber zumindest aus Osteuropa allmählich seit der Gegenreformation so gut wie ganz verschwunden sind, kann das Motiv entweder alt sein oder aber aus einer der evangelischen Kirchen, z. B. in Siebenbürgen, stammen, wo z. B. die Kirchen von Almás und Klosdorf noch heute einen Hahn tragen. 48 Hierher gehören : die Version in Gasters Ms. 66 aus Persien, nach Gaster ( 1924 : 17 ) zusammengesetzt aus Niederschriften des 16. – 18. Jhs., dort fol. 46 r – 47 r, wobei aber die untere Hälfte von fol. 46 aus dem Ms. gerissen ist, so dass nur drei Bruchstücke der Erzählung erhalten sind ( ich urteile nach Fotokopie ) ; die Version bei Ben-Menachem ( 1978 : 358 – 360 ) aus einem undatierten jemenitisch-hebr. Ms. im Besitz von J. L. Zlotnik, das, nach dem Faksimile bei Zlotnik ( 1946 : 11 ) zu urteilen, höchstens etwa zweihundert Jahre alt sein dürfte ; die Version aus Ägypten, abgedruckt aus einem jüdisch-arab. Ms. von 1840 bei Avishur ( 1992 : 167 – 170 ) mit hebr. Übersetzung ; die aus Syrien, erwähnt bei Ben-Amos ( 2011 : 162 Anm. 18 ). Schließlich ist hier zu nennen die Version des jemenitisch-jüdischen Erzählers Jefet Schwili bei Noy ( 1963 : 331 – 334 ), heute ifa 619 ; doch hat Schwili die Erzählung sehr modernisiert und aus der Christenheit in den heutigen Islam versetzt ( die Hinrichtung des Juden ĳindet jeweils am » Arafat-Tag « statt! ) ; Jesus, Maria und der Hahn sind verschwunden, der Retter – es ist immer noch Abraham ibn Ezra – erbittet sich stattdessen einen Hammer und einen Pfosten, und bei jedem Hammerschlag versinken alle anwesenden Araber tiefer in die Erde, bis der König das Gesetz widerruft. 300 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Jahre auf ruhelosen Wanderungen durch christliche Länder von Italien bis England zugebracht und erscheint deshalb auch in der jüdischen Folklore oft als Wanderer.49 Doch bleibt die geographische Frage : sollen wir wirklich annehmen, dass seine Gestalt erst im persisch-arabischen Bereich in den Erzähltyp eindrang ? Wohl kaum ; denn vor dem Hintergrund dieser Versionen gewinnt doch das zunächst rätselhafte Aben in Buxtorfs und der italienischen Fassung ( also 1602 bzw. 1775 ) nunmehr eine weit größere Relevanz. Es muss sich jetzt die Vermutung aufdrängen, dass der Name schon dort durch eine sefardische Erzähltradition über Ibn Ezra beeinflusst wurde. Damit stehen wir vor der entscheidenden Frage : ist denn unser Erzähltyp aus Abraham ibn Ezras Heimat, aus dem sefardischen oder sefardisch dominierten Bereich gar nicht zu belegen ? Doch, aus dem Munde eines Erzählers aus Meknès in Marokko ; die dortige jüdische Gemeinde war zwar schon vorsefardisch, wurde aber kulturell, vor allem dank der weitverzweigten Familie der Toledano, Rabbiner und Vertrauensleute des Scherifen, völlig sefardisiert.50 Der Retter ist auch dort Abraham ibn Ezra. Die Version wird von Sheynfeld, anscheinend wörtlich, ohne weitere Herkunftsangabe vorgeführt : 51 Zur Zeit des Rabbi Abraham ibn Ezra lebte ein den Juden feindlich gesinnter König, der ihnen auferlegt hatte, jedes Jahr ein Kind zu bringen, das dann an seinem Hofe geopfert wurde. Als die Reihe an den einzigen Sohn einer Familie kam, erschien Abraham ibn Ezra und schlug vor, an Stelle des Sohnes zur Opferung zu gehen. Er kam vor den König, und dieser gestattete ihm, nun seinen letzten Wunsch zu äußern ; er, der König, werde ihn erfüllen. Aber Abraham ibn Ezra zögerte, dem Fürsten seinen Wunsch zu offenbaren. Als der König ihn nach dem Grund fragte, entgegnete er : » Wenn ich dir offenbarte, was ich gern erfüllt sähe, würde der König aller Könige mich zornig fragen, warum ich meinen Wunsch nicht ihm, sondern einem so kleinen König offenbarte. « Doch der König fragte ihn abermals nach seinem letzten Wunsch ; denn er gelobe ihn doch zu erfüllen, und das Versprechen eines Königs sei unabänderlich. » So ist mein Wunsch, dass du alle Opfer, die du getötet hast, ihren Eltern lebend zurückgibst. « Doch da ein irdischer König Tote nicht auferwecken kann, fragte ihn der König erneut nach einem letzten Wunsch. Er antwortete : » Du hast unten eine Tonne Weizen, hol sie herauf und trage sie in den Oberstock. « Wieder konnte der König die Bitte nicht erfüllen. 49 Zu Letzterem vgl. speziell Alexander-Frizer ( 1990 : 15 und 16, sowie 2008 : 210 und 212 ). 50 Vgl. Encyclopaedia Judaica 1972 : Art. » Meknès «. 51 Sheynfeld 1968 : 63 f [ hebr. ] ; diese Version hat jetzt im ifa die Nummer 3813 ; vgl. BenAmos 2011 : 162. Erika Timm : Abraham ibn Ezra und das Maiśebuch 301 Da sagte Rabbi Abraham zu ihm : » Wenn der König nicht einmal eine solche Last auf seinem Rücken tragen kann – wie kann er dann all die jüdischen Opfer tragen, die von seiner Hand getötet wurden, all die Kinder Israel, die er Jahr für Jahr gemordet hat ? « Plötzlich spürte der König starke Schmerzen im Rücken und in den Hüften. Die ließen nicht nach, bis er sein Versprechen besiegelt hatte, den Juden in seinem Land nie mehr Böses anzutun. Diese Urkunde wurde Rabbi Abraham ibn Ezra ausgehändigt. Eine bewundernswert sparsame und durchstrukturierte Geschichte. Ibn Ezra erinnert den König zunächst an den größeren König : dem zuerst ist Abraham auch jetzt Rechenschaft schuldig. Dann spricht er die Psyche des irdischen Königs an, sein Gewissen : auch der König weiß, dass diese Opfer schuldlos sind, und er wird für sie zur Rechenschaft gezogen werden. Nunmehr wendet er sich dem Körper des Königs zu und demonstriert ihm dessen Schwäche. Schließlich verbindet er im qal wa-ḥomer Körper und Psyche, vergleicht die körperliche Last mit der ungleich schwereren Gewissenslast. Das Wunder, das sich dann ereignet, übersteigt kaum das, was wir heute eine psychosomatische Wirkung nennen würden. Kann man sich vorstellen, dass die spektakuläre orientalische Form unseres Typs mit Ibn Ezra, aber auch mit Jesus, Maria und dem Hahn einige Tausend Kilometer westwärts gewandert und dann von Volkserzählern so völlig umgeformt, so ins Unspektakulär-Geistige zurückübersetzt worden wäre ? Wenn nicht, so bleibt nur eine Alternative : wir haben hier in der Substanz sehr altes sefardisches Erbe vor uns.52 Man könnte einwenden wollen, dazu sei die Erzählung in ihrer Milde zu modern. Aber erinnern wir uns nur an die oben erwähnte Erzählung Ibn Vergas : auch dort reicht eine Fußverstauchung samt Ohnmachtsanfall aus, den französischen König von der geplanten Untat abzubringen. Doch wenn wir wagen wollen, die sefardische Erzählung in ihrer Substanz noch vor unsere aschkenasische Doppelversion mr / mbux von um 1600 zu stellen, so müssen wir zumindest einen plausiblen Weg der Beeinflussung aufzeigen. Seit wann ist denn eigentlich Ibn Ezra als Gestalt der sefardischen Folklore bezeugt ? Jedenfalls seit Gedaljah ibn Yaḥya ( 1515 – 1587 ) in seiner Šalšelet ha-Qabbālāh ( Venedig 1587, fol. 31 ) über ihn schrieb : » Ich habe viele Erzählungen über seine Lebensver52 Dass die orientalischen Versionen unseres Typs als Retter Abraham ibn Ezra nennen, die rezenten ostaschkenasischen aber nicht, spricht nicht gegen unsere Vorstellung vom Wanderweg des Typs ; der Name kann ja im östlichen Aschkenas allmählich verloren gegangen sein. Schon die sämtlich naheliegenden Ersatzgestalten ( anonymer Rabbi, der Prophet Elija, ein Engel, der Baal Shem Tov ) deuten ja auf den Verlust einer alten Trägergestalt hin. 302 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ hältnisse, seine Taten und die Eleganz seiner Sprache gehört, die ich um der Kürze willen hier nicht niedergeschrieben habe. « 53 Gedalja ibn Yaḥya gehörte der ersten Generation der sefardischen Diaspora an ; geboren in Imola, lebte er lange im Kirchenstaat, seit 1569 dann in mehreren Städten Norditaliens, unter anderem bis 1575 in Ferrara – kurzum, in dem breiten Überlappungsgebiet zwischen Sefarden und Aschkenasen. Warum sollte unsere Erzählung nicht zu den › vielen ‹ gehören, die es damals schon gab ? Und warum sollte sie nicht auch Aschkenasen zu Ohren gekommen sein ? Hier drängen sich zwei Erwägungen auf : Zum einen weiß man im sefardischen Kulturkreis recht gut über die Verfolgungen in Aschkenas Bescheid. Nicht nur erfuhr man darüber aus erster Hand von Flüchtlingen wie dem berühmten Ascher ben Jechiel.54 Auch berichtet Salomon ibn Verga im Ševet Yěhūdāh von den aschkenasischen Ereignissen des Jahres 1349 und der Wiener Gesera von 1421.55 Vor allem aber hatte man Blutbeschuldigungen im sefardischen Bereich selbst erlebt : 1250 und 1294 in Saragossa, im selben Jahrhundert auch in Sepúlveda und 1490 / 91 in La Guardia ( Provinz Toledo ).56 Die Annahme, im sefardischen Bereich sei eine Erzählung unseres Typs entstanden, strapaziert also keineswegs die Wahrscheinlichkeit. Und zum anderen : der historische Abraham ibn Ezra hielt sich 1140 – 1145 in Rom auf.57 Dort schrieb er ein eigenes grammatisches Werk und einen kurzen Kommentar zum Daniel und zum Hiob und übersetzte mehrere grammatische Traktate des Ibn Ḥayyūdž. Da er in seinen Werken jeweils den Entstehungsort nennt, konnte man somit leicht von seinem Aufenthalt in Rom wissen. Dann lag es nahe, als seinen Kontrahenten gleich den Papst zu wählen. Kürzlich hat Israel Yuval ausgeführt, wie nur das aschkenasische Judentum für das Endzeitschicksal der Christen eine Vergeltungsperspektive ausbildete, insbesondere der sefardische Bereich aber an einer Bekehrungsperspektive festhielt.58 Passt nun nicht die Diskussionswilligkeit und Belehrbarkeit des Papstes sowohl zu denselben Eigenschaften des Königs in unserer sefardischen Version, als auch im weiteren Rahmen zu dieser Bekehrungsperspektive ? Im Hauptpunkt allerdings wird unsere aschkenasische Erzählung wesentlich handfester, und 53 Zitiert nach Alexander-Frizer ( 2008 : 213 ). 54 Encyclopaedia Judaica 1972 : Art. » Asher ben Jeḥiel «. 55 Hebr. ( vgl. oben Anm. 40 ) Nr. 25, 34, 36 ; jidd. ( Krakau 1591 ) fol. 52 r – 53 r, 72v – 73 r, 73 v – 74 v. 56 Encyclopaedia Judaica 1972 : Art. » Blood Libel «, » La Guardia, Holy Child of «, » Saragossa «. 57 Encyclopeadia Judaica 1972/2006 : Art. » Ibn Ezra, Abraham «. 58 Yuval 2007 : 105 – 125. Erika Timm : Abraham ibn Ezra und das Maiśebuch 303 man versteht warum : Nach den Erfahrungen des Mittelalters konnte ein Aschkenase schwer glauben, dass der Judenfeind sich auf bloße menschliche Psychologie hin ändern würde. Man brauchte vielmehr eine Instanz, welcher selbst ein Papst Glaubensgehorsam schuldete. Abschließend noch einmal zurück zu Buxtorf. Ich habe oben seine Über- und Unterschriften zu seiner Aufzeichnung – weil nicht zum Maiśe-Text gehörig – noch nicht genannt. Die Überschrift lautet : Ex manuscripto Iudaei libro › aus der Handschrift eines Juden ‹.59 Buxtorf schöpft also nicht etwa aus einem für uns verlorenen Druck, sondern aus einer Handschrift, und zwar offenbar einer jiddischen. Denn hätte er aus einer hebräischen ins Deutsche übersetzt, dann hätte er nicht hebräische Wörter, auch ideologisch völlig belanglose, durch Synonymendopplungen wie » bekitzur und kurz « erklärt, sondern nur den deutschen Ausdruck gebracht.60 Aufschlussreicher noch ist seine Unterschrift : ult[ imo ] Jan[ uarii ] anno 1602 / scripsi ex libro / chartaceo judaei / poloni cui nomen / Iacob Mocher / Sepharim, Jacob buchhandler von / Messeritz burtig – › am 31. Januar 1602 habe ich dies abgeschrieben aus der Papierhandschrift eines polnischen Juden namens Jakob Mokher Sefarim, d.h. Jakob Buchhändler, gebürtig aus Meseritsch ‹ ( wohl das heutige Międzyrzec Podlaski ). Mit anderen Worten, dieses › handschriftliche Buch ‹ gehörte gerade jenem Mann, der im selben Jahr, ebenfalls in Basel, in der Druckerei des Christen Konrad Waldkirch, wo in diesen Jahren auch eigene Schriften Buxtorfs erschienen, die Erstauflage des großen Maiśebuchs drucken ließ.61 Angesichts des von Buxtorf genannten Januardatums ist es zudem das Wahrscheinlichere, dass die Drucklegung fortgeschritten, aber noch nicht beendet war. Und damit wird Buxtorfs Niederschrift, sozusagen e contrario, für die Druckgeschichte des Werkes interessant. Das Titelblatt des Buchs verspricht › dreihundert und etliche ‹ Maiśes ; das Buch enthält deren aber bei genauer Zählung nur 258, nach der Zählung im Text selbst und im Inhaltsverzeichnis am Ende des Buches sogar nur 255. Diese Diskrepanz habe ich 1995 ausführlich zu erklären versucht.62 Wie man leicht an der Lagenzählung erkennt, ist das 59 Liber wird, wie in der Antike und im ganzen Mittelalter ausschließlich, so später auch noch für Handschriften gebraucht ; die Präzisierung auf › Handschrift ‹ steckt erst in dem hier adjektivisch gebrauchten manuscriptum. 60 Vgl. oben Anm. 17. Alle hebräischen Elemente, die nur in mbux vorkommen ( 17, 22, 28, 64, 89, 131 [ 2 ], 147, 148 ), sind im Jiddischen vor und um 1600 durchaus gängig. 61 Jakob b. Abraham Meseritsch ( ‫ ) מעזריטש‬hat bei Waldkirch in den Jahren 1598 – 1602 mindestens vier hebräische und vier jiddische Bücher zum Druck gebracht ( vgl. Prijs 1964 : Nr. 153 a, 157, 159, 167, 169, 170 a, 174, 178 ) ; im Sommer 1603 arbeitete er sogar mit Buxtorf direkt zusammen ( Prijs 1964 : Nr. 185 a, vgl. auch 185 b ). 62 Timm 1995 : 270 – 272 ( » Die Faszination der Zahl 300 « ). 304 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Titelblatt fester Bestandteil der ersten Lage, muss also gleich zu Beginn der Druckarbeit gedruckt worden sein ; doch wird auf seiner Rückseite auch schon der Verkaufspreis des Buchs mit einem Taler angegeben.63 Der Schluss des Buches ist auffällig schmucklos : die letzten vier Maiśes sind nur je eine halbe Seite lang, und nach der letzten Maiśe folgt, gerade auf dem letzten Blatt der fünfzigsten Lage ( allerdings noch auf dessen Vorderseite ), ohne die gewohnte Messias-Wunschformel nur ein dreimaliges ślik ( › Finis ‹ ), das nicht einmal graphisch ausgezeichnet ist. Auch wenn dann zwei weitere Lagen für das Inhaltsverzeichnis – einen praktisch unabdingbaren Bestandteil einer solchen Sammlung – nötig wurden, ist der Textschluss doch offensichtlich kurzfristig improvisiert. Daraus habe ich damals geschlossen, dass der geplante Inhalt des Buches aus wirtschaftlichen Gründen in einer Spätphase des Druckes gekürzt werden musste. Die Vorkalkulation des Buches hatte sich auf fünfzig Lagen Text bezogen, der Text der handschriftlichen Vorlage erwies sich aber während des Drucks als wesentlich länger, und mehr als den eingedruckten Verkaufspreis würde für das Buch kaum jemand zahlen wollen. Das halte ich auch heute noch für eine naheliegende Erklärung der Diskrepanz. Buxtorfs Abschrift ist dabei jetzt ein sehr willkommenes Indiz ; denn sie beweist ja, dass Jakob Meseritsch in der Tat mit der 258. Maiśe keineswegs am Ende seines Wissens oder seiner Sammeltätigkeit angekommen war. Und inhaltlich wäre die vorliegende Maiśe von seiner jüdischen Leserschaft zweifellos günstig aufgenommen worden ; man sieht also nicht, warum er sie nicht hätte drucken lassen mögen. Allerdings bietet sich jetzt auch eine andere Erklärung an, die mit der ersten durchaus vereinbar ist. In den 258 gedruckten Maiśes tritt Jesus nicht als handelnde Person auf ; erst recht berichtet er nicht von Qualen. Es ist durchaus denkbar, dass angesichts dieser neuen und vielleicht noch einiger ähnlicher Maiśes Buxtorf oder Waldkirch Bedenken bekamen und für Waldkirchs Konzession fürchteten. In einigen Monaten würde der Text in Hunderten Exemplaren vorliegen, und Jakob Meseritsch würde den Vertrieb nicht erst in Böhmen, › Reußen ‹ oder Polen, sondern gleich an Ort und Stelle beginnen, wie der gereimte Vorspann des Buches ankündigte.64 Gerade weil im Laufe des 16. Jahrhunderts zwar das Interesse von Gelehrten und Studenten am › jüdischen Deutsch ‹ und seiner Verschriftung, aber nicht notwendigerweise auch ihrer aller Toleranz zugenommen hatte, wusste man nicht, welchen 63 Nach den Angaben von Krieg ( 1953 : 228 ) zu Lagenpreisen in der Druckerei von Nikolaus Schneider in Liegnitz um 1600 darf man vergleichsweise › einen Taler ‹ als Verkaufspreis für das Maiśebuch durchaus als realistisch ansehen. 64 Immerhin war Jakob Meseritsch im Sommer 1603 noch in Basel ; vgl. Anm. 61. Erika Timm : Abraham ibn Ezra und das Maiśebuch 305 Christen das Buch in die Hände fallen würde. Schon von Buxtorfs eigenen Schülern hätte eines Tages einer mit dem Buch sich beim Rat der Stadt wichtig machen können, und ein Entzug der Konzession für Waldkirch hätte die Folge sein können. In dieser Situation könnte sich einer von beiden entschlossen haben zu einem › Bis hierher und nicht weiter ‹. Dafür spricht insbesondere Buxtorfs Polemik in seiner etwa zur selben Zeit verfassten und 1603 in Basel gedruckten Synagoga Judaica, wo er – in größerem Zusammenhang – die oben vorgeführte Erzählung aus Gittin 65 scharf kommentiert und mit Beifall hinzufügt : » aber im Talmud / zu Basel getruckt 66 / ist sie billicherweise / wie viel andere Sachen mehr wider Christum / und die Christliche Religion / außgelassen worden «. Man darf also die Vermutung wagen, dass es Buxtorf selbst war, der die Aufnahme unserer Maiśe in das Maiśebuch verhindert hat. Wenn er sie trotzdem nicht nur sorgfältig transkribierte, sondern mit erklärenden Zusätzen versah, so vielleicht, weil er sie zum Beispiel in einer seiner Vorlesungen zu verwenden gedachte. Zitierte Literatur Aarne, Antti / Thompson, Stith, 1961 : The Types of the Folktale. A Classiĳication and Bibliography. Second revision. Helsinki : Suomalainen Tiedeakatemia ( = ffc 184 ). Alexander-Frizer, Tamar, 1990 : » Hagiography and Biography : Abraham ibn Ezra as a Character in the Hebrew Folktale. « In : Abraham ibn Ezra y su tiempo. Actas del Simposio Internacional. 1 – 8 febrero 1989. Madrid : Asociación Española de Orientalistas, 11 – 16. Alexander-Frizer, Tamar, 2008 : The Heart is a Mirror. The Sephardic Folktale. Detroit : Wayne State University Press. Avishur, Yiẓḥaq, 1992 : » Sippūrēy- ‘ am ḥadāšīm ‘ al R' ’Avrāhām ’ ibn ‘ Ezra’ ( ū-věnō ) mi-Miẓrayīm ū-mē- ‘ Īrāq. « In : Studies in the Works of Abraham Ibn Ezra. [ Te ‘ udah 8 ] Tel-Aviv : University of Tel Aviv, 163 – 192. Avitsuk, Jacob, 1965 : Hā- ’ īlān še-sāfag děmā ‘ ōt. 36 sippūrēy- ‘ ām mippī 12 měsappěrīm, ed. and annotated by Dov Noy. Haifa : ifa Publication Series 7. Ben-Amos, Dan ( ed. ), 2011 : Folktales of the Jews. Vol. 3 : Tales from Arab Lands. Philadelphia : The Jewish Publication Society. 65 Synagoga Judaica, p. 93 f. ; vgl. oben S. 287. 66 1578 – 1580 bei Ambrosius Froben ; vgl. Prijs 1964 : Nr. 124. 306 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Ben-Menaḥem, Naftali, 1978 : ‘ Inyěnēy ’ Ibn ‘ Ezra’. Jerusalem : Mosad haRav Kook. Birnbaum, Salomo A., 1960 : » Das Datum des Codex Zimt Sand. « In : Mitteilungen aus dem Arbeitskreis für Jiddistik 2 ( 11 ) : 9 – 10. Buxtorf, Johann, 1603 : Synagoga Judaica, das ist : Juden-schul. Basel : Petri. ( Zitiert nach der Ausgabe Basel : König 1643 [ urn :nbn :de :hebis :30180010577006 ]. ) Buxtorf, Johann, 1613 : De Abbreviaturis Hebraicis [ … ] Item : Bibliotheca Rabbinica [ … ]. Basel : Waldkirch. ( Zitiert nach dem Nachdruck der Ausgabe Herborn : Andreas 1708. ) Cahan, Judah Leyb, 1938 : Der yidisher folklor. Wilna : yivo. Dictionnaire d’ archéologie chrétienne et de liturgie, 15 vols., ed. Fernand Cabrol [ et al. ]. Paris : Letouzey, 1907 – 1953. Encyclopædia Judaica 1928 – 1934 : 10 Bde. Berlin : Eschkol. Encyclopædia Judaica 1972 : 16. Bde. Jerusalem : Keter. ( Second Edition, 22 Bde., Detroit : Gale, 2007 ). Gaster, Moses, 1924 : The Exempla of the Rabbis. London : Asia Publ. Co. ( Nachdruck New York : Ktav Publ. House, 1968 ). Ginzberg, Louis [ hier : ‫] לוי גינצבורג‬, 1960 : ‘Al halākhāh wě-’aggādāh. Meḥqār ū-massāh. Tel Aviv : Dvir. Groyser verterbukh fun der yidisher shprakh. 1961 – 1980: 4 Bde. [ = Buchstabe Alef ], hg. von Judah A. Joffe und Yudl Mark. New York : Komitet farn Groysn verterbukh fun der yidisher shprakh. Karlinger, Felix, und Mykytiuk, Bohdan ( Hg. ), 1967 : Legendenmärchen aus Europa. Düsseldorf : Diederichs. khm = Kinder- und Hausmärchen, s. Röllecke 1999. Kretzenbacher, Leopold, 1958 : » Der Hahn auf dem Kirchturm. « In : Rheinisches Jahrbuch für Volkskunde 9 : 194 – 206. Krieg, Walter, 1953 : Materialien zu einer Entwicklungsgeschichte der Bücher-Preise und des Autoren-Honorars vom 15. bis zum 16. Jahrhundert, nebst einem Anhange : Kleine Notizen zur Auflagengeschichte der Bücher im 15. und 16. Jahrhundert. Wien : Stubenrauch. Kunzler, Michael, 1995 : Die Liturgie der Kirche. Paderborn : Bonifatius. Lexikon der christlichen Ikonographie, 8 Bde., hrg. v. Engelbert Kirschbaum SJ [ et al. ]. Freiburg i. Br. : Herder 1968 ( Sonderausgabe 1994 ). Lotter, Friedrich, 1993 : » Innocens virgo et martyr. Thomas von Monmouth und die Verbreitung der Ritualmordlegende im Hochmittelalter. « In : Rainer Erb ( Hg. ), Die Legende vom Ritualmord. Berlin : Metropol, 25 – 72. Meitlis, Jakob, 1933 : Das Ma’ assebuch. Seine Entstehung und Quellengeschichte. Berlin : Mass. ( Neudruck Hildesheim : Olms 1987 ). Erika Timm : Abraham ibn Ezra und das Maiśebuch 307 Neuberg, Simon, 2008 : » Deutsch ist anders, unverständlich, gelehrt, lächerlich, hässlich. Zur Verwendung des Deutschen in der jiddischen Literatur. « In : Grenzgängereien. Beiträge der gemeinsamen germanistischen Vortragsreihen in Trier und Prešov 2006 / 07. Prešov : Filozoĳická fakulta Prešovskej univerzity, 41 – 66. Novati, Francesco, 1904 – 1905 : » › Li Dis du Koc ‹ di Jean de Condé. Ed il gallo del campanile nella poesia medievale. « In : Studi medievali 1 : 465 – 512. Noy, Dov, 1960 : » ’ Ēliyyāhū ha-nāvī ’ bě-lēyl ha-sēder. « In : Maḥanayim 44 : 110 – 116. Noy, Dov ( Hg. ), 1963 : Jefet Schwili erzählt. Hundertneunundsechzig jemenitische Volkserzählungen aufgezeichnet in Israel 1957 – 1960. Berlin : De Gruyter. Prijs, Joseph, 1964 : Die Basler Hebräischen Drucke ( 1492 – 1866 ). Ergänzt und hrg. von Bernhard Prijs. Olten – Freiburg i. Br. : Graf. Rohrbacher, Stefan, und Schmidt, Michael, 1991 : Judenbilder. Kulturgeschichte antijüdischer Mythen und antisemitischer Vorurteile. Hamburg : Rowohlt. Röhrich, Lutz, 1974 : Märchen und Wirklichkeit. 3. Aufl. Wiesbaden : Steiner. Röhrich, Lutz, 1981 : » Drache, Drachenkampf, Drachentöter «. In : Enzyklopädie des Märchens 3. Berlin : De Gruyter, 787 – 820. Röllecke, Heinz, Hg., 1999 : Kinder- und Hausmärchen, gesammelt durch die Brüder Grimm. Darmstadt : Wissenschaftliche Buchgesellschaft. Sand, Ilse Z[ imt ], 1965 : » A Linguistic Comparison of Five Versions of the Mayse-bukh. « In : Uriel Weinreich, Hg., The Field of Yiddish, Bd. 2. The Hague : Mouton, 24 – 48. Sauer, Joseph, 1924 : Symbolik des Kirchengebäudes und seiner Ausstattung in der Auffassung des Mittelalters. 2. Aufl., Freiburg : Herder. Schäfer, Peter, 2010 : Jesus im Talmud. 2. durchgesehene Aufl., Tübingen : Mohr Siebeck. She(y)nfeld, Elisheva, 1968 : » Ha-qorbān wě- ‘ ośeh ha-pele ’ «. In : Yeda - ‘ Am 13 : 58 – 64. Sierra, Sergio, 1958 : » Notizie storiche e pragmatica degli Ebrei di Lugo nel sec. XVIII. « In : Rassegna mensile di Israel 24 : 451 – 462. Starck, Astrid, Hg., 2004 : Un beau livre d’ histoires – Eyn shön Mayse bukh. Fac-similé de l’ editio princeps de Bâle ( 1602 ). Traduction du yiddish, introduction et notes. 2 Bde. Basel : Schwabe. Steinschneider, Moritz, 1852 – 1860 : Catalogus librorum Hebraeorum in Bibliotheca Bodleiana. Berlin : Friedländer. ( Neudruck Hildesheim : Olms 1964 ). 308 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Timm, Erika, 1975 : » Beria und Simra. Eine jiddische Erzählung des 16. Jahrhunderts. Hrg. und kommentiert. « In : Literaturwissenschaftliches Jahrbuch nf 14 : 1 – 94. – 1995 : » Zur Frühgeschichte der jiddischen Erzählliteratur. Eine neu aufgefundene Maiśe-Handschrift. « In : Beiträge zur Geschichte der deutschen Sprache und Literatur 117 : 243 – 280. – 2005 : Historische jiddische Semantik. Die Bibelübersetzungssprache als Faktor der Auseinanderentwicklung des jiddischen und des deutschen Wortschatzes. Tübingen : Niemeyer. Thompson, Stith, 1955 – 1958 : Motif-Index of Folk Literature. 6 Bde. Kopenhagen : Rosenkilde/Bagger. Treue, Wolfgang, 1996 : Der Trienter Judenprozess. Voraussetzungen – Abläufe – Auswirkungen ( 1475 – 1588 ). Hannover : Hahnsche Buchhandlung. Uther, Hans-Jörg, 2004 : The Types of International Folktales. A Classiĳication and Bibliography, Based on the System of Antti Aarne and Stith Thompson. 3 Bde. Helsinki : Suomalainen Tiedeakatemia ( = ffc 284 – 286 ). Volli, Gemma, 1957 : » Gli Ebrei a Lugo. « In : Rassegna mensile di Israel 23 : 65 – 76. Weinreich, Max, 1973 : Geshikhte fun der yidisher shprakh. 4 Bde. New York : yivo. Willi, Thomas, 1994 : » Übersicht über den Inhalt der Kollektaneen von Johann Buxtorf i «. In : Die Handschriften der Universitätsbibliothek Basel. Die hebräischen Handschriften. Basel : Publikationen der Universitätsbibliothek 21, 89 – 98. Yuval, Israel J., 2007 : Zwei Völker in deinem Leib. Gegenseitige Wahrnehmung von Juden und Christen in Spätantike und Mittelalter. Aus dem Hebräischen von Dafna Mach. Göttingen : Vandenhoeck & Ruprecht. Zlotnik [ Avida ], Yehuda Leyb, 1946 : Ma ‘ aśeh yěrūšalmī. Jerusalem : Palestine Institute of Folklore and Ethnology. Wulf-Otto Dreessen Dovid und Wolfdietrich Von der Frühgeschichte der jiddischen Literatur wissen wir vergleichsweise wenig, weil ihre Überlieferung stark dezimiert ist. Sie beginnt eigentlich erst mit der in Kairo gefundenen Cambridger Handschrift von 1382 / 3,1 setzt danach für rund hundert Jahre wieder aus und wird dann in größerer Breite um die Mitte des sechzehnten Jahrhunderts fassbar. Aber selbst das früh Überlieferte zeigt schon deutliche Spuren einer Tradition, bildet also keinen Anfang, sondern setzt etwas fort. Für die Texte der Cambridger Handschrift, allen voran die Fabel vom kranken Löwen 2 und den Dukus Horant, 3 hat die Forschung mancherlei zusammengetragen, das etwas von den literaturgeschichtlichen Zusammenhängen erkennen lässt. Auch für den zentralen Text 4 des überwiegend auf jüdischen Quellen beruhenden Teils der altjiddischen Epik, das Schmu ’ elbuch,5 in dem auf biblischer Grundlage die heroische Gründungsgeschichte des jüdischen Königtums erzählt wird, erhob schon vor Jahrzehnten Felix Falk Materialien zur literaturgeschichtlichen Ortsbestimmung. Auf dieser Grundlage ist aber kaum noch weiter gebaut worden, seit L. Fuks im Jahre 1961 ein Faksimile des Augsburger Erstdrucks von 1544 zusammen mit umfangreichen Aufzeichnungen aus Falks Nachlass herausgab.6 Unverkennbar steht das Schmu ’ elbuch mittelhochdeutscher Heldendichtung nahe. Die ältere Forschung zog gern das Nibelungenlied in Betracht, war es doch im Zuge seiner Wiederentdeckung zum Inbegriff heimischer Heldenepik aufgewertet worden und damit für eine Jiddistik, die sich dem Nachweis nationaler Zugehörigkeit verpflichtet fühlte, fast unumgehbar.7 So ist es kein Zufall, dass ein von Felix Falk Die im vorliegenden Beitrag für das Ältere Jiddisch gebrauchte Transkription lehnt sich an das Trierer System an, verzichtet jedoch auf Diakritika. 1 Röll 1978. 2 Timm 1985. 3 Caliebe 1980. 4 Baumgarten 2005 : 141 – 151. 5 Dreessen 1992. 6 Fuks 1961. 7 Vgl. z.B. die Einleitung von Landau ( 1912 : xxviii ). Noch bei Baumgarten ( 2005 : 140 – 155 ) wirkt mit der Bezugnahme auf das Nibelungenlied das » nationale « Konzept nach, jetzt un- 310 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ 1908 in den Mitteilungen zur jüdischen Volkskunde veröffentlichter Aufsatz über das Schmu ’ elbuch den Titel trägt : » Die Bücher Samuelis in deutschen Nibelungenstrophen des xv. Jahrhunderts « ; in der ein Jahr später in französischer Sprache veröffentlichten Separatfassung dieses Aufsatzes ist im Titel sogar nur noch von » strophes de Nibelungen « die Rede, der einschränkende Hinweis auf das fünfzehnte Jahrhundert also getilgt.8 Er ist aber, was dem Verfasser der Abhandlung sehr wohl bewusst war, alles andere als belanglos, denn die Nibelungenstrophe unterlag im Verlaufe der Überlieferungsgeschichte einer Veränderung und machte nicht in ihrer ursprünglichen, sondern in abgewandelter Gestalt Schule. Scheinbar betrifft die Abwandlung der Strophenform nur eine Kleinigkeit : Im letzten Abvers ist die Anzahl der Hebungen um eine verringert. Da nunmehr allen vier Langzeilen einer Strophe metrisch das gleiche Schema zu Grunde liegt, entfällt die charakteristische Schlussbeschwerung der ursprünglichen Nibelungenstrophe. Damit wird der weiteren formalen Entwicklung der Weg bereitet, durch Zäsurreime die Halbzeilen zu verselbständigen, aus den vier zäsurierten Langzeilen also acht Kurzzeilen und so aus der abgewandelten Nibelungenstrophe die » Heunenweise « bzw. das » Achtgesetz « zu machen, wie diese Form dann im jiddischen Joschua ( Krakau 1594 ) 9 genannt und ebenfalls in der Hamburger Megilas Ester 10 verwendet wird. Bei der metrischen Form des Schmu ’ elbuchs handelt es sich also um jene Abart der Nibelungenstrophe, die in der mittelhochdeutschen Literatur nach dem Jüngeren Hildebrandslied, dem wohl am weitesten verbreiteten Stück der Dietrichdichtung,11 als Hildebrandston bezeichnet wird und in zahlreichen weiteren Texten – nicht nur über Meister Hildebrand und Dietrich von Bern, sondern beispielsweise auch in der Jungsiegfried-Dichtung vom › Hürnen Seyfrid ‹ 12 – verwendet wurde. Der Hildebrandston entwickelte sich zur gängigsten Strophenform mittelhochdeutscher nachnibelungischer Heldendichtung überhaupt, und viel stärker an diese als an das Nibelungenlied selbst ist zu denken, wenn nach dem literarischen Umfeld des Schmu ’ elbuchs gefragt wird. Bei seinen Überlegungen zur Entstehungszeit des Schmu ’ elbuchs, das er in die zweite Hälfte des fünfzehnten Jahrhunderts datierte, ter umgekehrtem Vorzeichen : » The Shmuel-bukh itself is a challenge cast by Jewish poets at the Christian world and sets itself up as the Ashkenazic › national epic ‹ « ( Baumgarten 2005 : 147 ). 8 Vgl. Fuks 1961 ( i ) : x. 9 Timm 1983. 10 Dreessen 1987. 11 Curschmann 1983. 12 Brunner 1983. Wulf-Otto Dreessen : Dovid und Wolfdietrich 311 verwies Felix Falk auf die etwa gleichzeitige Dresdner HeldenbuchHandschrift,13 in der » Kaspar von der Rhön unter Benutzung vorhandener Überlieferungen die deutschen Heldenepen bearbeitete und ihnen eine andere Form gab. « 14 Falk fand in den » dem zeitgenössischen Geschmack angepaßten Umdichtungen der volksmäßigen Epen, die in den großen Sammelhandschriften des 15. Jahrhunderts aufgeschrieben, im Heldenbuch gegen 1480 erstmals gedruckt und dann vielfach nachgedruckt wurden, « Muster für die formale Gestaltung des Schmu ’ elbuchs : » Sprache, Stil und Metrik der jüngeren Fassungen des Nibelungenliedes, des Rosengarten und Wolfdietrich sowie der anderen Dietrichsepen « waren nach Falk dem Verfasser des Schmu ’ elbuchs » vollkommen vertraut ; sie boten ihm Werkzeuge, mit denen er seine Darstellung der biblischen Geschehnisse Zuhörern und Lesern anschaulich zu machen wußte. « 15 Im Zusammenhang mit der Strophenform verwies Falk auf » die jüngeren Bearbeitungen des Rosengarten und verschiedene Fassungen des Wolfdietrich, auch Ortnit und Alpharts Tod « 16 und verglich entsprechende Teile des Schmu ’ elbuchs mit » den Kampfszenen zwischen Dietrichhelden und Parteigängern Sigfrids, den Zwölfkämpfen in den Gedichten vom Rosengarten oder den Schlachtberichten im Wolfdietrich, mit den Drachenkämpfen Sigfrids und Dietrichs, den Wurmkämpfen im Ortnit «.17 Falk fand » einzelne von den in diese Schilderungen verwobenen Vorgänge( n ) auf die Kämpfe der Israeliten mit den Philistern, auf Davids Kampf mit Goliath, seine Abenteuer mit Löwen und Bären und auf die Taten seiner Heldenschar übertragen « ; 18 allerdings erweist sich bei näherem Hinsehen, dass der Dovid des Schmu ’ elbuchs nirgends gegen Drachen oder Lindwürmer kämpft. Falk war sich offenbar der Vagheit seiner Angaben bewusst, rechtfertigte sich aber durch den Hinweis : » Da der Stil dieser deutschen Epik eine allen Gedichten gemeinsame Art besitzt, läßt es sich kaum feststellen, welche bestimmte Dichtung dem Verfasser ( des Schmu ’ elbuchs ) vorgelegen haben mag. Indessen können wir wohl annehmen, dass er mit Vorliebe die Gedichte vom Rosengarten, den Wolfdietrich und das Nibelungenlied benutzt hat, Werke, die in allen Landschaften der oberdeutschen Heimat des Dichters sich großer Beliebtheit und Verbreitung erfreuten. Die beiden letzteren mögen ihm vielleicht in jüngeren Bearbeitungen bekannt gewesen sein, wie sie uns etwa durch 13 14 15 16 17 18 Kofler 2006 ; Heinzle 1981 ; Heinzle 1981 / 1987 ; Kornrumpf 1984. Falk in Fuks 1961 ( i ) : 7, 11. Falk in Fuks 1961 ( ii ) : 114. Ibid. : 115. Ibid. : 115 f. Ibid. : 116 ; vgl. Dreessen 2002 : 373 – 379. 312 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ die Piaristenhandschrift überliefert sind. « 19 Falk meinte also auf eine ganze Gruppe von Texten Bezug nehmen zu müssen, obwohl er gern bestimmte einzelne als Anreger des Schmu ’ elbuchs namhaft gemacht hätte. Mosche Esrim Wearba, der unbekannte vermeintliche Verfasser des Schmu ’ elbuchs, war für Falk entsprechend seinem Beinamen jemand, der » nicht blos › Esrim Wearba ‹, das heißt die vierundzwanzig Bücher der Heiligen Schrift kannte, sondern auch die rabbinische Literatur beherrschte und zudem im deutschen Volksepos heimisch war «.20 Einen weiterführenden Hinweis liefert möglicherweise eine der Listen, die Mantuaner Juden im Jahre 1595 für die kirchliche Zensur über ihre Bücherbestände anfertigen mussten : 21 Dort wird eine » istoria nikress [ genannt ] wolf titreich bilschon aschcenas cossev jad [ in aschkenasischer Sprache handgeschrieben ] « verzeichnet, also die jiddische Handschrift einer Großerzählung, die im späten Mittelalter und in der frühen Neuzeit in mehreren Fassungen sehr weit verbreitet war.22 Trotz Falks Hinweisen im Zusammenhang mit dem Schmu ’ elbuch wurde sie bislang wenig beachtet, obwohl auch der Wolfdietrich die Strophenform des Hildebrandstons hat. Als großes Motivsammelbecken ( besonders Fassung D, der Große Wolfdietrich ) 23 verdient er im Blick auf die Frage, woher das Schmu ’ elbuch seine Anregungen empĳing, größere Aufmerksamkeit, nachdem durch die Mantuaner Notiz gesichert ist, dass es auch eine jüdische Rezeption des Wolfdietrich gegeben hat. Dabei muss nicht zwingend davon ausgegangen werden, dass die der Zensur in Mantua gemeldete Handschrift eine durchgängig eigenständige Bearbeitung des Wolfdietrich enthielt. Es ist ebenso gut möglich, dass es sich hier über weite Strecken um die Umsetzung einer mittelhochdeutschen Vorlage in hebräische Schrift gehandelt hat. Wir haben ein – allerdings jüngeres – Zeugnis dafür, dass jüdische Liebhaber deutscher Heldendichtung sich derartige Transkriptionen anfertigen ließen : Im Vorwort seines 1649 in Amsterdam erschienenen Nei ’ lid ouf der megile bemerkt Gumprecht Levi : 24 derweil ich etliche jungen un ' maidlich hab sehen laufen un ' haben galhess [ » mönchische «, d. h. lateinschriftliche ] bicher tun kaufen un ' si haben bei ’ mir losen ous-schreiben ir zeit mit selche nibel pe [ Schmutzrede ] zu fer-treiben. 19 Ibid. : 1 ; Piaristenhandschrift : Wien cod. 15478, vgl. Heinzle 1981 : 951 f. 20 Falk in Fuks 1961 ( i ) : 6. 21 Shmeruk 1988 : 45, Anm. 51. Ferner : Turniansky und Timm 2003 : 163, Baruchson-Arbib 2001. 22 Dinkelacker 1989 und Dinkelacker 1999. 23 Kofler 2001 ; Kofler 2008. Zum › Wolfdietrich D ‹ jüngst Reich 2011 : 231 – 299. 24 Dreessen 2002 : 384. Wulf-Otto Dreessen : Dovid und Wolfdietrich 313 Der 1597 erschienene Krakauer Sigenot-Druck von Jizchok ben Ahron Prosnitz gehört wohl in einen ähnlichen Zusammenhang, ebenso wie auch das bereits erwähnte Jüngere Hildebrandslied,25 das in hebräischer Schrift überliefert ist durch zwei Handschriften aus der zweiten Hälfte des sechzehnten Jahrhunderts, denen nach der Vermutung ihres Herausgebers » ein gedruckter Text in deutscher Sprache als Vorlage gedient « haben könnte.26 Auch im Krakauer Sigenot heißt es am Schluss, das lid sei ous-genumen fun galhess un ' ouf judesch verteischt,27 also nach einer lateinschriftlichen Vorlage ins Jiddische umgesetzt worden. Zumindest also die Bestseller dieses literarischen Genres, Jüngeres Hildebrandslied, Sigenot 28 und Wolfdietrich, haben auch jüdisches Publikum erreicht. Der Wolfdietrich ist mittelhochdeutsch gewöhnlich zusammen mit dem – auch von Falk schon erwähnten – Ortnit überliefert. Die beiden Erzählungen sind inhaltlich dadurch miteinander verzahnt, dass Wolfdietrich sich mit dem in » Lamparten «, der Lombardei, herrschenden Ortnit verbündet und später dessen Witwe heiratet. Möglicherweise enthielt auch die Vorlage des Mantuaner cessav jad bilschon aschcenas im Verbund mit dem Wolfdietrich den Ortnit. In diesem Zusammenhang mag erwähnenswert sein, dass beide an einem international verbreiteten Erzählmodell partizipieren, das besonders für die mittelhochdeutsche Epik wichtig wurde, nämlich der › gefährlichen Brautwerbung ‹.29 Wie der Dukus Horant belegt, in dem nicht nur Kudrun oder König Rother, sondern eben auch Ortnit und Wolfdietrich mit motivischen Parallelen anklingen,30 griffen jüdische Rezipienten dieses Modell schon im vierzehnten Jahrhundert auf. Im gedruckten Heldenbuch folgen auf den Ortnit-WolfdietrichKomplex der Wormser Rosengarten und der Laurin ( › Kleiner ‹ und › Großer ‹ Rosengarten ). Offenbar konnte diese Heldenbuch-Sammlung, die zuerst 1479 in Straßburg bei Johann Prüß d. Ä. gedruckt, danach 1491 in Augsburg, 1509 in Hagenau, 1545 wiederum in Augsburg und 1560 sowie zuletzt 1590 in Frankfurt am Main erneut aufgelegt wurde,31 im Ganzen als ein › Wolfdietrich ‹ bezeichnet werden ; auf der ersten Seite des Straßburger Drucks heißt es : » Hie fahet an der helden buch das man nennet den Wolfdieterich. « 32 Auch die handschriftlichen Helden25 26 27 28 29 30 31 32 Dreessen 2002 : 383. Lockwood 1963 : 434. Howard 1986 : 102 f. Heinzle 1992. Einen Überblick bietet Bräuer 1970 ; vgl. Schmid-Cadalbert 1985. Caliebe 1973 : [ Register ]. Heinzle 1999 : 41 – 45 ; Heinzle 1987 : 207. Schulz-Grobert 2003 – 2004 : 198 f. Heinzle 1999 : 44. 314 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ bücher, darunter die beiden bereits von Falk erwähnten – das Dresdner Heldenbuch Kaspars von der Rhön, abgeschlossen 1472, und die Piaristenhandschrift, Linhart Scheubels Heldenbuch, geschrieben um 1480 / 90 – enthalten regelmäßig im ersten Teil den Ortnit-WolfdietrichVerbund. Dieser ist » einer der großen literarischen Erfolge des Spätmittelalters «,33 und deshalb lässt sich annehmen, dass die Titelgebung des gedruckten Heldenbuchs auf eine bereits geläuĳige Bezeichnung solcher Sammlungen von Heldendichtung zurückgeht. Bei der der Mantuaner Zensur gemeldeten jiddischen Handschrift dürfte es sich eher um eine Transkription von Teilen oder des ganzen gedruckten Heldenbuchs als eines seiner handschriftlichen Vorläufer gehandelt haben. Als die jiddische Handschrift 1595 in das für die Mantuaner Zensur bestimmte Verzeichnis aufgenommen wurde, war sie möglicherweise schon alt ; sie muss nicht einmal in Italien geschrieben, sondern könnte dorthin mitgebracht worden sein. Sollte das Schmu ’ elbuch bereits vor dem Erstdruck des Heldenbuchs entstanden sein, müssten handschriftliche Heldenbücher als Anreger in Betracht gezogen werden. Rund die Hälfte aller Zeugnisse mittelhochdeutscher Heldendichtung, darunter fast sämtliche › Heldenbücher ‹, stammen aus dem mutmaßlichen Zeitraum der Entstehung des Schmu ’ elbuchs.34 Das älteste bekannte Heldenbuch ist eine aufwendige rheinfränkische Handschrift aus der ersten Hälfte des 14. Jahrhunderts [ … ] Es ist anzunehmen, daß man das ganze 14. und 15. Jahrhundert hindurch Sammlungen dieser Art zusammengestellt hat, doch stammen die nächsten erhaltenen Exemplare erst aus dem letzten Drittel des 15. Jahrhunderts. Demnach herrschten im späten fünfzehnten Jahrhundert günstige Voraussetzungen für eine jüdische Heldenbuch-Rezeption. Nimmt man Italien als Entstehungsgebiet des Schmu ’ elbuchs an,35 obwohl es inhaltlich kaum Spuren italienischer Verhältnisse und sprachlich noch keine Italianismen enthält, müsste es an den Anfang der italo-aschkenasischen Literatur gehören, also ins letzte Viertel des fünfzehnten Jahrhunderts. In der jiddischen Literatur des sechzehnten Jahrhunderts begegnen allenthalben Erwähnungen Dietrichs von Bern, oft im Zusammenhang frommer Polemik gegen verwerflichen Lesestoff, aber auch als Berufung auf ein literarisches Vorbild. Manche dieser Erwähnungen 33 Heinzle 1999 : 42. 34 Ibid. : 43 f. 35 Turniansky / Timm 2003 : 12. Wulf-Otto Dreessen : Dovid und Wolfdietrich 315 weisen ebenso wie die Mantuaner Wolfdietrich-Notiz von 1595 nach Oberitalien.36 Dabei mag auch eine Rolle spielen, dass ein erheblicher Teil der Handlungsschauplätze des Ortnit und Wolfdietrich wie auch der übrigen Dietrichdichtung in Oberitalien liegt.37 Im Blick auf das Schmu ’ elbuch ist zudem erwähnenswert, dass zumindest die eine seiner beiden Haupthandschriften in Italien entstanden ist.38 Falks oben zitierte Annahme, der Verfasser des Schmu ’ elbuchs sei im hauptsächlichen Verbreitungsgebiet der mittelhochdeutschen Heldendichtung beheimatet gewesen, darf vielleicht dahingehend verfeinert werden, dass der Schmu ’ elbuch-Autor zwar aus Oberdeutschland stammen mag, aber keineswegs dort gelebt und gearbeitet haben muss, sondern wie etwa der Schreiber der Hamburger Schmu ’ elbuch-Handschrift, wie Anschel Levi,39 wie Elia Levita und viele andere aus seiner deutschen Heimatregion nach Oberitalien abgewandert sein könnte. Sollte er sich seine Kenntnisse mittelhochdeutscher Heldendichtung schon in seinem Herkunftsgebiet angeeignet haben, konnte er in Oberitalien durchaus etwas damit anfangen. Es erscheint aber auch nicht undenkbar, dass er erst dort jenen intensiven Kontakt mit dieser Literatur und dortigen jüdischen Rezipienten erfuhr, der dann schließlich ein Werk wie das Schmu ’ elbuch entstehen lassen konnte. Zu dessen möglicher Abfassung in Italien 40 würde passen, dass das Schmu ’ elbuch eben dort im sechzehnten Jahrhundert Schule machte, wie beispielsweise Schoftim und Joschua sowie eine italienische Handschrift des Melochimbuchs belegen können.41 Das Schmu ’ elbuch wie der Wolfdietrich erzählen Gründergeschichten : Sowohl die Gestalt Dovids als auch die Wolfdietrichs gewinnen einen beachtlichen Teil ihrer Bedeutung im Blick auf ihre überragenden Nachfahren Schlomo beziehungsweise Dietrich von Bern. Sie ähneln einander aber ebenso darin, dass Dovid wie Wolfdietrich Vorläufer hatten, Scho ’ ul ( Saul ) bzw. Ortnit, die in auffälliger Ambivalenz einerseits als starke Kämpfer, anderseits als ruinöse Herrscher dargestellt sind. Zu den strukturellen Parallelen beider Erzählungen kann schließlich noch gezählt werden, dass Dovid ebenso wie Wolfdietrich von der Möglichkeit, zu dem ihm bestimmten Königtum zu gelangen, lange geradezu aussichtslos weit entfernt gehalten wird und immer wieder die verschiedensten Rückschläge erfahren muss, ehe er doch noch ans Ziel gelangen darf. 36 37 38 39 40 41 Dreessen 2002 : 384 f. Beispielhaft sei daran erinnert, dass es sich bei Dietrichs Bern um Verona handelt. Turniansky / Timm 2003 : 12 f. Maitlis 1978. Turniansky in Turniansky / Timm 2003 : 191 – 196, hier 194. Timm 1983 ; Timm 1992 ; Turniansky / Timm 2003 : 14 – 19. 316 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Möglicherweise waren es also nicht in erster Linie formale und stilistische, sondern thematische Anregungen, die von mittelhochdeutscher Heldendichtung für die entsprechende Gestaltung des biblischen Stoffes im Schmu ’ elbuch ausgingen. Dies gilt etwa für die Auseinandersetzung mit » Heiden «, die namentlich im Wolfdietrich eine wichtige Rolle spielt, hingegen in der Dietrichepik weniger hervortritt ; im Schmu ’ elbuch werden die Plischthim, Dovids hartnäckigste Gegner, bevorzugt haiden genannt. Nicht zuletzt bekommen es beide Helden immer wieder mit unbezwingbar erscheinenden Gegnern in Riesengestalt zu tun ; geradezu paradigmatisch steht am Anfang von Dovids Karriere sein Sieg über Goljoss ( Goliath ).42 Aber auch die verlässliche Mithilfe seiner Gefährten, denen Dovid ihre treuen Dienste selten vergisst, hat ihre Entsprechung in der für die Erzählung konstitutiven Dienstmannenmotivik des Wolfdietrich. Schließlich wäre auch noch ein Aspekt, der für Felix Falk kaum eine Rolle spielte und in seiner Belegsammlung 43 fast gänzlich fehlt, für einen Vergleich in Betracht zu ziehen : die Komik.44 In deutlichem Unterschied zu dem Heldentyp, den der Berner verkörpert, zeichnet sich Wolfdietrich durch große Gottesfurcht und stetigen himmlischen Beistand aus. Wolfdietrichs Schutzpatron ist der Heilige Georg, der keineswegs nur als Drachentöter, sondern vor allem auch als Heidenbekämpfer bekannt ist. Gegen Ende seines Lebensweges zieht sich Wolfdietrich in ein Georgs-Kloster zurück, nachdem er zugunsten seines Sohnes auf die Krone verzichtet hat. Der oder die Bearbeiter der jiddischen Wolfdietrich-Handschrift aus Mantua werden es mit diesem frommen Helden nicht ganz so einfach gehabt haben, wie es der Krakauer Sigenot seinen Urhebern machte : Diese hatten nicht viel mehr zu tun, als die nicht sehr zahlreichen christlichen Phrasen in ihrer Textvorlage zu neutralisieren. Der Mantuaner Wolfdietrich konnte demgegenüber schwerlich ohne stellenweise einschneidende Änderungen auskommen. Nichtsdestoweniger könnte das Bild des Helden und Herrschers Dovid im Schmu ’ elbuch viel eher der Gestalt Wolfdietrichs als der Dietrichs von Bern nachmodelliert sein. Strophik und Sprachstil, Erzählstruktur, Thematik, Motivik und rezeptionsgeschichtliche Zeugnisse können die Vermutung stützen, dass es wesentlich der Wolfdietrich war, durch den in jüdischen Literaturkreisen ( Oberitaliens ? ) der Impuls entstand, nach diesem Modell eine volkssprachliche Nacherzählung der Überlieferung von der eigenen Vorzeit zu gestalten. 42 Dreessen 2002 : 374 – 379. 43 Falk in Fuks 1961 ( ii ) : 117 – 130. 44 Vgl. Coxon 2003. Wulf-Otto Dreessen : Dovid und Wolfdietrich 317 Dies machte Dovid nicht zu Wolfdietrichs Ebenbild. Es bedeutet lediglich, dass hier wie dort die gleichen gängigen Muster literarischer Verarbeitung und Darstellung verwendet wurden. Für die literarische Bearbeitung von › Vorzeitkunde ‹ werden niemals beliebige Mittel genutzt, sondern gewöhnlich traditionelle. Der Autor des Schmu ’ elbuchs hat sich also nicht, unter dem Eindruck eines großen Vorbildes, für eine gestalterische Technik › entschieden ‹, sondern er hat seinem Stoff die Sicht- und Gestaltungsweise aufgeprägt, die sich ihm seinerzeit als die › normale ‹ für entsprechende Darstellungen › aufdrängen ‹ musste. Zitierte Literatur : Baruchson-Arbib, Shifra, 2001 : La Culture livresque des juifs d ’ Italie à la ĳin de la Renaissance. Übers. v. Gabriel Roth. Paris : cnrs. Baumgarten, Jean, 2005 : Introduction to Old Yiddish Literature. Oxford : Oxford University Press. Bräuer, Rolf, 1970 : Literatursoziologie und epische Struktur der deutschen › Spielmanns- ‹ und Heldendichtung. Berlin : Akademie-Verlag. Brunner, Horst, 1983 : » Hürnen Seyfried «. In : Kurt Ruh, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 4. Berlin : de Gruyter, 317 – 326. Caliebe, Manfred, 1973 : Dukus Horant. Berlin : Erich Schmidt ( Philologische Studien und Quellen 70 ). – 1980 : » Dukus Horant «. In : Kurt Ruh, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 2. Berlin : de Gruyter, 239 – 243. Coxon, Sebastian, 2003 : » Komik und Gelächter in der › Wolfdietrich ‹-Epik. « In : 7. Pöchlarner Heldenliedgespräch. Wien : Fassbaender ( Philologica Germanica 25 ), 57 – 76. Curschmann, Michael, 1983 : » Jüngeres Hildebrandslied «. In : Kurt Ruh, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 4. Berlin : de Gruyter, 918 – 922. Dinkelacker, Wolfgang, 1989 : » Ortnit «. In : Kurt Ruh, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 7. Berlin : de Gruyter, 58 – 67. – 1999 : » Wolfdietrich «. In : Burghart Wachinger, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 10. Berlin : de Gruyter, 1309 – 1322. Dreessen, Wulf-Otto, 1987 : » Megilas Ester. « In : Kurt Ruh, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 6. Berlin : de Gruyter, 302 f. 318 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ – 1992 : » Schmuelbuch «. In : Kurt Ruh, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 8. Berlin : de Gruyter, 769 – 771. – 2002 : » Goliaths Schwestern und Brüder «. In : Jürgen Jaehrling, u. a., Hg., Röllwagenbüchlein. Festschrift für Walter Röll. Tübingen : Niemeyer, 369 – 389. Fuks, L [ ejb ], Hg., 1961 : Das Schemuelbuch des Mosche Esrim Wearba. 2 Bde. Band 1 : Einleitung [ von Felix Falk ] und Faksimile der editio princeps, Augsburg 1544. Band 2 : Textkritischer Apparat [ von Felix Falk ]. Assen : van Gorcum. Heinzle, Joachim, 1981 : » Heldenbücher «. In : Kurt Ruh, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 3. Berlin : de Gruyter, 947 – 956. – 1981 / 1987 : Heldenbuch. Nach dem ältesten Druck in Abbildung herausgegeben. 2 Bde. Göppingen : Kümmerle ( Litterae 75 / i, ii ). – 1992 : » Sigenot «. In : Kurt Ruh, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 8. Berlin : de Gruyter, 1236 – 1239. – 1999 : Einführung in die mittelhochdeutsche Dietrichepik. Berlin : de Gruyter. Howard, John A., Hg., 1986 : Dietrich von Bern ( 1597 ). Würzburg : Königshausen und Neumann. Kofler, Walter, Hg., 2001 : Ortnit und Wolfdietrich D. Stuttgart : Hirzel. – Hg., 2006 : Das Dresdener Heldenbuch und die Bruchstücke des Berlin-Wolfenbütteler Heldenbuchs. Stuttgart : Hirzel. – Hg., 2008 : Wolfdietrich B. Stuttgart : Hirzel. Kornrumpf, Gisela, 1984 : » Strophik im Zeitalter der Prosa : Deutsche Heldendichtung im ausgehenden Mittelalter «. In : Ludger Grenzmann u. a. Hg., Literatur und Laienbildung im Spätmittelalter und in der Reformationszeit. Stuttgart : Metzler, 316 – 340. Landau, Leo, Hg., 1912 : Arthurian Legends. Leipzig : Eduard Avenarius. Lockwood, W. B., 1963 : » Die Textgestalt des Jüngeren Hildebrandliedes in jüdisch-deutscher Sprache. « In : Beiträge zur Geschichte der deutschen Sprache und Literatur 85. Halle : Niemeyer, 433 – 447. Maitlis, Jakob J., Hg., 1978 : Anshel Levi, An Old Yiddish Midrash to the › Chapters of the Fathers ‹. Jerusalem : Israel Academy of Sciences and Humanities. Reich, Björn, 2011 : Name und maere. Heidelberg : Winter. Röll, Walter, 1978 : » Cambridger Handschrift von 1382 / 1383. « In : Kurt Ruh, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 1. Berlin : de Gruyter, 1169 f. Schmid-Cadalbert, Christian, 1985 : Der › Ortnit AW ‹ als Brautwerbungsdichtung. Bern : Francke. Wulf-Otto Dreessen : Dovid und Wolfdietrich 319 Schulz-Grobert, Jürgen, 2003 – 2004 : » Zum Druckbild eines frühneuzeitlichen Bestsellers. « In : Jahrbuch der Oswald-von-Wolkenstein-Gesellschaft 14: 189 – 202. Shmeruk, Chone, 1988 : Prokim fun der yidisher literatur-geshikhte. TelAviv : Y. L. Perets. Timm, Erika, 1983 : » Jehoschua «. In : Kurt Ruh, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 4. Berlin : de Gruyter, 511. – 1985 : » Löwenfabel «. In : Kurt Ruh, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 5. Berlin : de Gruyter, 923 – 925. – 1992 : » Schoftim «. In : Kurt Ruh, Hg., Die deutsche Literatur des Mittelalters. Verfasserlexikon. 2. Aufl. Bd. 8. Berlin : de Gruyter, 814 f. Turniansky, Chava und Timm, Erika, 2003 : Yiddish in Italia. Milano : Associazione Italiana Amici dell ’ Università di Gerusalemme. Diana Matut What Happened in Hamburg… A Yiddish Document about Polish Jews in Germany during the Early Modern Period 1. Introduction In 1675, David de Castro Tartas 1 printed A Beautiful New Song : What Happened in Hamburg ( ‫ וואש צו האמבורג איז גישעהן‬/ ‫ איין שין נייא ליד‬Ain schėn nei ’ lid / waś zu Hamburg is gėschehe̍n ). Two identical copies of this text survive which is a rare occurrence for an Old Yiddish print. Today, one is to be found in the Bodleian Library, Oxford,2 the other in the Bibliotheca Rosenthaliana, Amsterdam.3 The main story-line is quickly told : a Polish Jew ( named Yoyne/ Jonah ) has taken up residence in Hamburg, where he has married a second woman ( Fraydkhen ) without being divorced. His ĳirst wife in Poland ( unnamed ) therefore effectively remains an agune.4 When she hears about his whereabouts from ‘ travelling people, ’ she leaves her home and turns to her brother in Amsterdam for help. Together they travel via Friesland to Hamburg, where Yoyne is brought before a beysdin ( ‫ בית ־ דין‬, rabbinical court ) by his brother-in-law. The beys-din rules that until it is clear to which wife he is supposed to hand a get ( divorce ), he is to live alone, a judgment Yoyne does not obey. Therefore, his ĳirst wife appeals to the members of the ( Christian ) city council. He is arrested and spends time in prison while Fraydkhen gives birth to his child. Finally, after he almost perishes in jail, Yoyne ’ s ĳirst wife has pity on him and pleads for his release. Subsequently, he is set free and driven out of Hamburg together with Fraydkhen, handing his ĳirst wife the get before he has to leave. 1 David de Castro Tartas lived as a printer of Hebrew and Yiddish books in Amsterdam, where the family had arrived as Marranos in 1640. His career lasted from 1662 to 1695 and encompassed the printing of 66 ( known ) books and pamphlets, but more may have been published that are now lost ; see http://www.brown.edu/Facilities/John_Carter_Brown_Library/judaica/pages/brazil.html ( under no. 48. Mishnah [ Amsterdam : David de Castro Tartas, 1685 – 1687 ] ; last accessed February 25th, 2012 ). 2 Sign. Opp. 8° 1120 ( B ) ( 4 fol. ) ; Catalogue entries : Steinschneider 1848 : nos. 105 und 172 ( there with a wrong date [ 1695 ], identiĳied by himself as a typographical error [ Steinschneider 1852 – 1860 : no. 3636 ] ) ; Steinschneider 1852 – 1860 : nos. 3636 & 5646 ; Cowley 1929 : see entry Ezekiel b. Zechariah. 3 Gutschow 2007 : no. 63 ( with further references ). 4 According to Jewish religious law, a woman whose husband has vanished ( for whatever reason ) remains in a situation where she is unable to marry again. 322 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ The song ’ s narrative is, of course, much more complex ( see the edition provided here ) and gives an insight into various aspects of Ashkenazi life in the Early Modern Period – such as the pursuit of legal cases, the status and situation of Jews in Hamburg-Altona, common ways and means of travelling, and so forth – that are historically plausible and sound ( see below ). 2. The Author In verse 33 . 6 of the Beautiful New Song the author mentions himself as Jeḥask ’el ben haḥov̄ er rabi Secharie̱ der schreibėr ( ‫יחזקאל בן החר רבי‬ ‫ז ריה דער שרייביר‬, Ezekiel, son of the learned fellow Rabbi Zechariah, the scribe ). Weinreich already notes that nothing is known about Ezekiel b. Zechariah,5 but his title and self-description reveal a few facts. The attribute “ the scribe ” ( if it does indeed refer to his own profession and not that of his father ) already brings him close to the world of song. Ashkenazi customers would often seek the assistance of professional scribes to have songs they liked written or copied in order to remember and perform them. Sometimes they would buy – for instance in a printing shop, a booth or via a book-peddler – a songtext in Latin script, bring it to a Jewish scribe and have it transcribed into Yiddish letters so as to be able to read it. We know of this through the complaints of scribes and authors who were unhappy about their task and the “ inĳiltration ” of the Ashkenazi world by supposedly non-pious song material.6 It may well be that, as a scribe, Ezekiel had some experience with songs describing historical events – maybe Jewish, but very likely nonJewish ones, too. Somehow, Ezekiel must have acquired knowledge about life in Hamburg-Altona, since his account of the structure of the community, the juridical system – the beys-din, the city council, the special Hamburg-Altona relationship, and so forth – seem to reflect a certain amount of insight. Whether he ever lived there himself or simply had well-informed accounts at his disposal is difĳicult to judge. 5 Weinreich 1928 : 261 – 265, here 265. 6 See for instance the title page of Ephraim bar Judah Halevi ’ s ( Gumprecht Levi ) and his ‫ ( איין נייא ליד אויף דער מגילה‬A new Song on the megile ) ( Amsterdam : Judah ben Mordechai & partners, 1649 ), now in the Rosenthaliana ( Amsterdam ). See Gutschow 2007 : 14 ; Shmeruk 1979 : 135 ; Baumgarten 2005 : 155 f. Diana Matut : What Happened in Hamburg… 323 3. The Genre The title – A Beautiful New Song – already clearly refers to the genre this text belongs to, and is further supported by indication of a melody ( see 4. ) : this is one of the many Early Modern Yiddish songs ( to be speciĳied below ) that were printed alone or together with one, sometimes two other texts in a pamphlet and then sold relatively cheaply to Ashkenazi customers. It was published in Amsterdam, one of the major Yiddish printing centers of the time, from which many a song made its way into the East or South. A title like “ Beautiful New Song ” was by no means exceptional. “ Beautiful ” does not hint at a song being particularly ‘ nice ’ or pleasant in terms of its content or style ; it was a standard phrase, used in the hope of making a work more attractive to potential customers. “ New, ” on the other hand, did in fact usually ( but not always ) refer to a recently written or published work, either containing new information or presenting an old theme clothed in a new garb. As Walter Salmen wrote about the ‘ new song ’ of the Early Modern Period : 7 It is remarkable that since the days of the troubadours and minnesingers the literarily documented offer to create ‘ niuwez [ ze ] singen ’ ( Wolfram von Eschenbach ), ‘ newe Lieder ’ or ‘ chançons noveles ’ ( Messire Thibaut, Li Romanz de la Poire ) grew considerably [ … ]. An increasing demand for the ‘ new ’ in a song stimulated the market until during the 16th century huge numbers of distributed printed matters bore the advertising title ‘ …beautiful, new, secular song ’ that had become an established wording [ … ].8 Whether the incident rendered in these ‘ new songs ’ was indeed recent or from the distant past, it often had some connection to a real event. Thus, a link exists between the so called ‘ historical songs ’ and titles including the phrase ‘ new, ’ although, as said before, this is not an exclusive connection. Max Weinreich classiĳied A Beautiful New Song : What Happened in Hamburg as a “ news (paper) style account ” ( ‫בארי כט‬ ַ ‫צײטונגסמעסיקער‬ ַ ).9 Since it is indeed the rendering of a ( real or fake ) event, he is correct in his classiĳication. Weinreich does not, however, distinguish between ‫באריכט‬ ַ ( account ) and ‫ ( ליד‬song ). Furthermore, ‘ news (paper)-style ’ in 7 8 9 Salmen 1975 ( ii ) : 407 – 420. Ibid. : 408. Weinreich 1928 : 253. 324 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ a song would correspond to what in German is called a Zeitungslied ( ‘ news song ’ ). In terms of format and title, however, this category does not apply here. Rather, ‘ historical song, ’ as described in Shmeruk ’ s essay “ Yiddish ‘ Historical Songs ’ in Amsterdam in the 17th and 18th century. ” 10 – the rubric under which Chone Shmeruk classiĳied it – seems to ĳit this song best. 4. The Melody The melody to which a text was meant to be sung – as usual in Yiddish manuscripts and prints of the Early Modern Period – indicated by the term ‫ ( בניגון‬benigẹn ), meaning “ to the tune ( of ). ” This was standard procedure and – to the best of my knowledge – none of the Yiddish song-pamphlets that survive from the Early Modern Period contain direct musical notations.11 It was expensive and certainly difĳicult to add notes, an undertaking further discouraged by the fact that sight-reading music was not a common skill. One can therefore only speculate as to whether such booklets existed at all, and to ĳind an example would be a most spectacular discovery. For centuries the simple solution was thus to use a tune most people would already know and recognize, and write a new text to it – that is, to create a contrafact.12 Any contrafact must necessarily have the same number of lines per stanza as the original ; otherwise it would not ĳit the same melodic structure. In most cases, the rhyme-scheme is also preserved, and sometimes even the initial lines or rhyme-words are used for the contrafact ’ s text. In case of the Beautiful New Song the author ( or publisher ? ) indicated a well-known secular song, namely ‫איין מאלט דאש איך לושט ביקאם‬ ( Ain-molt, daś ich luśt bėkam Once when I had the desire ).13 This song was indeed famous during the seventeenth century ( but also later on ). Its beginning reads Einsmahls da ich lust bekam, anzusprechen eine Dam ( Once I had the desire to approach a lady ).14 It was ( supposedly ) writ10 Shmeruk 1984 : 153. 11 The ĳirst Yiddish print with musical notation is – to the best of my knowledge – the famous Simkhes hanefesh ( Delight of the Soul ) by Elḥanan Kirchhan ( vol. 1 : Frankfurt, 1707 ; vol. 2 : Fürth, 1727 ) ; musical notations in vol. 2 only. 12 It may also have been the case that printers or publishers, wishing to increase sales, simply chose a melody that ĳitted the text, either because the author had given no indication or because the melody given was not known in the area. Since it was not unusual to sing a song with different melodies, this procedure is conceivable as well. 13 On the title page, see the edition below. 14 Quoted from the Venus-Gaertlein : Oder Viel Schoene / außerlesene Weltliche Lie=der / allen zechtigen Jungfrawen vnd Jungen=Gesellen zu Ehren… ( Hamburg : Georg Papen, 1659 ), Diana Matut : What Happened in Hamburg… 325 ten by Gabriel Voigtländer, a Danish court trumpeter, originally from Sorau ( now in Poland ). Voigtländer mentions the melody in the preface to his Erster Theil Allerhand Oden vnd Lieder ( Lübeck : Volck, 1650 ), but unfortunately did not include it in his collection.15 The song itself, though, must have been written before 1639, since during that year it had already appeared as an indication for a tune.16 From then on it was published continually – either directly with its full text or mentioned as a melody.17 The Jewish community obviously knew it as well, since there exists a contrafact in Yiddish letters, called Ainėś-mol, da̍ ś ich luśt bėkam zu frei ’ẹn aine̍n junge̍n ma̍ n ( Once I had the desire to court a young man ) which became part of the so called Wallich Manuscript – among other things a collection of Yiddish and German songs – which was probably compiled over a period around and after 1600.18 Most of the time, the existence of contrafacts is an indication of the popularity of a song. In the case of this melody, not only secular, but also religious contrafacts exist, for instance the Ein schön newes/ Geistliches Lied. / Das Geistlich : Eins male ich lust / bekam, genandt. / Eins mals ich lust bekam, anzuspre- / chen GOttes Sohn which was printed continually between 1638 and 1670 by Christoff Schmidt in Augsburg. Thus, all in all, three contrafacts are known for Einsmahls da ich lust bekam, anzusprechen eine Dam ( Once I had the desire to approach a lady ) : The Ainėś-mol, da̍ ś ich luśt bėkam zu frei ’ẹn aine̍n junge̍n ma̍ n ( Once I had the desire to court a young man ) of the “ Wallich Manuscript, ” Einsmals ich lust bekam, anzusprechen Gottes Sohn ( Once I had the desire to approach God ’ s son ), and last not least our Ain schėn nei ’ lid / waś zu Hamburg is gėschehe̍n ( A Beautiful New Song : What Happened in Hamburg ), two of which have come down to us in Yiddish letters.19 no. 59. Clemens Brentano and Achim von Arnim called it Des guten Kerls Freierey ( The Good Lad ’ s Courtship ), but this title is artiĳicial. See Rölleke 1979 ( V ) : 94 – 97. There with the incipit Einstens, da ich Lust bekam / Mir zu freien eine Dam ( Once I had the desire to court a lady ). 15 See Müller 1928 : 182 and Holzapfel 2006 ( i ) : 428 f. 16 Brockmann 1639 ; see also Holzapfel 2006 ( i ) : 428. 17 Brockmann 1639 ; Vierdanck 1641 ; Zwey schöne newe weltliche Lieder / Das Erste Als ich einmal Lust bekam / anzusprechen eine Dam… 1646 ; Drey Weltliche Newe Lieder : Das Erste, Einßmahls da ich Lust bekam, anzusprechen… 1647 ; Neukrantz 1650 : 23 ; Venus-Gaertlein 1659 : no. 59. 18 See Rosenberg 1888 – 1889 : 251 ; Weinreich 1928 : 261 f, and Matut 2011 ( ii ) : 133 f. 19 The following examples are taken from: Matut 2011 ( 1 ) : 22 – 73 ( ainėś mol, da̍ ś ich luśt bėkam ) and Waldberg 1890 : 109 – 111 ( Einsmahls, da ich lust bekam ). 326 a a b c c b ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ hert mir zu ir libė leit waś sich hot far-lafėn zu dise̍r zeit waś zu Hamburg is geschehe̍n es is gėkume̍n ous Pole̍n ain bėse̍r man der do hot gar ĳil ma‘ aśim ro‘ im gėton das hot got nit lengėr kenėn zu sehe̍n ainėś mol, da̍ ś ich luśt bėkam zu frei ’ẹn aine̍n junge̍n ma̍ n – ainė fru ’ zu werėn, do ĳil eś mir asȯ ebėn ein, wa̍ ś var ain luśt ain jung-frau ’lein hot uf düse̍r erdėn. Einsmahls, da ich lust bekam anzusprechen eine Dam vnd sie freundlich fragte, ob ich ihr auch wol geĳiel, warlich nicht besonders viel sie gar spoetlich sagte. ( Source : Ain schėn nai ’ lid ) ( Source : Ms. Opp. add. 4o 136 ) ( Source : Venus-Gaertlein ) It is safe to assume that a chosen melody may have had various functions : it could certainly underline the content of a poem, thus enhancing its effect and creating a stronger emotional response. But it could surely also be used to create irony or satire, too, or allude to certain underlying, perhaps suppressed themes. In the case of the Beautiful New Song it seems as if the melody wasn ’t randomly chosen. The beginning of the ‘ original song ’ reads Einsmahls, da ich lust bekam, anzusprechen eine Dam ( Once I had the desire to approach a lady ) and is in most parts a monologue spoken by a man to his beloved, whom he wants to win for himself by describing his good, modest, honest character and way of life. Knowing this, we immediately understand the relationship with our Yiddish text, since in both cases a man has the desire to ‘ conquer ’ ladies. But whereas in Einsmahls, da ich lust bekam, anzusprechen eine Dam this is done with honor and decency resulting in a faithful marriage, the Jewish protagonist Yoyne has given in to immoral urges in order to gain sexual pleasures, abandoning his wife, marrying again without being divorced, and even contemplating taking a third wife. Whereas the text of Einsmahls, da ich lust bekam, anzusprechen eine Dam is well documented,20 no clear source is available as to its melody. As mentioned earlier, Voigtländer did not include it and other attempts to try and trace it by way of its contrafacts and various prints have so far led to nothing – but it might be only a matter of time until it is rediscovered. In 1928, though, Willibert Müller tried to reconstruct the original melodic material using the unison parts of Johann Vierdanck ’ s Capricci, Canzoni vnd Sonaten ( Rostock, 1641 ) in which one piece is entitled : Sonata, worin die Melodia des Liedes : Als ich einmahl Lust bekam / & enthalten / mit drey Tromboni vnd swey Cornetten ( Sonata, wherein the melody of the song : ‘ Once I had the desire ’ is contained with three trombones and two cornetti ).21 This undertaking seems justiĳied but it 20 See footnotes 18 and 19. 21 Müller 1928 : 182. Müller ’ s article is only one page long, but he does mention the Yiddish transcription of the song through Rosenberg ’ s work : Rosenberg 1888 – 1889 : 251. Diana Matut : What Happened in Hamburg… 327 leaves us in the dark as to whether Müller ’ s reconstruction does indeed bear a close resemblance to the original melody – is perhaps even identical with it – or not. Trying to sing the Beautiful New Song to Müller ’ s melody does prove difĳicult in terms of text distribution ( there are too many words in the Yiddish text ), but this does not necessarily speak against Müller. Many a contrafact suffers from the necessity of squeezing in more text than the original had, which is mostly achieved by dividing longer note values into halves or even smaller fractions. Ill. 1 : Müller ’ s ( 1928 : 182 ) reconstruction of the melody for Einsmahls, da ich lust bekam, anzusprechen eine Dam ( Once I had the desire to approach a lady ) 22 5. Historical Background & Sources 5 . 1 East European Jews in Germany during the 17th Century The development of the stereotype of the Ostjude is strongly associated with the 19th and especially the early 20th centuries.23 For decades, scholars viewed the westward migration of Eastern Jews as a phenomenon that suddenly brought together “ two segments of a once uniĳied Ashkenazic Jewry [ that ] had been driven into two distinctive and mutually exclusive camps by the time they met in the late nineteenth and early twentieth centuries. ” 24 Of course, the size and scope of 22 Reconstructed by using the unisono passages of Johann Vierdanck ’ s Capricci, Canzoni… 1641. 23 See, for instance, Wertheimer 1987 ; Aschheim 1982 ; Lowenstein 1997. 24 Wertheimer 1987 : 3. Wertheimer, trying to offer a nuanced and differentiated picture of Eastern Jews in Imperial Germany, also accounts for the help and hospitality they received from their German coreligionists, and the efforts that were made to ease their situation and to offer practical assistance. He also takes into account Shulvass ’ work on earlier migration ( see below ). 328 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ this migration, as well as its political, social and cultural implications, are unique. German and Eastern Jews did not, however, create their images of each other out of the blue. Rather, these images are part of a continuous othering that was already taking place in the Early Modern Period, as is evident in Yiddish sources from the 1600s to the Haskoleperiod and from there into the modern discourse.25 Underlying these sources is the historical fact, that Eastern Jews were moving into the German lands in signiĳicant numbers after 1648, a year which is of dual importance : On the one hand, it marked the beginnings of the Khmelnitsky massacres in the Polish-Lithuanian Commonwealth ( on the territory of modern-day Ukraine ) ; on the other it saw the signing of the Peace of Westphalia, which marked the end of the Thirty Years ’ War. Even before 1648, ( especially ) Polish Jews had made their way as merchants, teachers, rabbis, army provisioners, printers or beggars into the German-speaking lands, but after 1648 their number increased signiĳicantly. One of the ĳirst to recognize the importance of this early westward migration by Eastern Jews was Moses A. Shulvass. In his pathbraking From East to West (1971), he describes how the Drang nach Osten “ came to a standstill during the years 1648 – 1660, when Polish-Lithuanian Jewry suffered the great calamities of the Cossack massacres and the Muscovite-Swedish invasion ” and the “ drive west ” began.26 With it came, according to Shulvass,27 ( 1 ) the progressive decline and pauperization of the Polish commonwealth, and the perpetual persecutions of the Jews that resulted from them, and ( 2 ) the fact that during this period Western Europe began to develop into the political, economic, and cultural centre of the world. Therefore, Jews who succeeded in overcoming the formidable obstacles of settling in Western Europe were able to live under politically more secure and economically much more favorable conditions. The “ wandering Jews ” in particular remained a “ bizarre part of the Jewish population of the West until emancipation made it possible for 25 See for instance Weinreich 1929 : col. 537 – 553 ; Aptroot 2010 : 295 – 318 ; Geller 2012 : 357 – 368. For further bibliographical information, see 5.2. 26 Ibid. : 11. On the subject see also Fram 1997 : 6 – 10. 27 Ibid. : 15. This view has recently been challenged, for instance in works like Gershon D. Hundert ’ s Jews in Poland-Lithuania in the Eighteenth Century, which combats the image of the Eastern Jew after 1648 sinking into a state of constant political, religious and economic crisis, and emphasizes the Polish Jews ’ majority status in many towns, their “ indispensability to the national economy, ” the “ ramiĳied, extensive, and complex ” organization of Polish-Lithuanian Jewry, resulting in an image of the West as “ an empty void, ” an undesirable place ; see Hundert, 2004 : 236 – 239. Diana Matut : What Happened in Hamburg… 329 them to become citizens of their various cities and states. ” 28 As said before, many came to the West as merchants or as part of the professional intelligentsia, but a signiĳicant number of newcomers were either “ illegal ” Jews who sometimes worked for their richer German coreligionists, or joined the poorer strata of society as Betteljuden ( Jewish beggars ).29 There was even an entire “ genre ” of emigrant literature in Yiddish and Hebrew, offering practical aid for those intending to leave – two important publications were written by Jewish emigrants from Poland.30 All in all, the seventeenth century saw German Jewry being forced to care for and tend to their Eastern brethren, who came in unforeseeable numbers, needing housing and shelter, work and food, physical and spiritual care. Sometimes, though, they saw their hospitality abused through the indecent behavior of the newcomers, their inability to adapt to a new lifestyle, and their unwillingness to integrate in terms of clothing, language and general appearance.31 This led to situations where German Jews had to post bail to free their fellow Jews from jail, to provide for those who, for exmple, roamed the streets when they entered a town or were in need during the preparation for Jewish holidays, and even take care of children who were born in the new country to parents who didn ’t have the means to provide for them. Another such worry concerned the wives of Polish Jews who were left behind by their husbands, who vanished without a trace. Even before 1648 – in 1635 to be precise – the council of the Four Lands worried about the increase in agunes and decided to send special ofĳicials to the Germanies and Bohemia in order to track down men who had left their wives,32 a situation reflected in this song. Jonathan I. Israel is of the opinion that “ the signiĳicance of this Polish Jewish migration westwards during the mid-seventeenth century has in the past been absurdly exaggerated ” and that “ the majority of the Ashkenazi immigrants into the Dutch provinces and the Hamburg region in the 1650s and 1660s were ‘ High German ’ and not ‘ Polish ’ . ” 33 Since it is impossible to engage in a historical argument at this point, it might be enough to respond to the controversial views of Shulvass and Israel that the character of the Polish Jew did not make its way into the text by accident ( whether or not the song is based on a true story ). By the time “ Ezekiel, son of the learned fellow Rabbi Zechari28 Shulvass 1971 : 14. 29 Ibid. : 20 f ; 25 – 43. 30 Ibid. : 28 f. 31 Much could be said, of course, about the often problematic ‘ hospitality ’ of the German Jews, as is well reflected in Yiddish sources. 32 Shulvass 1971 : 22. 33 Israel 1985 : 135 . 330 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ah ” wrote his work, Polish Jews in Germany must have been a common enough phenomenon or were at least a sujet that was easily recognized by readers. However great or small the actual number of newcomers may have been, using a polak as protagonist meant that the audience associated certain stereotypes with it and maybe even had expectations about how the subject would be treated ( for this, see 5 . 2 ). All in all, A Beautiful New Song : What Happened in Hamburg seems to reflect a post-1648 situation, even if we have no other clear indication except the printing date. The same holds true for the factor of an increasing number of agunes, the ‘ fate ’ of one of whom ( whether real or imagined ) is depicted in the text. Furthermore, Yoyne, the protagonist of the song, has no clear source of income – how he spends his time and how he earns a living is unknown, but he seems to be no proper business man and certainly is no religious authority. Instead, he is marked by unruly and indecent social behavior. This image would ĳit a time when the poorer strata of Polish Jewish society were a factor within the Germanies, marking the reversal of a situation : Eastern Jews, for decades regarded ĳirst and foremost as learned and gladly brought into the German countries as teachers, rabbis, cantors, religious slaughterers and so forth, were now in the process of decline and pauperization, and had to migrate under completely different circumstances. 5 . 2 Yiddish Sources on the Relations between German and Polish Jews from the 16th and 17th century and ‘ A Beautiful New Song : What Happened in Hamburg ’ The Early Modern Period is a most fascinating time with regard to Ashkenazi consciousness. On the one hand – especially, but not only, after the expulsion from Spain and the influx of Sephardim into the Ashkenazic realm – a clear awareness of a cultural uniqueness and separation from ‘ other ’ Jewish traditions is evident. This self-awareness of ‘ Ashkenaz as Ashkenaz ’ seems to increase due to various cultural confrontations. At the same time, however, beside a pan-Ashkenazi consciousness, very strong local identities become apparent.34 Especially in popular culture, this growing rift lies at the basis of many a literary piece depicting Jewish characters from the various realms of the Ashkenazic world, among them not only German and Polish Jews,35 but also 34 This is why “ at least by the seventeenth century, if not earlier, one might speak of a ‘ Polak ’ in contradistinction to an ‘ Ashkenazic ’ Jew. The latter term, in other words, reverted in some measure to its earlier denotation of a Jew in German lands. Nevertheless, Ashkenazic Jewry by the seventeenth century was coterminous with those who spoke Yiddish in its various dialects and followed Mosheh Isserles ’ glosses to the Halakhic code, Shulḥan ‘ arukh ” ( Marcus 2008 : 79 ). A valuable article on the subject is Teller 2008. 35 What Steven E. Aschheim wrote about modern times partly holds true for the Early Modern period as well : “ It is important to recognize that the stereotyping was not limited Diana Matut : What Happened in Hamburg… 331 protagonists from Italy or Prague, for example. The various Ashkenazim are then characterized by various cultural aspects, encompassing many aspects of daily and religious life. Yiddish sources offer an almost unbroken stream of references as to these various images : one of the earliest is the Bovo d ’Antona ( composed in Padua 1507, ĳirst printed in Isny 1541 ) by Elye Bokher. In a tavern scene, Bovo pretends to be from Poland and is immediately confronted with Tirits ’ assessment of those who come from there : they only want to stuff themselves with food, and to woo and court ladies ; they are starving beggars, and this is the true reason why they leave their country.36 Around 1600 the Khazonim-shpil of the so-called Wallikh manuscript introduces a ‘ classical ’ Ashkenazic triad in form of an Ashkenaz ( meaning a ‘ German ’ ), a Polish, and an Italian Jewish cantor ( hence, Khazonim-shpil ), who are compared with respect to their eating habits. Since most of this Purim-shpil is lost, we do not know if and how the play elaborated further on their cultural differences. Choosing cantors as protagonists at least opens the possibility of them ‘ competing ’ musically, too.37 The most famous and elaborate literary example for the expression of a pre-Haskalah inner-Ashkenazic bias, though, was written in the second half of the 17th century ( maybe around 1675 – 1680 ). It is “ The Description of ( an ) Ashkenaz and ( a ) Polish Jew ” ( ‫די בשרייבונג‬ ‫ פון אשכנז אונ פאלק‬Di ba̍ schraibung fun Ašcenas un Pola̍ k ).38 Its title is somewhat misleading, since it features not only a German and a Polish Jew, but also a representative of Prague ’ s Jewry. The three argue most fervently about the merits and shortcomings of their respective cultures, thereby delving into almost every imaginable subject. In the piece, written in form of a dialogue, the protagonists debate about religious learning and observance ; intellectual capabilities ; virtues such as hospitality and moderation ; dress and appearance ; eating and drinking habits ; social behavior, marriage customs ( at what age and under what circumstances ) and married life, treatment of children, and so forth.39 to German Jewish conceptions of Eastern ghetto Jews. German Jews also had their particular place in the folklore and popular literature of East European Jewry. In many ways the respective East-West stereotypes were inverted images of each other. ” Aschheim 1982 : 249. 36 Already mentioned by Erik [ 1928 ] 1979 : 262f. See the edition by Rosenzweig 2007 : v. 518.1 – 5. I am indebted to Claudia Rosenzweig for ĳinding and sending me the concrete verse for Erik ’ s general reference. 37 For this play see, for instance, Shmeruk 1979 : 105 ; Shmeruk 1988 : 200 ; Butzer 2003 : 73 – 77 ; Aptroot 2010 : 298 – 300, Matut 2011 ( i ) : 452 – 454, ( ii ) : 379 – 383. 38 Opp. 8o 1061, Bodleian Library, Oxford. Originally, two copies of this text existed in the Bodleiana. When Max Weinreich visited, though, one was already missing and has not reappeared. 39 See Erik [ 1928 ] 1979 : 262 – 265 ; Weinreich 1929 : col. 537 – 553 ; Shulvass 1971 : 25 ; Low- 332 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Undoubtedly, this verbal dispute reflects a post-1648 situation, which is clear for text-immanent reasons as well, since the protagonists refer to the war( s ). When Max Weinreich edited Di ba̍ schraibung, he included a second text with a related theme called “ A Nice History about a Polish Jew ” ( Ain schėne̱ his̀torie fun ain Polak / ‫) איין שינה היסטאריע פון איין פאלק‬.40 Probably printed in Prague during the second half of the 18th century, this text is extremely relevant for A Beautiful New Song : What Happened in Hamburg, since it also tells the ‘ story ’ of a Polish Jew coming to Germany. He, too, is married, and in addition to that, he has debts. Therefore, he makes his way into the medine Ashkenaz ( ! ),41 where he marries a second wife and starts to have children with her. Since he can ’t stand children, he chooses to move on and the story continues with the two wives accusing him together and him being forced by the beys-din to give one of them a divorce. It is fascinating to have at least two texts from the 17th century that borrow the cliché of a Polish Jew who takes a second wife in Germany without being divorced, has children with her in the new country, is brought before a beys-din and is, all in all, a rather dubious character. As was said before, it is not by chance that this century brought forth such types and personages in Yiddish literature, since they reflect a speciĳic historical situation. It would be a commendable achievement to think further at this point and compare these images of Polish and German Jews to those in texts of the 18th century42 as well as later Haskole comedies and maybe even to the stereotype Ost- and Westjude of the 19th and 20th century. The question would be whether some of these earlier typologizations still resonate in the literature and images of later periods. 5 . 3 The Situation in Hamburg-Altona in the Late 17th Century : the Song and its Historical Reality Max Weinreich was convinced that a real historical event led to the composition of the text : ‫אקטישער‬$ ַ ‫האבן מיר געוויס צו טון מיט ַא‬ ָ ‫דא‬ ָ ‫„ אויך‬ ” ‫פּאסירונג‬ ַ . ( Here as well we are certainly dealing with a real event ).43 To start with the facts, one has to say that no legal case is known to us from 17th century Hamburg-Altona that would support the story of enstein 1997 : 73 f, fn. 1 ; Butzer 2003 : 73 f ; Aptroot 2010 : 298 – 300 ; Matut 2011 ( ii ) : 380 – 384 ; Geller 2012 : 357 – 368. 40 Sign. 1979.c.25, British Library, London ( 4 pages ; Octavo-format ). Weinreich 1929 : col. 551 – 554. 41 Weinreich 1929 : col 552. 42 For a very valuable overview, see Aptroot 2010 : 295 – 318. Further material will be made accessible by Berger ( forthcoming ). 43 Weinreich 1928 : 261. Diana Matut : What Happened in Hamburg… 333 our song ( or at least none has been found so far ). Neither the archives of the Senat ( city council, senate ) nor those of the Geistliches Ministerium ( clerical ministry ) contain any information about a Polish Jew being imprisoned for bigamy or on behalf of his ĳirst wife. Other legal case ĳiles from this century that could be relevant did not survive.44 It would have been fascinating to ĳind a true historical event to be the basis of this song. However, this does not influence its validity as ‘ historical source-material ’ for various reasons. First of all, the situation of Ashkenazi Jews during the Early Modern Period is well captured in the text : main centers of living play a role ( Poland – Amsterdam – Hamburg ) ; ways of travelling ( Amsterdam – Friesland – Hamburg – Altona ), the juridical system ( beys-din ; city council ) and the executive in Hamburg-Altona, women ’ s autonomy ( traveling alone ) and dependence ( on a relative ) are depicted and, last not least, a Polish Jew in Hamburg represents an underlying reality or at least a perception of reality as well ( see 5 . 1 and 5 . 2 ). Furthermore, as we ’ ve seen above, the image of Polish Jewry in the German-speaking lands became a topos or sujet laden with resentment during the Early Modern Period. As such, our song represents an important source for the development of Western Jewry ’ s view on their Eastern coreligionists. Therefore, the text is a true historical source, even if the actual case may never have happened. The conditions of Jewish life in Hamburg ( and Altona ) are especially well captured in the text for various reasons : ( 1 ) The general picture. According to Jonathan I. Israel, the 17th century was a time of “ stagnant or falling population in much or most of continental Europe, ” but the situation was different for the Jewish communities. There, one notices a “ rapid increase of numbers in almost all of the regions where they were permitted to live. ”45 And for Hamburg-Altona-Wandsbek he explicitly states : 46 44 I am deeply indebted to Jutta Braden, expert on Hamburg ’ s Jewish history of the 17th century, for this information ; ( Braden 2001 ). She told me, too, about the case of a Polish Jew being sentenced to pay a ĳinancial penalty in 1671 because he “ married his beloved. ” The name of this Polish Jew was Mos( he ) Salomon : “ 13. 5. 1671 : Mos. Salomon weil er sich gegenst dieser Stadt Verfassung midt seiner Liebsten copuliren Laßen ” ( ‘ 13th of May 1671 : Mos. Salomon because he married his beloved against the constitution of this city ’ ) ( Source : Staatsarchiv Hamburg, 332-1 i, Bestand Wedde i, 11 Band 1 [ Strafen ] ). However close the resemblance to our case might seem, we do not have enough information to verify a direct connection. 45 Israel 1985 : 134. 46 Ibid. : 135. The picture varied, of course. After 1650 hardly any Jews remained in Vienna ; the Jewish community in Prague suffered from the plague ( 1680 ) and the great ĳire ( 1689 ) ; Frankfurt recovered slowly, and around 1700 only 2000 Jews lived there. Lvov, Cracow and Lublin tended to stagnate in size, while Amsterdam grew, outstripping Prague and Rome. 334 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Figures are lacking for Hamburg-Altona-Wandsbek as a whole, but we do know that, in Hamburg proper around 1660, there were approximately 120 Sephardi and between 40 and 50 Ashkenazi families, giving a total of around 800 ; for the entire city, including Altona and Wandsbek, the combined Sephardi-Ashkenazi population had probably outstripped that of Frankfurt by 1700 to become the second-largest concentration of Jew in the Empire after Prague. ( 2 ) Ashkenazim in Hamburg. For decades, the Ashkenazi community in 17th-century Hamburg proper could develop only under the auspices of the Sefardim. Since 1610/11, Ashkenazim worked in the city and had non-permanent rights of residency – but only as servants and employees of their Spanish-Portuguese coreligionists.47 Without a proper permit, Ashkenazim were not allowed to stay in the city overnight and therefore had to return to their home places after work ( most commonly in the more liberal Danish-Holstein towns ). ( 3 ) Polish Jews and Hamburg. According to Shulvass, the year 1656 must have been extraordinary. He reports that in the fall of that year “ a number of refugees from Poland were staying within the vicinity of Hamburg. ” The Sephardim obviously helped them generously and provided boats for them to travel on, covering their travel expenses.48 Furthermore, when large groups of Polish Jews had to stop in Lübeck on their way to Altona in the same year, the Sephardim of Hamburg helped them immediately, too, and made an ofĳicial appeal so as to raise money. It is difĳicult to imagine how a person like Yoyne could gain a permanent right of residence in Hamburg proper given the city ’ s restrictive policy of admittance. ( 4 ) Communal Structure. At the time the song was printed, the towns of Hamburg, Altona and Wandsbek formed a so called Dreigemeinde ( Triple-community ) – abbreviated as ah ” u ( ‫ – ) אה ” ו‬but they shared a common beys-din with the majority of Jews living in Danish Altona. This explains why, in the song, “ Altona and Hamburg ” ( verse 14 . 5 ) knew all about the sorrows of Yoyne ’ s ĳirst wife : ĳirst of all, because people would bring the news with them from Hamburg to their hometown in Altona, and second, because Yoyne had to appear before a beys-din, which would have gathered in Altona, too. 47 Only a handfull of Ashkenazim lived in the city before that time. 48 Shulvass 1971 : 28. Diana Matut : What Happened in Hamburg… 335 ( 5 ) The role of the city council. Throughout the text, the city council or senate of Hamburg is depicted as extremely friendly towards the Jews. Not only is Yoyne ’ s ĳirst wife treated fairly and sympathetically – legal executive actions are even taken on her behalf – but also his second one, Fraydkhen, claims that she has a good relationship with the masters of the city ( which is of no use in this case, since she is in the wrong ). This reflects a historical situation. By all accounts, the city council of Hamburg seems to have been quite liberal and relatively welcoming towards a Jewish ( also an Ashkenazic Jewish ) settlement in town. Obviously, there was a substantial rift between their rather generous approach and the partly unfavorable one of the town ’ s citizens.49 Furthermore, it was not uncommon for a Jewish community or its members to appeal to a non-Jewish court or instance throughout the Early Modern Period. ( 6 ) The beys-din and the city council. Legal Affairs. In the story of the song, Yoyne ’ s ĳirst wife and her brother turn to a religious court in order to decide the situation. This was common procedure, since questions of family law belonged to the sphere of ‘ ecclesiastical ’ or ‘ Church law ’ ( they were part of the so-called Ceremonialsachen ) – in this case, to the Jewish religious law ( ‫) הלכה‬. From a legal point of view, Church law and Halakhah meant the same thing, namely that marriage and divorce cases were not part of secular, civil legislation, but subject to and part of religious discretionary competence.50 Especially for Altona, it is known that the competence of the beys-din reached quite far ( not only in terms of decisions but also in terms of geography : they ruled for Hamburg and all of Schleswig-Holstein ) and that their privileges were conĳirmed in 1680.51 With regard to the text at hand, we are left with several questions : Was it written shortly before it was printed ? Was its author a Western Jew or did he come from the East ? Is it a moralistic piece about agunes and a warning to Jewish men ? Is it simply part of a literature based on using Polish Jews as cliché or stereotype, or is it based on historical fact ? Is the unnamed ĳirst wife a real character or is she an embodied image of the ‫ ( אשת ־ חיל‬Woman of Valor ) ? At this point, there is no room to answer these questions, but hopefully our understanding of the text and its context will grow through the further ( re-)discovery of Yiddish sources as valuable and important documents of literary, social and political history. 49 For general information on the subject, see Braden 2001 and Grunwald 1904. 50 Gotzmann 2008 : 44 f, 53 – 56. 51 Ibid. : 54, 56. 336 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Ill. 2 : Title page of Opp. 8o 1120 ( B ), Bodleian Library, Oxford Diana Matut : What Happened in Hamburg… 337 ‫אײן שין נייא ליד‬ ‫וואש צו האמבורג איז גישעהן‬ · ‫וויא אייניר צו האמבורג האט איין הור גינומן‬ ‫רויא האט דאש גיהערט אונ׳‬$ ‫אונ׳ זיין ערשטי‬ ‫איז אויז פולן קומן ׃ וויא ער איר האט מוזן‬ ‫גט געבין · עש העט אין באלד גיקאשט זיין‬ ‫וס‬$‫חיות ת‬ ֿ ‫לעבין ׃ דען ער איז אויף דאש‬ ‫אר‬$ ‫רויא ניט‬$ ‫גיוועזין · העט דיא ערשטי‬ ‫אין גיבעטן ער העט ניט קענין גינעזין ׃ אונ׳‬ ‫ריידין‬$ ‫רויא‬$ ‫וויא ער איז מיט זייניר אנדרי‬ ‫דיא הור אויז האמבורג גיאגט · דאש זייא‬ ‫אר איין גיווישי ווארהייט גיזאגט ׃ זער‬$ ‫אייך‬ ‫שין דרינן צו לייאין אודר צו זינגן וויא עש איינים‬ ‫עלט · איר קענט עש קויפן אום‬$‫איטלים גי‬ ‫איין גירינג געלט ׃‬ ‫בניגון‬ ‫איין מאלט דאש איך לושט‬ · ‫ביקאם‬ ‫באמשטירדאם‬ ‫בבית דוד די קאשטרו‬ 1 2 ‫תארתאס יצ ״ ו‬ ‫שנת התל ״ ה לפ ״ ק‬ 1 ‫ ‘ ישמרהו צורו ויחיהו‬His rock and redeemer may protect him.’ 2 ‫ ‘ לפרט קטן‬minor era.’ [1] [2] [3] [4] [5] [6] [7] [8] [9] [ 10 ] [ 11 ] [ 12 ] [ 13 ] [ 14 ] [ 15 ] ain schėn nei ’ lid waś zu Hamburg is gėschehe̍n wi ’ ainėr zu Hamburg hot ain hur gėnume̍n · un` sein erśtė frau ’ hot daś gėhert un` is ous Pȯle̍n kume̍n : wi ’ er ir hot muse̍n get 1 gebėn · eś het in bald gėkośt sein lebėn : den er is ouf daś ḥajẹss 2 thofus̀ 3 gėwesėn · het di ’ erśtė frau ’ nit far in gėbete̍n er het nit kenėn gėnesėn : un` wi ’ er is mit seinėr ande̍rė frau ’ Fraidchėn di ’ hur ous Hamburg ge̍jagt · daś sei ’ eich far ain gėwiśė worhait gėsagt : ser schėn drine̍n zu lai ’ėn ode̍r zu singe̍n wi ’ eś ainėm itliche̍m gėfelt · ir kent eś kaufe̍n um ain gėring gelt : [ 16 ] benigẹn 4 [ 17 ] ain molt daś ich luśt [ 18 ] bėkam · [ 19 ] be ’Amśtėrdam [ 20 ] bebėss Dovid dė Kaśtrȯ [ 21 ] Tharthas̀ jaz``u [ 22 ] šnass ‫ התל ״ ה‬lepa``k 5 1 ‘ document of divorce.’ 2 ‘ life.’ 3 ‘ imprisoned.’ 4 ‘ in the melody ( tune ) ( of ).’ 5 ‘ The year 5435 minor era ’ ( = 1675 ). The formula “ minor era ” is usually used if the year is written without the thousands. In this case, however, the thousands are given, so the formula is unnecessary. 338 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ [ 2r ] bėss 52 [ 1 ] hert mir zu ir libė leit, waś sich hot far-lafėn zu dise̍r zeit, waś zu Hamburg is geschehe̍n : es is gėkume̍n ous Pȯle̍n ain bėse̍r man [ r. mon ], der do hot gar ĳil ma‘ eśim-ro‘ im 53 gėton, das hot got nit lengėr kenėn zu-sehe̍n. [ 2 ] Jȯne̱, jimaḥ-šemȯ,54 is er gėnant, in alė bėsė štik is er wȯl bėkant, ain hur hot er sich gėnume̍n. do daś di erśtė frau ’ hot worde̍n gėwar [ r. gėwor ], far grȯśė laid reis̀ėt si ’ sich ous irė hor, ken Amśtėrdam is si ’ gėkume̍n. [ 3 ] do ĳind di ’ gutė frau ’ ire̍n brude̍r do un` e̍rzėlt im, wi ’ ir der man hot gėton also. „ach got, waś sol ich armė frau ’ an-fangėn ?“ der brude̍r sagt : „du libė schwes̀te̍r mein, got der almechtig sol unsėr bei-štand sein ! sag mir, wi ’ hot eś her-gėgangėn ?“ [ 4 ] si ’ šprach : „du ’ libe̍r brude̍r mein, ȯ wė ’ gėschri ’e̍n di ’ grȯśė pein ! eś sein nun bei ’ etlichė jore̍n, daś er is gėzȯge̍n fun mir aweke̍n. ich hab in gėsucht in alėn ekėn ich hab gėmaine̍t er wer far-lorėn. [ 5 ] eś habe̍n mir abėr gėsagt di ’ leit, di ’ aso he̍rum-wandėrn alė zeit, daś er hot zu Hamburg ain hur gėnume̍n ! drum, mein libe̍r brude̍r, mein libś kind, zich mit mir noch Hamburg gėschwind, daś ich mecht bei ’ den hediẹt 55 kume̍n.“ [ 6 ] der brude̍r mit seinėr schwes̀te̍r, di ware̍n nit treg, si ’ machte̍n sich alė baidė ouf den weg. dorch Friś-land ware̍n si ’ noch Hamburg zihe̍n in frȯśt un` kelt un` hungėrś-nȯt, si ’ sein bald gėfrorėn tȯt, si ’ ferchte̍n sich, der hediẹt 56 mecht in e̍ntflihe̍n ! 52 Number ‘ two.’ 53 Pl. ‘ bad deeds.’ 54 ‘ May his name be obliterated,’ curse after a name is mentioned. Still to be found in modern Yiddish, see Niborski 1999 : ‫ימח שמו‬. 55 ‘ Plain, simple person,’ here with a negative connotation. Still used in modern Yiddish ; see Niborski 1999 : ‫ הדיוט‬hedyet. 56 See 5. 6. ‫‪Diana Matut : What Happened in Hamburg… 339‬‬ ‫‪2r‬‬ ‫] ‪[1‬‬ ‫ב‬ ‫הערט מיר צו איר ליבי לייט ·‬ ‫וואש זיך האט ‪$‬אר לא‪$‬ין צו דיזר צייט ׃‬ ‫וואש צו האמבורג איז גישעהן ·‬ ‫עש איז גיקומן אויז פולין איין ביזר מאן ·‬ ‫דער דא האט גאר ‪$‬יל מעשים רעים גיטאן ׃‬ ‫דאש האט גאט ניט לענגיר קענין צו זעהן ׃‬ ‫] ‪ [ 2‬יונה‬ ‫ימח שמו איז ער גינאנט ·‬ ‫אין אלי ביזי שטיק איז ער וואול ביקאנט ·‬ ‫איין הור האט ער זיך גינומן ·‬ ‫דא דאש דיא ערשטי פרויא האט ווארדן גיוואר ·‬ ‫‪$‬אר גרושי לייד רייסיט זיא זיך אויש אירי האר ·‬ ‫קען אמשטירדאם איז זיא גיקומן ׃‬ ‫] ‪ [ 3‬דא‬ ‫‪$‬ינד דיא גוטי ‪$‬רויא אירן ברודר דא ·‬ ‫אונ׳ ארצילט אים וויא איר דער מאן האט גיטאן אלזא ·‬ ‫אך גאט וואש זאל איך ארמי ‪$‬רויא אן ‪$‬אנגין ·‬ ‫דער ברודר זאגט דוא ליבי שוועסטר מיין ·‬ ‫גאט דער אלמעטיג זאל אונזיר ביי שטאנד זיין ·‬ ‫זאג מיר וויא האט עש הער גיגאנגין ׃‬ ‫] ‪[4‬‬ ‫זיא‬ ‫שפראך דוא ליבר ברודר מיין ·‬ ‫או וויא גישריאן דיא גרושי פיין ·‬ ‫עש זיין נון בייא עטליי יארן ·‬ ‫דאש ער איז גיצוגן פון מיר אוועקן ·‬ ‫איך האב אין גיזוט אין אלין עקין ·‬ ‫איך האב גימיינט ער ווער ‪$‬אר לארין ׃‬ ‫] ‪ [ 5‬עש‬ ‫האבן מיר אביר גיזאגט דיא לייט ·‬ ‫דיא אזא הרום וואנדירן אלי צייט ·‬ ‫דאש ער האט צו האמבורג איין הור גינומן ·‬ ‫דרום מיין ליבר ברודר מיין ליבש קינד ·‬ ‫ציך מיט מיר נאך האמבורג גישווינד ·‬ ‫דאש איך מעט בייא דען הדיוט קומן ׃‬ ‫] ‪ [ 6‬דער‬ ‫ברודר מיט זייניר שוועסטר דיא ווארן ניט טרעג ·‬ ‫זיא מאטן זיך אלי ביידי אויף דען וועג ·‬ ‫דארך ‪$‬ריש לאנד ווארן זיא נאך האמבורג ציהן ·‬ ‫אין ‪$‬רושט אונ׳ קעלט אונ׳ הונגירש נוט ·‬ ‫זיא זיין באלד גיפרארין טוט ·‬ ‫זיא ‪$‬ערטן זיך דער הדיוט מעט אין אנט‪$‬ליהן ׃‬ 340 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ [ R : ] do [ 2v ] [ 7 ] do Jȯne̱, jimaḥ-šemȯ,57 is daś worde̍n ine̍n, do hot er sich nit lang tun bėsine̍n, noch dem schwogėr tet er schike̍n : „šolẹm-‘ alėchem, ei, wu kumt ir her ? sagt mir dȯch epėś nei ’ė mer !“ far grȯśėr behole̱ 58 tet er bald der-štikėn. [ 8 ] der schwoge̍r sagt : „eś sein grȯśė ḥidušim 59 far-hande̍n, daś mir habe̍n gėhert in fremdė lande̍n ! drum sein mir her gėkume̍n. du ’ lȯsėr man, sag mir her : waś is dȯch mit dir der mer, daś du ’ hośt ain ande̍rė frau,’ un` der-zu ain hur gėnume̍n ? [ 9 ] bei ’ dein frum keśtlich weib ! du ’ hediẹt 60 biśt nit wert an-zu-rire̍n ire̍n leib ! an dir hediẹt is jȯ ’ zu-mol kain broche̱ ! 61 do hub der tomẽ 62 zu schrei ’ėn an : „eś is šeker-vecosev̄,63 ich bin nit ir man ! ich ken si ’ nit ȯde̍r ir mišpoḥe̱ !“ [ 10 ] do der schwogėr daś hot fun im gėhert, daś der hediẹt 64 sein erśtė frau ’ ganz zu far-laikėne̍n 65 bėgert, er šprach : „daś mus ich ande̍rśt mache̍n !“ ain bėss-din 66 lis̀ er sezėn ebėn, si ’ solte̍n ain mišpet 67 gebėn, as wi ’ do gėhert zu selchė sache̍n. 57 See 2 . 1. 58 ‘ panic ; commotion ’ ; still used in modern Yiddish, see Niborski 1999 : ‫בהלה‬. 59 Pl. ‘ remarkable things ; novelties.’ 60 See 5 . 6. 61 ‘ Blessing ’ ; an dir … is jȯ ’ zu-mol kain broche̱ is probably a proverbal expression, meaning ‘ there is nothing good about you.’ 62 ‘ unclean person ; devilish, corrupted ’ ; for modern Yiddish, see Niborski 1999 : ‫טמא‬. 63 ‘ lie and falsehood ; complete lie ’ ; also modern Yiddish, see Niborski 1999 : ‫שקר וכּז‬. 64 See 5 . 6. 65 ‘ to renounce.’ 66 ‘ religious ( rabbinical ) court.’ 67 ‘ sentence ; judgment.’ ‫‪Diana Matut : What Happened in Hamburg… 341‬‬ ‫דא‬ ‫] ‪[ 2v‬‬ ‫] ‪[7‬‬ ‫דא‬ ‫דא יונה ימח שמו איז דאש ווארדן אינן ·‬ ‫דא האט ער זיך ניט לאנג טון ביזינן ·‬ ‫נאך דעם שוואגיר טעט ער שיקן ·‬ ‫שלום עלים איי וואו קומט איר הער ·‬ ‫זאגט מיר דוך עפיש נייאי מער ·‬ ‫‪$‬אר גרושיר בהלה טעט ער באלד דער שטיקן ׃‬ ‫] ‪[8‬‬ ‫דער‬ ‫שוואגר זאגט עש זיין גרושי חדושים ‪$‬אר האנדן ·‬ ‫דש מיר האבן גיהערט אין ‪$‬רעמדי לאנדן ·‬ ‫דרום זיין מיר הער גיקומן ·‬ ‫דוא לוזיר מאן זאג מיר הער ·‬ ‫וואש איז דוך מיט דיר דער מער ·‬ ‫דאש דוא האשט איין אנדרי ‪$‬רויא אונ׳ דער צו איין הור גינומן ׃‬ ‫] ‪[9‬‬ ‫בייא‬ ‫דיין ‪$‬רום קעשטליך ווייב ·‬ ‫דוא הדיוט בישט ניט ווערט אן צו רירן אירן לייב ·‬ ‫אן דיר הדיוט איז יוא צו מאל קיין ברה ·‬ ‫דא הוב דער טמא צו שרייאין אן ·‬ ‫עש איז שקר וכז ‪ 68‬איך בין ניט איר מאן ·‬ ‫איך קען זיא ניט אודר איר משפחה ׃‬ ‫] ‪ [ 10‬דא‬ ‫דער שוואגיר דאש האט ‪$‬ון אים גיהערט ·‬ ‫דאש דער הדיוט זיין ערשטי ‪$‬רויא גאנץ צו ‪$‬אר לייקינן ביגערט ·‬ ‫ער שפראך דאש מוז איך אנדרשט מאן ·‬ ‫בית דין ליס ער זעצין עבין ·‬ ‫ֿ‬ ‫איין‬ ‫זיא זאלטן איין משפט געבין ·‬ ‫אז וויא דא גיהערט צו זעלי זאן ·‬ ‫‪.‬וז ‪68 In print :‬‬ 342 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ [ 11 ] do daś hot di ande̍rė frau ’ e̍rfarėn, do hot si ’ sich auch nit tun šparėn : mit der erśtė frau ’ hub si ’ an zu krige̍n un` zu zankėn : „ich hab dein man, wen eś dir schȯn nit gefelt, un` du ’ bėkumśt der-zu fun im kain helėr gelt ! mechśtu get fun im krige̍n, aso selśtu jȯ ’ got dankėn !“ [ 12 ] di ’ erśtė frau ’ šprach : „daś tu ’ ich nit, eś sei ’ den din-thȯre̱ s69 brengt eś aso mit. dem rov̄ un` bėss-din štel ich eś in hande̍n. ich main, eś wer [ R : ] beśėr gimel 70 [ 3r ] beśėr zu lebėn mit seinėm erliche̍n weib un` si ’ zu libe̍n as sein aigėn leib, as mit Fraidchėn, di ’ hur, zu lebe̍n in schande̍n.“ [ 13 ] do hot daś bėss-din gėpas̀kenth 71 fein : „Jȯne̱ sol sich fun der hure̍n pȯreš sein,72 bis man wert drouś lernėn ebėn, welchė frau ’ er bėhaltėn mecht, der-mit, daś kainėr gėschech unrecht.“ aso must er jȯ ’ doch gėwiś ainėr get gebėn. [ 14 ] Jȯne̱, jimaḥ-šemȯ,73 hot abėr ouf den rov̄ un` bėss-din nikś tun gebėn, nei ’ėrt er hot gėĳirt sein hure̍n-lebėn ! in is̀ẹr 74 un` hafroše̱ 75 hot er tun bleibe̍n. waś di ’ erśtė frau ’ hot far za‘ ar 76 gėhat [ r. gėhot ], daś waiś man wȯl zu ka`` k 77 Altenou ’ 78 un` zu Hamburg in der štat [ r. štot ] wer kan eś ale̍ś der-schreiben ! 69 ‘ lawsuit before a rabbinical court.’ 70 Number ‘ three.’ 71 ‘ sentenced ’ ; still used in modern Yiddish : ‫ פּסקענען‬paskenen ‘ to judge.’ 72 pȯreš sein sich ‘ to keep away from ; to segregate oneself.’ 73 See 2.1. 74 ‘ Prohibited by halakha ( religious law ) ’ ; here : the halakhically forbidden situation in which he lives. 75 ‘ Seclusion ; isolation ’ ; in this context probably ‘ hidden ; concealed.’ 76 ‘ concern.’ 77 Abbreviation for ‫ קהילה קדושה‬kehile̱ kedȯše̱ ‘ holy community ’ ; title for every fully equipped and functional community. 78 ‘ Altona ’ near Hamburg. ‫‪Diana Matut : What Happened in Hamburg… 343‬‬ ‫] ‪ [ 11‬דא‬ ‫דאש האט די אנדרי ‪$‬רויא אר‪$‬ארין ·‬ ‫דא האט זיא זיך אויך ניט טון שפארין ·‬ ‫מיט דער ערשטי ‪$‬רויא הוב זיא אן צו קריגן אונ׳ צו צאנקין ·‬ ‫איך האב דיין מאן ווען עש דיר שון ניט גי‪$‬עלט ·‬ ‫אונ׳ דוא ביקומשט דער צו ‪$‬ון אים קיין העליר געלט ·‬ ‫מעשטו גט ‪$‬ון אים קריגן אזא זעלשטו יוא גאט דאנקין ׃‬ ‫] ‪ [ 12‬דיא‬ ‫ערשטי ‪$‬רויא שפראך דאש טוא איך ניט ·‬ ‫עש זייא דען דין תורה ברענגט עש אזא מיט ·‬ ‫בית דין שטעל איך עש אין האנדן ·‬ ‫ֿ‬ ‫דעם ר אונ׳‬ ‫איך מיין עש ווער‬ ‫בעשיר‬ ‫ג‬ ‫] ‪[ 3r‬‬ ‫בעשיר ‪ 79‬צו לעבין מיט זיינים ערלין ווייב ·‬ ‫אונ׳ זיא צו ליבן אז זיין אייגין לייב ·‬ ‫אז מיט ‪$‬ריידין דיא הור צו לעבן אין שאנדן ׃‬ ‫] ‪ [ 13‬דא‬ ‫בית דין גיפסקנת ‪$‬יין ·‬ ‫ֿ‬ ‫האט דאש‬ ‫יונה זאל זיך ‪$‬ון דער הורן פורש ‪ 80‬זיין ·‬ ‫ביז מאן ווערט דרויש לערנין עבין ·‬ ‫וועלי ‪$‬רויא ער ביהאלטן מעט ·‬ ‫דער מיט דאש קייניר גישעך אונרעט ·‬ ‫אזא מוזט ער יוא דאך גיוויש אייניר גט געבין ׃‬ ‫] ‪ [ 14‬יונה‬ ‫בית דין ניקש טון געבין ·‬ ‫ֿ‬ ‫ימח שמו האט אביר אויף דען ר אונ׳‬ ‫נייאירט ער האט גי‪$‬ירט זיין הורן לעבין ·‬ ‫אין איסור אונ׳ ה‪$‬רשה האט ער טון בלייבן ·‬ ‫וואש דיא ערשטי ‪$‬רויא האט ‪$‬אר צער גיהאט ·‬ ‫דאש ווייש מאן וואול צו ק ״ ק אלטנויא אונ׳ צו האמבורג אין דער שטאט ·‬ ‫ווער קאן עש אלש דער שרייבן ׃‬ ‫‪ with Raphe ).‬ב ( עשיר ‪79 In print :‬‬ ‫‪. This mistake is signiĳicant, though, since it reflects on the actual pro‬פרוש ‪80 Should be‬‬‫‪nounciation.‬‬ 344 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ [ 15 ] far di ’ ‘ eze̱ 81 jor``h 82 is si ’ gėtrete̍n, di here̍n hot si ’ gar ser gėbete̍n, man solt ir doch zu-herėn. di ’ rošė-‘ ezẹss 83 frogėte̍n : „junk-frau ’ , waś is ei ’ėr bėger ȯde̍r worum seit ir gėkume̍n ain-her ? sagt ei ’ėr nȯt sunde̍r alė bėschwerėn !“ [ 16 ] si ’ šprach : „ir grȯś ginśtigė here̍n un` weisėr rot, eich mus ich klagėn meinė nȯt, mein herzė-laid un` grȯśe schmerzėn : mein man is hi ’-her ous Pȯlėn gėkume̍n un` hot hi ’ ainė ande̍rė frau ’ un` der-zu ain hur gėnume̍n ! wi ’ hot er daś kenėn habėn in seinėm herzėn ?“ [ 17 ] do di ’ here̍n recht far-štunde̍n di ’ sach, do gobe̍n si ’ der frau ’ ain briv̄chėn an di ’ wach : man solt ir muśke̍tire̍r mit-gebėn. der ȯĳizire̍r hot daś briv̄chėn an-gėnume̍n un` šprach : „di ’-weil eś is fun di ’ here̍n gėkume̍n so muse̍n mir ir helfėn ebėn !“ [ 18 ] noch dem hous zu ginge̍n ĳir muśke̍tire̍r mit, si ’ suchėte̍n [ R : ] Jȯne̱ [ 3v ] Jȯne̱ übėr-al, si ’ gėfande̍n in abėr nit. si ’ sagėte̍n : „daś sein gar wunde̍rlichė sache̍n !“ der frau ’e̍n brude̍r šprach : „ir libe̍n here̍n mein, sucht doch in dem schore̍n-štain ! ĳil-leicht hot er sich drein far-krȯchėn.“ [ 19 ] di ’ muśke̍tire̍r šproche̍n : „daś is werlich wor, eś felt auch wȯl nit um ain hor, drum muse̍n mir übe̍r-al recht wȯl zu-sehe̍n !“ do si ’ nun kame̍n bei ’ den schorėn-štain zu gėn, do gėfunde̍n si ’ bar-Homen drine̍n štėn. do daś nun war gėschehe̍n, 81 Usually ‘ advice ’ ; but the meaning here is ‘ city council,’ see : Weinreich 1928 : 263, fn. no. 1, and Kleine and Steffers-Maus 2007. 82 ‫ ירום הודו‬jorum hȯdȯ ‘ his glory may endure ’ ; also used as eulogy for non-Jewish rulers. 83 The meaning here is probably ‘ members of the city council,’ see : Kleine and SteffesMaus 2007. ‫‪Diana Matut : What Happened in Hamburg… 345‬‬ ‫] ‪$ [ 15‬אר‬ ‫דיא עצה יר ״ ה איז זיא גיטרעטן ·‬ ‫דיא הערן האט זיא גאר זער גיבעטן ·‬ ‫מאן זאלט איר דאך צו הערין ·‬ ‫עצות ‪$‬ראגיטן יונק ‪$‬רויא וואש איז אייאיר ביגער ·‬ ‫ֿ‬ ‫דיא ראשי‬ ‫אודר ווארום זייט איר גיקומן איין הער ·‬ ‫זאגט אייאיר נוט זונדר אלי בישווערין ·‬ ‫] ‪ [ 16‬זיא‬ ‫שפראך איר גרוש גינשטיגי הערן אונ׳ ווייזיר ראט ·‬ ‫אייך מוז איך קלאגין מייני נוט ·‬ ‫מיין הערצי לייד אונ׳ גרושי שמערצין ·‬ ‫מיין מאן איז היא הער אויז פולין גיקומן ·‬ ‫אונ׳ האט היא אייני אנדרי ‪$‬רויא אונ׳ דער צו איין הור גינומן ·‬ ‫וויא האט ער דאש קענין האבין אין זיינים הערצין ׃‬ ‫] ‪ [ 17‬דא‬ ‫דיא הערן רעט ‪$‬אר שטונדן דיא זאך ·‬ ‫דא גאבן זיא דער ‪$‬רויא איין בריין אן דיא וואך ·‬ ‫מאן זאלט איר מושקטירר מיט געבין ·‬ ‫דער אופיצירר האט דאש בריין אן גינומן ·‬ ‫אונ׳ שפראך דיא ווייל עש איז ‪$‬ון דיא הערן גיקומן ·‬ ‫זא מוזן מיר איר העל‪$‬ין עבין ׃‬ ‫] ‪ [ 18‬נאך‬ ‫דעם הויז צו גינגן ‪$‬יר מושקטירר מיט ·‬ ‫זיא זוכיטן‬ ‫] ‪[ 3v‬‬ ‫יונה אויבר אל זיא גי‪$‬אנדן אין אביר ניט ·‬ ‫זיא זאגיטן דאש זיין גאר וואונדרליי זאן ·‬ ‫דער ‪$‬רויאן ברודר שפראך איר ליבן הערן מיין ·‬ ‫זוט דאך אין דעם שארן שטיין ·‬ ‫‪$‬יל לייט האט ער זיך דריין ‪$‬אר קרוין ·‬ ‫] ‪ [ 19‬דיא‬ ‫מושקטירר שפראכן דאש איז ווערליך וואר ·‬ ‫עש ‪$‬עלט אויך וואול ניט אום איין האר ·‬ ‫דרום מוזן מיר אויבר אל רעט וואול צו זעהן ·‬ ‫דא זיא נון קאמן בייא דען שארין שטיין צו גין ·‬ ‫דא גי‪$‬ונדן זיא בר המן דרינן שטין ·‬ ‫דא דאש נון וואר גישעהן ·‬ ‫יונה‬ 346 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ [ 20 ] di ’ muśketire̍r hube̍n in an zu schlepfėn. der tomẽ 84 der-schrak un` maine̍t, man wert in thecef 85 kepfėn ! gar bite̍r hub er an zu waine̍n un` zu schrei ’e̍n : „ir libė here̍n lost mich štėn, ich wil gerėn mit eich gėn, got der her wert mir meinė sind far-zei ’ėn !“ [ 21 ] do Jȯne̱ nun tet in der theĳis̀e̱ size̍n, er kont far kelt nit an-hėbe̍n zu schwize̍n, wi ’ gerėn wer er wide̍r arous gėwesėn ! aso sol eś al den gėn, di ’ sich far got nit schemėn, un` sich zwai ’ weibe̍r nemėn, di ’ kenėn far gotś štrof nit gėnesėn. [ 22 ] do er nun in der theĳis̀e̱ war gėsesėn un` hot nit ĳil zu trinke̍n ȯde̍r zu esėn, sein ande̍r frau ’ Fraidchėn, di ’ hur, kont daś nit lengėr far-tragėn : si ’ štund ouf ous dem kind-bet un` hub an zu laufėn um di ’ wet, bei ’ den man un` hub an zu sagėn : [ 23 ] „ ȯch got, waś hośtu nun gėton ? freg dein erśtė frau ’ , waś si ’ wil fun dir hon ! du ’ wilśt ir doch gerėn get gebėn !“ „sag ir, mit meinėm tȯt is dir doch bėholfėn nischt ! drum bit ich dich, lema‘ an hašem,86 zu dise̍r friśt, mach doch, daś ich mecht bėhalte̍n mein lebėn !“ [ R : ] un` [ 4r ] dalet 87 [ 24 ] „ un` ich wil auch bei ’ di ’ roš-‘ ezẹss gėn, den ich tu ’ gar wȯl mit in štėn ! ich hof, si ’ werde̍n mir auch zu-herėn. ich wil rėde̍n ale̍ś, waś mir müglich is, so waiś ich den gar wȯl far gėwiś, si ’ werde̍n mir meinė bet gėwerėn !“ 84 85 86 87 See 9 . 4. ‘ immediately, instantly ; at once.’ ‘ For the love of God ’ ; still used in modern Yiddish, see Niborski 1999 : ‫למען השם‬. Number ‘ four.’ ‫‪Diana Matut : What Happened in Hamburg… 347‬‬ ‫] ‪ [ 20‬דיא‬ ‫מושקטירר הובן אין אן צו שלעפ‪$‬ין ·‬ ‫דער טמא דער שראק אונ׳ מיינט מאן ווערט אין תכף קעפ‪$‬ין ·‬ ‫גאר ביטר הוב ער אן צו וויינן אונ׳ צו שרייאן ·‬ ‫איר ליבי הערן לאזט מיך שטין ·‬ ‫איך וויל גערין מיט אייך גין ·‬ ‫גאט דער הער ווערט מיר מייני זינד ‪$‬אר צייאין ׃‬ ‫] ‪ [ 21‬דא‬ ‫יונה נון טעט אין דער ת‪$‬יסה זיצן ·‬ ‫ער קאנט ‪$‬אר קעלט ניט אן היבן צו שוויצן ·‬ ‫וויא גערין ווער ער ווידר ארויז גיוועזין ·‬ ‫אזא זאל עש אל דען גין דיא זיך ‪$‬אר גאט ניט שעמין ·‬ ‫אונ׳ זיך צווייא ווייבר נעמין ·‬ ‫דיא קענין ‪$‬אר גאטש שטראף ניט גינעזין ׃‬ ‫] ‪ [ 22‬דא‬ ‫ער נון אין דער ת‪$‬יסה וואר גיזעסין ·‬ ‫אונ׳ האט ניט ‪$‬יל צו טרינקן אודר צו עשין ·‬ ‫זיין אנדר ‪$‬רויא ‪$‬ריידין דיא הור קאנט דאש ניט לענגיר ‪$‬אר טראגין ·‬ ‫זיא שטונד אויף אויז דעם קינד בעט ·‬ ‫אונ׳ הוב אן צו לוי‪$‬ן אום דיא וועט ·‬ ‫בייא דען מאן אונ׳ הוב אן צו זאגין ׃‬ ‫] ‪ [ 23‬אוך‬ ‫גאט וואש האשטו נון גיטאן ·‬ ‫‪$‬רעג דיין ערשטי ‪$‬רויא וואש זיא וויל ‪$‬ון דיר האן ·‬ ‫דוא ווילשט איר דאך גערין גט געבין ·‬ ‫זאג איר מיט מיינים טוט איז דיר דאך ביהאל‪$‬ין נישט ·‬ ‫דרום ביט איך דיך למען השם צו דיזר ‪$‬רישט ·‬ ‫מאך דאך דאש איך מעט ביהאלטן מיין לעבין ׃‬ ‫] ‪ [ 24‬אונ׳‬ ‫עצות גין ·‬ ‫ֿ‬ ‫איך וויל אויך בייא דיא ראש‬ ‫דען איך טוא גאר וואול מיט אין שטין ·‬ ‫איך האף זיא ווערדן מיר אויך צו הערין ·‬ ‫איך וויל רידן אלש וואש מיר מויגליך איז ·‬ ‫זא ווייש איך דען גאר וואול ‪$‬אר גיוויש ·‬ ‫זיא ווערדן מיר מייני בעט גיווערין‬ ‫אונ׳‬ ‫ד‬ ‫] ‪[ 4r‬‬ 348 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ [ 25 ] si ’ hot abėr bei ’ den here̍n nikś ous-gėricht, do hot si ’ nit gėwiśt wi ’ ir gėschicht, daś aso ain mace̱ 88 is ouf ir gėkume̍n. daś is gėwesėn der mȯs̀ėrthe̱ 89 rechtė lon, den si ’ hot der ganzė kehile̱ gar wė ’ gėton ! ain schėnė mapole̱90 hot si ’ ein-gėnume̍n. [ 26 ] do man nun hot gesehe̍n, daś špil tut kain gut, eś wert Jȯne̱ kośte̍n sein gut un` blut, zu der erśte̍n frau ’ is man gėgangėn un` hot ir gėsagt : „sich zu, waś du ’ gėdenkśt, daś du ’ ain bar-Jiśro ’el um daś ḥajẹss brengśt ! er wert ’efšer gėkepft ȯde̍r wȯl gar gėhangėn !“ [ 27 ] di ’ gutė frau ’ ging zu dem roše‘ bei ’ di ’ theĳis̀e̱ hin un` šprach zu im : „du ’ mechśt mich leicht gėĳinde̍n in dem sin, un` wolt an dir tun ain hüpschė nekome̱ ! 91 abėr ich hab, borẹch-hašem, ain judėsch herz, wen du ’ mich gleich hośt gėbracht in grośė schmerz ! ich bėdenk abėr mein nešome̱.“ 92 [ 28 ] do šprach der hediẹt : 93 „het ich di ’ hur nit gėnume̍n, aso wer ich nit in daś zorẹss 94 gėkume̍n ! ich wil der hur daś schȯn bėzalėn : [ r. bėzolėn ] ich wil nun zihe̍n in ain fremd lant, wu ich gar nit bin bėkant, ain dritė frau ’ wil ich mir holėn !“ [ 29 ] do ging di ’ frau ’ wide̍r far di ’ here̍n tretėn, un` um sein lebėn hot si ’ gėbetėn. do šprochėn zu [ 4v ] 88 89 90 91 92 93 94 [ R : ] ir ir di ’ here̍n gar ebėn : „mir wele̍n eś eich zu gėfale̍n tȯn, er het wȯl far-dint ain schlechtėre̍n lȯn ! fun ei ’e̍rėnt-wegėn welėn mir im schenkėn daś lebėn. ‘ trial ; plague.’ Fem. ‘ defamer ; traitress ; denunciator,’ from ‫ מסרן‬masern ‘ to denunciate ; to betray.’ ‘ defeat ; decline.’ ‘ vengeance.’ ‘ soul.’ See 5.6. ‘ trouble ; worry.’ ‫‪Diana Matut : What Happened in Hamburg… 349‬‬ ‫] ‪ [ 25‬זיא‬ ‫האט אביר בייא דען הערן ניקש אויז גיריט ·‬ ‫דא האט זיא ניט גיווישט וויא איר גישיט ·‬ ‫דאש אזא איין מכה איז אויף איר גיקומן ·‬ ‫דאש איז גיוועזין דער מוסירתה רעטי לאן ·‬ ‫דען זיא האט דער גאנצי קהלה גאר וויא גיטאן ·‬ ‫איין שיני מפלה האט זיא איין גינומן ·‬ ‫] ‪ [ 26‬דא‬ ‫מאן נון האט גיזעהן דאש שפיל טוט קיין גוט ·‬ ‫עש ווערט יונה קאשטן זיין גוט אונ׳ בלוט‬ ‫צו דער ערשטן ‪$‬רויא איז מאן גיגאנגין ·‬ ‫אונ׳ האט איר גיזאגט זיך צו וואש דוא גידענקשט ·‬ ‫חיות ברענגשט ·‬ ‫ֿ‬ ‫דאש דוא איין בר ישראל אום דאש‬ ‫ער ווערט א‪$‬שר גיקעפ‪$‬ט אודר וואול גאר גיהאנגין ׃‬ ‫] ‪ [ 27‬דיא‬ ‫גוטי ‪$‬רויא גינג צו דעם רשע בייא דיא ת‪$‬יסה הין ·‬ ‫אונ׳ שפראך צו אים דוא מעשט מיך לייט גי‪$‬ינדן אין דעם זין ·‬ ‫אונ׳ וואלט אן דיר טון איין הויפשי נקמה ·‬ ‫אביר איך האב ברוך השם איין יודיש הערץ ·‬ ‫ווען דוא מיך גלייך האשט גיבראט אין גרושי שמערץ ·‬ ‫איך בידענק אביר מיין נשמה ׃‬ ‫] ‪ [ 28‬דא‬ ‫שפראך דער הדיוט העט איך דיא הור ניט גינומן ·‬ ‫צרות גיקומן ·‬ ‫ֿ‬ ‫אזא ווער איך ניט אין דאש‬ ‫איך וויל דער הור דאש שון ביצאלין ·‬ ‫איך וויל נון ציהן אין איין ‪$‬רעמד לאנט ·‬ ‫וואו איך גאר ניט בין ביקאנט ·‬ ‫איין דריטי ‪$‬רויא וויל איך מיר האלין ׃‬ ‫] ‪ [ 29‬דא‬ ‫גינג דיא ‪$‬רויא ווידר ‪$‬אר דיא הערן טרעטין ·‬ ‫אונ׳ אום זיין לעבין האט זיא גיבעטין ·‬ ‫דא שפראין צו‬ ‫] ‪[ 4v‬‬ ‫איר דיא הערן גאר עבין ·‬ ‫מיר וועלן עש אייך צו גיפאלן טון ·‬ ‫ער העט וואול ‪$‬אר דינט איין שלעטירן לון ·‬ ‫‪$‬ון אייארינט וועגין וועלין מיר אים שענקין דאש לעבין ·‬ ‫איר‬ 350 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ [ 30 ] mir welėn eich daś abėr far ain worhait sagėn : mit der hur welėn mir in zu der štat anous-jagėn ! nehśt got mag er eich dankėn far sein lebėn, gėt ir abėr doch gėschwind, bei ’ di ’ eltśtėn fun dem jude̍sche̍n gėsind, ain schaid-briv̄ sol er eich erśt gebėn !“ [ 31 ] aso sol eś ainėm itliche̍n roše‘ gėn, der seinė erśtė frau ’ lost štėn un` tut sich ain ande̍rė nemėn ! der kan nit bleibėn an kainėm ȯrt, er is far-lorėn hi ’ un` dort un` mus sein ḥelek 95 far got un` auch far leitėn schemėn ! [ 32 ] daś schėnė lid hab ich gėtracht, un` hab eś aso in reim gėbracht, gleich as wi ’ eś is gėschehe̍n ! daś hot gėgebe̍n ain grȯś rumȯr, do man den hediẹt 96 Jȯne̱ mit Fraidchėn, der hur, hot ge̍jagt ouś Hamburg, daś hot col ‘ ȯlem wȯl gėsehe̍n, [ 33 ] un` habe̍n gėhat ain grȯśė ne̍kome̱ da̍ ran ! drum sei ’ gėwarėnt ain ide̍r erlich man un` nem sich kain zwai ’ weibėr ! eś hot Jȯne̱ bald gėkośt sein lebėn, kain zwai ’ pfenig het man far in gėgebe̍n ! daś sagt eich Jeḥask ’el ben haḥov̄er rabi Secharie̱ der schreibėr. [ 34 ] ir libe̍n rabȯssaj kent wȯl gėdenkėn, worum ich eich daś lid tu ’ schenkėn ! ain klainė mathone̱ 97 mir zu ge̍bėn wert eich nit far-dris̀e̍n, do-dorch wert ir den sȯche̱ 98 sein, bald zu kume̍n in ’erez Jiśro ’el arein, daś milch un` hȯnig tut flis̀e̍n ! omen ve ’omen ! s̀elik s̀elik s̀elik 95 ‘ part ; share ’ ; still used in modern Yiddish. 96 See 5.6. 97 ‘ present.’ In the print ‫ ת‬has a raphe-sign ( ‫ ) ֿת‬which indicates a pronounciation as massone̱. 98 ‘ be worthy of ( smb., smth. ) ; to have earned ( smth. ).’ ‫‪Diana Matut : What Happened in Hamburg… 351‬‬ ‫] ‪ [ 30‬מיר‬ ‫וועלין אייך דאש אביר ‪$‬אר איין ווארהייט זאגין ·‬ ‫מיט דער הור וועלין מיר אין צו דער שטאט אנויז יאגין ·‬ ‫נעהשט גאט מאג ער אייך דאנקין ‪$‬אר זיין לעבין ·‬ ‫גיט איר אביר דאך גישווינד ·‬ ‫בייא דיא עלטשטין ‪$‬ון דעם יודשן גיזינד ·‬ ‫איין שייד ברי זאל ער אייך ערשט געבין ׃‬ ‫] ‪ [ 31‬אזא‬ ‫זאל עש איינים איטלין רשע גין ·‬ ‫דער זייני ערשטי ‪$‬רויא לאזט שטין ·‬ ‫אונ׳ טוט זיך איין אנדרי נעמין ·‬ ‫דער קאן ניט בלייבין אן קיינים אורט ·‬ ‫ער איז ‪$‬אר לארין היא אונ׳ דארט ·‬ ‫אונ׳ מוז זיין חלק ‪$‬אר גאט אונ׳ אויך ‪$‬אר לייטין שעמין ׃‬ ‫] ‪ [ 32‬דאש‬ ‫שיני ליד האב איך גיטראט ·‬ ‫אונ׳ האב עש אזא אין ריים גיבראט ·‬ ‫גלייך אז וויא עש איז גישעהן ·‬ ‫דאש האט גיגעבן איין גרוש רומור ·‬ ‫דא מאן דען הדיוט יונה מיט פריידין דער הור ·‬ ‫האט גיאגט אויש האמבורג דאש האט כל עולם וואול גיזעהן ׃‬ ‫] ‪ [ 33‬אונ׳‬ ‫האבן גיהאט איין גרושי נקמה דראן ·‬ ‫דרום זייא גיווארינט איין אידר ערליך מאן ·‬ ‫אונ׳ נעם זיך קיין צווייא ווייביר ·‬ ‫עש האט יונה באלד גיקאשט זיין לעבין ·‬ ‫קיין צווייא פ‪$‬עניג העט מאן ‪$‬אר אין גיגעבן ·‬ ‫דאש זאגט אייך יחזקאל בן החר רבי זריה דער שרייביר ׃‬ ‫] ‪ [ 34‬איר‬ ‫רבותי קענט וואול גידענקין ·‬ ‫ֿ‬ ‫ליבן‬ ‫ווארום איך אייך דאש ליד טוא שענקין ·‬ ‫מתנה מיר צו געבין ווערט אייך ניט ‪$‬אר דריסן ·‬ ‫איין קלייני ֿ‬ ‫דא דארך ווערט איר דען זוה זיין ·‬ ‫באלד צו קומן אין ארץ ישראל אריין ·‬ ‫דאש מילך אונ׳ הוניג טוט ‪$‬ליסן ׃ אמן · ואמן ‪:‬‬ ‫סליק סליק סליק‬ 352 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Primary Sources Brockmann, Reiner, 1639 : Oda esthonica trochaica, ad Melodiam ; Einsmahls alß ich lust bekam. Revaliae, Typis excudebat Henricus Westphalus, gymnasij typographus Reval. Drey Weltliche Newe Lieder, 1647 : Drey Weltliche Newe Lieder : Das Erste, Einßmahls da ich Lust bekam, anzusprechen …/ Das Ander, Frölich im Sommer, im Herbst ohn Kummer ( Holzschnitt ) ; Das Dritte, Ist dann der Himmel zu wider meinm Lebn. S. l. Ephraim bar Judah Halevi ( Gumprecht Levi ), 1649 : Ain nei ’ lid ouf der megile̱ ( A new Song on the megile ). Amsterdam : Judah ben Mordechai & partners. Neukrantz, Johann, 1650 : Königs Davids Psalter-Spiel, von neuem besäitet und auff die heutige Singe-art gestimmet. Das ist : ausserlesene christLehr-Bete-Klage-Trost- und Dank-Psalmen Davids. Hamburg : Jakob Rebenlein. Venus-Gaertlein, 1659 : Venus-Gaertlein : Oder Viel Schoene/ außerlesene Weltliche Lie=der/ allen zechtigen Jungfrawen vnd Jungen=Gesellen zu Ehren… Hamburg : Georg Papen. Vierdanck, Johann, 1641 : Ander Theil darinnen begriffen etliche Capricci, Canzoni vnd Sonaten mit 2. 3. 4. und 5. Instrumenten ohne und mit dem Basso Continuo. Rostock : n. p. Zwey schöne newe weltliche Lieder, n.d. : Zwey schöne newe weltliche Lieder/ Das Erste Als ich einmal Lust bekam/ anzusprechen eine Dam…/ Das Ander/ Die fröliche Som[ m ]erzeit/ mein feines Lieb und Seytenspiel/ ist uber alle Frewd/Auffs new gedruckt. S. l. Secondary Literature Aptroot, Marion, 2010 : “ Euchels ‘ Kollegen ’ : Reb Henoch und die aschkenasischen Komödien im späten 18. Jahrhundert. ” In : Marion Aptroot, Andreas Kennecke and Christoph Schulte, eds., Isaac Euchel. Der Kulturrevolutionär der jüdischen Aufklärung. Hannover : Wehrhahn Verlag, 295 – 318. Aschheim, Steven E., 1982 : Brothers and Strangers. The East European Jew in German and German Jewish Consciousness, 1800 – 1923. Madison, wi : University of Wisconsin Press. Baumgarten, Jean, 2005 : Introduction to Old Yiddish Literature. Jerold C. Frakes, ed. and trans. Oxford and New York : Oxford University Press. Berger, Shlomo, forthcoming : Producing Redemption in Amsterdam : Early Modern Yiddish Books in Paratextual Perspective. Boston – Leiden : Brill. Diana Matut : What Happened in Hamburg… 353 Braden, Jutta, 2001 : Hamburger Judenpolitik im Zeitalter Lutherischer Orthodoxie, 1590 – 1710. Hamburg : Christians ( Hamburger Beiträge zur Geschichte der deutschen Juden, 23 ). Butzer, Evi, 2003 : Die Anfänge der jiddischen purim shpiln in ihrem literarischen und kulturgeschichtlichen Kontext. Hamburg : Buske ( jidische schtudies 10). Cowley, Arthur Ernest, 1929 : A Concise Catalogue of the Hebrew Printed Books in the Bodleian Library. Oxford : Clarendon Press. Erik, Maks, [ 1928 ] 1979 : Di geshikhte fun der yidisher literatur. Fun die eltste tsaytn biz der haskole-tkufe. New York : Alveltlekher yidisher kulturkongres. Fram, Edward, 1997 : Ideals Face Reality. Jewish Law and Life in Poland, 1550 – 1655. Cincinnati : Hebrew Union College Press. Geller, Ewa, 2012 : “ Aschkenas und Polak. Ein Jahrhunderte währender Antagonismus, exemplarisch dargestellt an einem jiddischen Streitlied aus dem 17. Jahrhundert. ” In : Nathanael Riemer, ed., Jewish Lifeworlds and Jewish Thought. Festschrift presented to Karl E. Grözinger on the Occasion of his 70th Birthday. Wiesbaden : Harrassowitz Verlag, 357 – 368. Gotzmann, Andreas, 2008 : Jüdische Autonomie in der Frühen Neuzeit. Recht und Gemeinschaft im deutschen Judentum. Göttingen : Wallstein Verlag. Grunwald, Max, 1904 : Hamburgs deutsche Juden bis zur Auflösung der Dreigemeinden 1811. Hamburg : Alfred Janssen. Gutschow, Mirjam, 2007 : Inventory of Yiddish Publications from the Netherlands, c. 1650 – c. 1950. Leiden and Boston : Brill. Holzapfel, Otto, 2006 : Liedverzeichnis. Die ältere deutschsprachige Liedüberlieferung. 2 Vols. Hildesheim – Zürich – New York : Olms ; vol. 1 : 428 f. Hundert, Gershon David, 2004 : Jews in Poland-Lithuania in the Eighteenth Century. A Genealogy of Modernity. Berkeley and Los Angeles : University of California Press. Israel, Jonathan I., 1985 : European Jewry in the Age of Mercantilism, 1550 – 1750. Oxford and Portland, or : The Littman Library of Jewish Civilization. Kleine, Ane and Steffes-Maus, Claudia, 2007: “gojim und ejze. Erstbelege aus einer neuaufgefundenen Handschrift von 1385 . ” In: Jiddistik Mitteilungen 37: 1–9. Lowenstein, Steven, 1997 : “ The Shifting Boundary between Eastern and Western Jewry. ” In : Jewish Social Studies 4 ( 1 ) : 60 – 78. 354 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Marcus, Ivan G., 2008 : “ Ashkenaz. ” In : Gershon David Hundert, ed., The yivo Encyclopedia of Jews in Eastern Europe. Vol. 1. New Haven : Yale University Press, 77 – 79. Matut, Diana, 2011 : Dichtung und Musik im frühneuzeitlichen Aschkenas. Ms. Opp. Add. 4o 136 der Bodleian Library, Oxford ( das so genannte Wallich-Manuskript ) und Ms. hebr. oct. der Stadt- und Universitätsbibliothek, Frankfurt a. M. 2 Vols. Leiden – Boston : Brill. Müller, Willibert, 1928 : “ Die Melodie zum ‘ Lied vom guten Kerl ’ aus dem Jahre 1641. ” In : Jahrbuch für Volksliedforschung 1 : 182. Niborski, Yitskhok, 1999 : avec la collaboration de Simon Neuberg : Verterbukh fun loshn-koydesh-shtamike verter in yidish / Dictionnaire des mots d'origine hébraïque et araméenne en usage dans la langue yiddish. First corrected reprint Paris : Bibliothèque Medem. Rölleke, Heinz, ed., 1979 : Achim von Arnim und Clemens Brentano Des Knaben Wunderhorn. Alte Deutsche Lieder. 9 Vols. Stuttgart : Reclam, vol. 5. Rosenberg, Felix, 1888 – 1889 : “ Über eine Sammlung deutscher Volks- und Gesellschaftslieder in hebräischen Lettern. ” In : Zeitschrift für die Geschichte der Juden in Deutschland 2 : 232 – 296 and 3 : 14 – 28. Rosenzweig, Claudia, 2007 : The Bovo d ’Antona by Elye Bokher. Ph. D. diss., The Hebrew University of Jerusalem. Salmen, Walter, 1975 : “ Das gemachte ‘ Neue Lied ’ im Spätmittelalter. ” In : Rolf-Wilhelm Brednich, Lutz Röhrich and Wolfgang Suppan, eds., Handbuch des Volksliedes. Bd. 2 : Historisches und Systematisches – Interethnische Beziehungen – Musikethnologie. München : Fink, 407 – 420. Shmeruk, Chone, 1979 : Maḥazōt miqrā ’ iyyīm bě-yīdīš, 1697 – 1750 . Jerusalem : Israel Academy of Sciences and Humanities. – 1984 : “ ‘ Šīrīm hīstōriyyim ’ bě-yīdīš še-nidpesū bě-’Amsterdam ba-mē ’ ōt ha-y ” z wě-ha-y ” ḥ. ” In Jozeph Michman, ed., Meḥqārīm ‘al tōlědōt jahadūt Hōland. Jerusalem : Hebrew University. Vol. 4, 143-161. – 1988 : Prokim fun der yidisher literaturgeshikhte. Tel Aviv : Farlag Y. L. Perets. Shulvass 1971 : From East to West. The Westward Migration of Jews from Eastern Europe During the Seventeenth and Eighteenth Centuries. Detroit : Wayne State University Press. Steinschneider, Moritz, 1848 – 1849 : “ Jüdisch-deutsche Literatur, nach einem handschriftlichen Katalog der Oppenheim ’ schen Bibliothek ( in Oxford ), mit Zusätzen und Berichtigungen. ” In : Serapeum. Zeitschrift für Bibliothekwissenschaft, Handschriftenkunde und ältere Litteratur Diana Matut : What Happened in Hamburg… 355 9 : 313 – 320, 321 – 336, 344 – 352, 363 – 368, 375 – 384 ; 10 : 9 – 16, 25 – 32, 42 – 48, 74 – 80, 88 – 96, 107 – 112. – 1852 – 1860 : Catalogus Librorum Hebraeorum in Bibliotheca Bodleiana. Berlin : A. Friedlaender. Stoll, Doris, 1991 : Die Kölner Presse im 16. Jahrhundert. Nikolaus Schreibers ‘ Neue Zeitungen aus Cöllen. ’ Wiesbaden : Harrassowitz. Teller, Adam, 2008 : “ The Jewish Literary Responses to the Events of 1648 – 1649 and the Creation of a Polish-Jewish Consciousness. ” In : Benjamin Nathans and Gabriella Safran, eds., Culture Front : Representing Jews in Eastern Europe. Philadelphia : University of Pennsylvania Press, 1 – 27. Waldberg, Max Freiherr von, 1890 : Venus-Gärtlein. Ein Liederbuch des xvii. Jahrhunderts. Nach dem Drucke von 1656. Halle a. S. : Niemeyer. Weinreich, Max, 1928 : Bilder fun der yidisher literaturgeshikhte : fun di eltste tsaytn biz Mendele Moykher Sforim. Vilna : Tomor. – 1929 : “ Tsvey yidishe shpotlider oyf yidn. ” In yivo Filologishe shriftn 3 : col. 537 – 553. Wertheimer, Jack, 1987 : Unwelcome Strangers. East European Jews in Imperial Germany. Oxford – New York : Oxford University Press. Meliz-jȯšer, Amsterdam 1687. Stadt- und Universitätsbibliothek Frankfurt a. M. ‫שמעון נויבערג‬ ‫שפּראך ון דעם בעל ־ ה „צאינה־וראינה “ ס „מליץ ־ יושר “‬ ‫ַ‬ ‫די‬ ‫שפּראך זענען זייער ַא וויכטיקער ענין צוליב‬ ‫ַ‬ ‫זײן‬ ‫דער מחבר ון „צאינה ־ וראינה “ און ַ‬ ‫סימפּאזיום‪ ,‬און‬ ‫ָ‬ ‫בײ ַא ריִ ערדיקן‬ ‫דערמאנט ַ‬ ‫ָ‬ ‫האב מסתּמא שוין‬ ‫וואס איך ָ‬ ‫ַא סך טעמים ָ‬ ‫מײן בוך וועגן‬ ‫געזאגט בכּת‪ #‬אין ַ‬ ‫ָ‬ ‫האב עס שוין‬ ‫ווײל איך ָ‬ ‫דעראר‪ַ ,‬‬ ‫ַ‬ ‫טאמער נישט איז עס‬ ‫ָ‬ ‫שפּראך ון דעם ווערק לויט‬ ‫ַ‬ ‫אויסארשן די‬ ‫ָ‬ ‫האב איך געפּרוּווט‬ ‫דארטן ָ‬ ‫„צאינה ־ וראינה “‪ָ .‬‬ ‫נאליזירט די‬ ‫האב ַא ַ‬ ‫דערגאנגען און איך ָ‬ ‫ַ‬ ‫וואס זענען צו אונדז‬ ‫אויסגאבעס ָ‬ ‫ַ‬ ‫די ריִ יִ קסטע‬ ‫האבן געוויזן ַאז טיילן ון‬ ‫וואס ָ‬ ‫ארשיידענע קלייניקייטן ָ‬ ‫סלאווישע עלעמענטן ָאבער אויך ַ‬ ‫ַ‬ ‫נאר‬ ‫שטאמען נישט ון דער עדער ונעם הויפּט ־ מחבר ָ‬ ‫ַ‬ ‫קארפּוס‬ ‫דעם „צאינה ־ וראינה “ ־ ָ‬ ‫וואס מיר ווייסן‬ ‫ארלוירענע מקורים בכּת‪ָ ,#‬‬ ‫וואס׃ זיי זענען איבערגענומען ון גרייטן‪ ,‬ון ַ‬ ‫ָ‬ ‫גארנישט‪.‬‬ ‫פּראקטיש ָ‬ ‫ַ‬ ‫וועגן זיי ַאחוץ דעם‬ ‫אר‬ ‫מאטיש אויף צוויי פּלענער‪ ,‬וויכטיקע ַ‬ ‫גרא ַ‬ ‫פּרא ַ‬ ‫ָ‬ ‫האב דעמלט אויך ָאנגעוויזן‬ ‫איך ָ‬ ‫ארבונדן מיט „צאינה ־ וראינה “‪.‬‬ ‫וואס זענען ַ‬ ‫שפּראך ָ‬ ‫ַ‬ ‫דער געשיכטע ון דער ייִ דישער‬ ‫נאכקוקן גענוי די ַאנטוויקלונג ון דעם טעקסט דורך די הונדערטער דרוקן‬ ‫דאס ָ‬ ‫ערשטנס ָ‬ ‫לײכטן‬ ‫בא ַ‬ ‫ריאנטן און ַאזוי ַארום ַ‬ ‫ווא ַ‬ ‫נאליזירן די ַ‬ ‫און איבערדרוקן ונעם חיבור‪ ,‬כּדי צו ַא ַ‬ ‫סינטאקס‪ .‬און צווייטנס‪ַ ,‬א‬ ‫ַ‬ ‫שפּראך לגבי ווערטער ־ אוצר און‬ ‫ַ‬ ‫די ַאנטוויקלונג ון דער‬ ‫שפּראכיקע איינסן אין ַאנדערן ווערק‬ ‫ַ‬ ‫נטראלירן די‬ ‫ָ‬ ‫כקא‬ ‫ָ‬ ‫נא‬ ‫דאס ָ‬ ‫באשיידענערע ַארבעט׃ ָ‬ ‫ַ‬ ‫האט זיך‬ ‫שפּראך — ַאזוי ווי זי ָ‬ ‫ַ‬ ‫זײן‬ ‫שרײבונג ון ַ‬ ‫ַ‬ ‫בא‬ ‫ון זעלבן מחבר‪ ,‬כּדי צו פּרעציזירן די ַ‬ ‫באוויזן אוין סמך ון „צאינה ־ וראינה “‪.‬‬ ‫ַ‬ ‫הײנט פּרוּוון אויסצוילן‪ . . .‬און איך‬ ‫פּראיעקט וויל איך ַ‬ ‫ָ‬ ‫באשיידענערן‬ ‫דעם צווייטן‪ַ ,‬‬ ‫וואס זענען‬ ‫ארשטייט זיך‪ ,‬אויף די אויסגעינסן וועגן „צאינה ־ וראינה “‪ָ ,‬‬ ‫בין זיך סומך‪ַ ,‬‬ ‫ארן‬ ‫וואס איז ספּעצייש ַ‬ ‫דאס ָ‬ ‫רשווײגן ָ‬ ‫ַ‬ ‫א‬ ‫קאנט — איך וועל ָאבער ַאוודאי ניט ַ‬ ‫בא ַ‬ ‫שוין ַ‬ ‫רגלײך ברענגט‬ ‫ַ‬ ‫א‬ ‫ווײזט זיך ַארויס ַאז דער פּשוטער ַ‬ ‫נאך‪ַ ,‬אז עס ַ‬ ‫„מליץ ־ יושר “‪ . . .‬ווער רעדט ָ‬ ‫ניט קיין גרויסע חידושים !‬ ‫ביבליא־‬ ‫ָ‬ ‫באקענען מיט דעם בוך און מיט דער ספּעציישער‬ ‫אײך ַ‬ ‫לאמיך אויב ַאזוי ַ‬ ‫ָ‬ ‫באזעלער‬ ‫פּסעוודא ־ ַ‬ ‫ָ‬ ‫לאגע‪ .‬די „צאינה ־ וראינה “ איז געקומען צו אונדז אין ַא‬ ‫גראישער ַ‬ ‫ַ‬ ‫האט ריִ ער שוין‬ ‫וואס איז אונדזער איינציקער עדות וועגן דעם‪ַ ,‬אז מע ָ‬ ‫דרוק ון ‪ָ 1622‬‬ ‫מאל !‬ ‫דרײ ָ‬ ‫ַ‬ ‫אייראפּע ַאילו‬ ‫ָ‬ ‫געהאט געדרוקט די „צאינה ־ וראינה “ אין מיזרח ־‬ ‫ַ‬ ‫עקזעמפּלארן ון ַאן ַאמסטער־‬ ‫ַ‬ ‫פּאר‬ ‫רמאגן ַא ָ‬ ‫ָ‬ ‫א‬ ‫מיטן „מליץ ־ יושר “ איז ענלעך ׃ מיר ַ‬ ‫דאס ערשטע‬ ‫דארטן קען מען דרינגען ַאז ָ‬ ‫יאר ‪ . . .1688‬און ון ַא הסכּמה ָ‬ ‫דאמער דרוק ון ָ‬ ‫ַ‬ ‫עקזעמפּלאר ון לובלינער‬ ‫ַ‬ ‫יאר ‪ — .1622‬קיין איין‬ ‫האט מען עס געדרוקט אין לובלין אין ָ‬ ‫מאל ָ‬ ‫ָ‬ ‫הײנט נישט בנימצא‪.‬‬ ‫אוילאגע איז ַ‬ ‫ַ‬ ‫בײם סוף ון „‪11‬טן‬ ‫דיסלדארף ַ‬ ‫ָ‬ ‫געהאלטן דעם ‪24‬סטן סעפּט‪ 2008 .‬אין‬ ‫ַ‬ ‫רעעראט‬ ‫ַ‬ ‫דאס איז דער טעקסט ון ַא‬ ‫ָ‬ ‫זא יו‪#‬ל ־ בוך ווי דער‬ ‫אר ַא ַ‬ ‫פּאסיק ַ‬ ‫טשלאנד “‪ .‬צוליב דעם איז עס ַ‬ ‫ַ‬ ‫דײ‬ ‫אר ייִ דישע שטודיעס אין ַ‬ ‫סימפאזיום ַ‬ ‫ָ‬ ‫זײן ַאלע‬ ‫האף איך ַאז די געברענגטע אויסגעינסן וועלן אינטערעסירן און נוצלעך ַ‬ ‫באנד — און ַאחוץ דעם ָ‬ ‫ָא ַ‬ ‫ליטעראטור‪.‬‬ ‫ַ‬ ‫ליבהאבערס ון „צאינה ־ וראינה “ און ון דער קרו‪#‬ישער‬ ‫ָ‬ ‫הײנט‬ ‫לקט ‪ +‬ייִ דישע שטודיעס ַ‬ ‫ווײזט אויס ַאז דער מחבר —‬ ‫צוגאב צו דער „צאינה ־ וראינה “‪ַ ,‬‬ ‫ָ‬ ‫זײן ַא‬ ‫דאס בוך וויל ַ‬ ‫ָ‬ ‫בארימט‬ ‫זײן ַ‬ ‫דעראלג ון ַ‬ ‫ָ‬ ‫זא גרויסן‬ ‫געהאט דערלעבט ַא ַ‬ ‫ַ‬ ‫האט‬ ‫יעק‪ #‬בן יצחק ַאשכּנזי — ָ‬ ‫רגלײך אינעם פּרט‬ ‫ַ‬ ‫א‬ ‫נאר קיין ַ‬ ‫זײן רעצעפּט‪ָ ,‬‬ ‫מאל ַ‬ ‫נאך ַא ָ‬ ‫געוואלט ניצן ָ‬ ‫ָ‬ ‫האט‬ ‫בוך‪ַ ,‬אז ער ָ‬ ‫ווײזט‬ ‫האט ַ‬ ‫זײן‪ .‬די „צאינה ־ וראינה “ ָ‬ ‫גאר ניט ַ‬ ‫אויסגאבעס ( קען ָ‬ ‫ַ‬ ‫געמאסטן אין‬ ‫ָ‬ ‫דעראלג )‬ ‫ָ‬ ‫באדערענישן‪ ,‬קיין צווייט בוך‬ ‫אר די מערסטע לייענערס ולשטענדיק געדעקט די ַ‬ ‫אויס ַ‬ ‫געדארט‪.‬‬ ‫ַ‬ ‫האט מען ניט‬ ‫ון דעם מין ָ‬ ‫צוגאב ־ דער־‬ ‫ָ‬ ‫מאל‬ ‫נאר גיט ַא ָ‬ ‫וואס דער מחבר חזרט ניט איבער‪ָ ,‬‬ ‫אינטערעסאנט ָ‬ ‫ַ‬ ‫האב איבערגעציילט ) ַאחוץ‬ ‫זײן ריִ ערדיקן בעסט ־ סעלער‪ .‬איך ָ‬ ‫דערמאנט ַ‬ ‫ָ‬ ‫קלערונגען און‬ ‫דאס בוך „צאינה ־ וראינה “‬ ‫רײניר ( ‪ 12‬ערטער וווּ ָ‬ ‫דערמאנונגען ון בוך אין ַא ַ‬ ‫ָ‬ ‫דרײ‬ ‫ַ‬ ‫די‬ ‫בײשפּיל ַאזוי ׃‬ ‫נאמען‪ ,‬צום ַ‬ ‫בײם ָ‬ ‫ווערט ָאנגערון ַ‬ ‫‪1‬‬ ‫‪( 7 v b, l. 35 ) in s̀efer Ze̍’ene̱-uRe̍ ’ ene̱ štėt‬‬ ‫] … [ ‪noch ain thėrez‬‬ ‫] ‪ [ 1‬אין סר צאנה וראנה שטיט נאך איין תירוץ‬ ‫] ‪[...‬‬ ‫ָאדער‬ ‫‪( 10v a, l. 47 ) es sein ĳil pe̍šotim ouf das‬‬ ‫̱‪ ) as̱ do štėt in s̀efer ( Ze̍ ’ ene‬כיום ( ‪wort‬‬‫‪uRe̍ ’ ene̱ ) abe̍r ma̍ n kan noch mėn sage̍n‬‬ ‫] … [ ‪ce̍lȯme̍r‬‬ ‫] ‪ [ 2‬עש זיין יל פשטים אויף דאש ווארט ) כיום (‬ ‫אז דא שטיט אין סר ) צאנה וראנה ( אבר מן קאן‬ ‫נאך מין זאגן כלומר ] ‪[ . . .‬‬ ‫ָאדער‬ ‫‪( 50v a, l. 1 ) fun dise̍r s̀edre̱ hot ma̍ n‬‬ ‫̱‪gėnuge̍n gėret in dem ( s̀efer Ze̍ ’ ene‬‬‫] … [ ) ̱‪uRe̍ ’ ene‬‬ ‫] ‪ [ 3‬ון דיזר סדרה האט מן גינוגן גירעט אין‬ ‫דעם ) סר צאנה ־ וראנה ( ] ‪[ . . .‬‬ ‫דערמאנונגען ון ַאנדערע ייִ דישע‬ ‫ָ‬ ‫ליטעראטור זענען ַאזעלכע‬ ‫ַ‬ ‫אין דער עלטערער ייִ דישער‬ ‫צונויקלײבן‪ָ ,‬אבער נישט‬ ‫ַ‬ ‫וואלט ַאזעלכעס ַאוודאי געמעגט‬ ‫ביכער גענוג זעלטן‪ ,‬און מע ָ‬ ‫דאס ָארט ‪. . .‬‬ ‫דא איז ָ‬ ‫ָ‬ ‫גראיע ון ייִ דישע ביכער געדרוקטע אין פּוילן ַאז‬ ‫ביבליא ַ‬ ‫ָ‬ ‫זײן‬ ‫זאגט אין ַ‬ ‫חנא שמערוק ָ‬ ‫נאענטע קרו‪#‬ה ון דער לובלינער ‪editio princeps‬‬ ‫אויסגאבע איז ַא ָ‬ ‫ַ‬ ‫אונדזער‬ ‫— און‬ ‫ונאנדערשיידן די ַארבעט‬ ‫ַ‬ ‫ארשיידענע סימנים‬ ‫ער איז מסתּמא גערעכט׃ מע קען לויט ַ‬ ‫האב ַא חשד‬ ‫צוזאמען געגרייט דעם „מליץ ־ יושר “ און איך ָ‬ ‫ַ‬ ‫האבן‬ ‫וואס ָ‬ ‫ון צוויי זעצערס ָ‬ ‫געמאכט די‬ ‫ַ‬ ‫האבן‬ ‫וואס ָ‬ ‫מסטערדאמער ַארבעטער‪ ,‬ווי די ָ‬ ‫ַ‬ ‫דאס זענען נישט ַאזוי די ַא‬ ‫ַאז ָ‬ ‫זײטל‬ ‫אר ַא ַ‬ ‫זײטל ַ‬ ‫פּראקטיש אות באות און ַא ַ‬ ‫ַ‬ ‫האט יענע‬ ‫עלטערע לובלינער‪ ,‬און ַאז מע ָ‬ ‫מסטערדאם‪.‬‬ ‫ַ‬ ‫איבערגעדרוקט אין ַא‬ ‫אר ַאלטייִ דיש;‬ ‫טראנסקריפּציע ַ‬ ‫ַ‬ ‫ריגינאל און אין ( דער ָאנגענומענער‬ ‫ַ‬ ‫ציטאטן ווערן געברענגט אין ) ָא‬ ‫ַ‬ ‫‪ 1‬די‬ ‫גאנצן ‪ָ 15‬‬ ‫דערמאנט אין ַ‬ ‫ָ‬ ‫„צאינה ־ וראינה “ ווערט‬ ‫מאל ) ‪ ,1r b‬ש‪ ,2va ,35 .‬ש‪ ,7 v b ,26 ,20 .‬ש‪ ,10 va ,35 .‬ש‪,48 .‬‬ ‫‪ ,12va‬ש‪ ,12v b ,15 .‬ש‪ ,14r b ,56 .‬ש‪ ,15 ra ,53 .‬ש‪ ,25r b ,24 — 23 .‬ש‪ ,35r b ,48 .‬ש‪ ,50va ,34 ,6 .‬ש‪ ,53v b ,1 .‬ש‪,10 .‬‬ ‫‪ ,72ra‬ש‪.(1 .‬‬ ‫‪358‬‬ ‫‪Simon Neuberg : Die Sprache des Meliz-jȯšer 359‬‬ ‫ארשיידענע זעצערס‬ ‫זא פּרוּוו צו דערקענען לויט דעם אויסלייג די ַארבעט ון ַ‬ ‫ַא ַ‬ ‫ארשיידענע ַאלטייִ דישע ביכער‪. . .‬‬ ‫נאליזירנדיק ַ‬ ‫ארגעשטעלט‪ַ ,‬א ַ‬ ‫מאל ָ‬ ‫האב איך עטלעכע ָ‬ ‫ָ‬ ‫באלד מיר עענען‬ ‫מאל‪ ,‬ווי ַ‬ ‫נאך ַא ָ‬ ‫טאן ָ‬ ‫נהאלטן‪ ,‬איך מוז עס ָ‬ ‫אײ ַ‬ ‫איך קען זיך ָאבער נישט ַ‬ ‫מאכן בקיצור‪ . . .‬און ריִ ער פּטרן‬ ‫דאס ־ ָא בוך ! איך וועל פּרוּוון עס ַ‬ ‫מאל ָאט ָ‬ ‫דאס ערשטע ָ‬ ‫ָ‬ ‫רגלײך מיט „צו ׳׳ ר ”‪.‬‬ ‫ַ‬ ‫א‬ ‫צוגעזאגטן ַ‬ ‫ָ‬ ‫דעם‬ ‫זאל‬ ‫דערשאצן די ווירקונג ון די זעצערס‪ ,‬מע ָ‬ ‫ַ‬ ‫ַאוודאי איז וויכטיק צו פּרוּוון‬ ‫שפּראך ונעם‬ ‫ַ‬ ‫ווײט מעגלעך — ביז צו דער‬ ‫דערנאכדעם פּרוּוון דורכקוקן — אויף ווי ַ‬ ‫ָ‬ ‫זײן גענוג‬ ‫טאן זייער פּרטימדיק‪ ,‬און עס וועט ַ‬ ‫הײנט ניט ָ‬ ‫דאס קען איך ָאבער ַ‬ ‫מחבר גוא‪ָ .‬‬ ‫סאמע ערשטן ון‬ ‫לאמיר בעסער ָאנהייבן מיט גרעסערע איינסן‪ ,‬און צום ַ‬ ‫קאמפּליצירט‪ָ .‬‬ ‫ָ‬ ‫דערמאנען‪,‬‬ ‫ָ‬ ‫כּדאי צו‬ ‫ַ‬ ‫סלאווישע ווערטער‪ .‬ס׳איז נישט‬ ‫ַ‬ ‫דהײנו די‬ ‫ַ‬ ‫ענאמענען‪,‬‬ ‫ָ‬ ‫אויבנאוייקע‬ ‫פּשטאם אין‬ ‫ַ‬ ‫סלאווישן ָא‬ ‫ַ‬ ‫צונויצוקלײבן ַאילו געציילטע ווערטער ון‬ ‫ַ‬ ‫ווי וויכטיק עס איז‬ ‫יא איבערצוחזרן‪ַ ,‬אז אין „צאינה ־ וראינה “‬ ‫ַא טעקסט ון זיבעצעטן י ׳׳ ה; עס לוינט זיך ָאבער ָ‬ ‫דאך‬ ‫ווײל זיי זענען ָ‬ ‫ַ‬ ‫וואס רעכענען זיך נישט‬ ‫ָ‬ ‫אר ַאחוץ „קריין “ און „ נעבעך “‬ ‫קומען ָ‬ ‫„קאברעץ “ — „ פּלייצע “ געינט זיך‬ ‫ָ‬ ‫ארש פּ רייט אין עלטערן מער‪ #‬־ ייִ דיש׃ „ פּלייצע “ און‬ ‫ַ‬ ‫דאס ניט קיין גרויסער‬ ‫אייראפּע איז ָ‬ ‫ָ‬ ‫זא דיק בוך ון מיזרח ־‬ ‫בײ ַא ַ‬ ‫מאל‪ַ . . .‬‬ ‫דארטן ַאילו צוויי ָ‬ ‫ָ‬ ‫שניט — ָאבער ַאזוי איז עס‪.‬‬ ‫סלאווישע‬ ‫ַ‬ ‫ארזיכטיק און ניצט ווינציק‬ ‫אויך אין „ מליץ ־ יושר “ איז דער מחבר ָ‬ ‫צײט‬ ‫כאטש עס וועט ניט נעמען קיין סך ַ‬ ‫ארט ַא ביסל מער‪ָ ,‬‬ ‫ווערטער‪ָ ,‬אבער מע געינט ָ‬ ‫דאס בוך‬ ‫באלד ָ‬ ‫זיי ַאלע איבערצוציילן‪ .‬אין דער אמתן געינט מען ווידער צוויי‪ָ ,‬אבער ווי ַ‬ ‫רײנרעכענען‬ ‫ארנעם איז לערך ַא העלט ון „צאינה ־ וראינה “‪ ,‬אויב ַא ַ‬ ‫איז קלענער ) דער ַ‬ ‫ווארט „ פּלייצע “ —‬ ‫דאס ָ‬ ‫ארט מער ! מע געינט ווידער ָ‬ ‫ביידע בענד ון צו ׳׳ ר ( איז עס ָ‬ ‫וואס‬ ‫ָ‬ ‫כאטשע “‬ ‫ווארט „ ָ‬ ‫ָ‬ ‫דאס‬ ‫מאל ! און ָ‬ ‫ָ‬ ‫דרײ‬ ‫ַ‬ ‫גאנצע‬ ‫מאל׃ ַ‬ ‫ָ‬ ‫מאל נישט צוויי‬ ‫ָ‬ ‫דאס‬ ‫נאר ָ‬ ‫ָ‬ ‫ארשפּרייט אין מער‪ ,#‬ווייס איך ניט וועגן קיין‬ ‫ווארט איז ַ‬ ‫דאס ָ‬ ‫כאטש ַא סך מיינען ַאז ָ‬ ‫ָ‬ ‫אר דער‬ ‫ווארט „פּלייצע “ ווערט געניצט ווי אין „צאינה ־ וראינה “ ַ‬ ‫דאס ָ‬ ‫עלטערע מקורים‪ָ . . .‬‬ ‫שטאמיקן‬ ‫ַ‬ ‫דײטשיש ־‬ ‫בײ ַא בהמה לעבן דעם ַאלטרענקישן ַ‬ ‫באצייכענונג ון דעם לייש ַ‬ ‫ַ‬ ‫האט איר ַא‬ ‫מאל‪ָ .‬אט ָ‬ ‫גאנצע זיבן ָ‬ ‫אר ַ‬ ‫כאטשע “ קומט ָ‬ ‫ווארט „ ָ‬ ‫דאס ָ‬ ‫עקוויוואלענט „ בוג “‪ָ .‬‬ ‫ַ‬ ‫מאל ׃‬ ‫ציטאט מיט ביידע ווערטער מיט ַא ָ‬ ‫ַ‬ ‫‪( 69 r b, l. 41 – 47 ) dorum hot im hakodeš‬‬‫‪boruch-hu’ haiße̍n gebe̍n das best fun‬‬ ‫‪de̍r ga̍ nze̍r ( be̍heme̱ ) da̍ s̱ is̱ fun den‬‬ ‫̱‪kopf di’ kin-bake̍n mit der zung das is‬‬ ‫’‪da̍ s bestė fun der ga̍ nze̍r ( be̍heme̱ ) un‬‬ ‫‪der-noch di’ ( se̍rȯe‘ ) da̍ s hot zwė’ march‬‬‫‪baine̍r da̍ s is̱ auch da̍ s bestė / 45 / eße̍n‬‬ ‫’‪wen ḥotschė der schenkėl auch hot zwai‬‬ ‫‪march-baine̍r is̱ da̍ s fun den bu`g ȯde̍r‬‬ ‫‪plėz`ẹ doch beße̍r weil es nohe̍nte̍r is̱ zu‬‬ ‫̱‪den ha̍ ls̱ wu da̍ s lebe̍n bei’ de̍r be̍heme‬‬ ‫‪is̱ .‬‬ ‫‪2‬‬ ‫] ‪ [ 4‬דארום האט אים הקדוש ברוך הוא היישן‬ ‫געבן דאש בעשט ון דר גנצר ) בהמה ( דז איז‬ ‫ון דען קאפף דיא קין באקן מיט דער צונג דאש‬ ‫איז דש בעשטי ון דער גנצר ) בהמה ( אונ׳ דער‬ ‫נאך דיא ) זרוע ( דש האט צוויא מארך ביינר דש‬ ‫איז אויך דש בעשטי ‪ / 45 /‬עשן ווען חאטשי דער‬ ‫שענקיל אויך האט צווייא מארך ביינר איז דש‬ ‫ון דען בו׳ג אודר פליצ׳א דאך בעשר ווייל עש‬ ‫נאהנטר איז צו דען הלז וואו דש לעבן בייא דר‬ ‫בהמה איז•‬ ‫סלאוויזמען׃ פּליצ׳א ) ‪ ,38 v b‬ש‪ ,69 r b ,49 .‬ש‪ ;( 46 ,27 .‬חאטשי ) ‪ ,40 va‬ש‪,45 r b ,10 .‬‬ ‫ַ‬ ‫‪ 2‬די ירקומענישן ון‬ ‫ש‪ ,69r b ,31 .‬ש‪ ,69 va ,45 .‬ש‪ ,69 v b ,32 ,31 .‬ש‪ ,72va ,20 .‬ש‪.( 53 .‬‬ ‫הײנט‬ ‫לקט ‪ +‬ייִ דישע שטודיעס ַ‬ ‫פּאר מיט „ בוג “‬ ‫וואס עס ווערט געניצט אין ַא ָ‬ ‫אר און ָ‬ ‫וואס „ פּלייצע “ קומט ָ‬ ‫אקט ָ‬ ‫דער ַ‬ ‫כאטשע “ ָאבער ניט׃ אין צו ׳׳ ר איז‬ ‫באניץ ון „ ָ‬ ‫שטארק אין צו ׳׳ ר‪ . . .‬דער ָאטער ַ‬ ‫ַ‬ ‫דערמאנט‬ ‫ָ‬ ‫נישטא!‬ ‫ָ‬ ‫ווארט‬ ‫דאס ָ‬ ‫ָ‬ ‫כאטש “׃ אין דעם‬ ‫טײטן ון „ ָ‬ ‫בא ַ‬ ‫קאנטע ַ‬ ‫בא ַ‬ ‫הײנט ַ‬ ‫האט ביידע ביז ַ‬ ‫כאטשע “ ָ‬ ‫ַאג‪ָ „ ,#‬‬ ‫טײט‬ ‫בא ַ‬ ‫פּאזיציע‪ ,‬עלעהיי „ הגם “‪ ,‬דער ַ‬ ‫באצייכנט עס ַאן ָא ָ‬ ‫ציטאט ַ‬ ‫ַ‬ ‫דערמאנטן‬ ‫ָ‬ ‫ָאקערשט‬ ‫דא למשל אין ׃‬ ‫„לכל ־ הפּחות “ איז ָ‬ ‫‪( 69 va, l. 29 – 33) da̍ s sein di’ baine̍r fun‬‬ ‫‪den kor ben di’ do bei’-tag sein noch nit‬‬ ‫‪fe̍r-brent / 30 / ge̍wore̍n habe̍n si’ muse̍n‬‬ ‫‪achtung habe̍n da̍ s̱ si’ sole̍n fe̍r-brent‬‬ ‫‪were̍n ḥotschė ain ga̍ nzė na̍ cht .‬‬ ‫] ‪ [ 5‬דש זיין דיא ביינר ון דען קרבן דיא דא בייא‬ ‫טאג זיין נאך ניט ר ברענט ‪ / 30 /‬גווארן האבן‬ ‫זיא מוזן א=טונג האבן דז זיא זאלן ר ברענט‬ ‫ווערן חאטשי איין גנצי נכט•‬ ‫מײן השערה ַאכטונג‬ ‫האט אין צו ׳׳ ר לויט ַ‬ ‫וואס ָ‬ ‫זײן ַאז דער מחבר‪ָ ,‬‬ ‫מע קען זיך משער ַ‬ ‫ארשטענדלעך בכל תּוצות ַאשכּנז און אויסגעמיטן‬ ‫זײן ַ‬ ‫זאל ַ‬ ‫שפּראך ָ‬ ‫ַ‬ ‫זײן‬ ‫געגעבן‪ַ ,‬‬ ‫סלאווישע ווערטער ווי אויך ַאנדערע ספּעציישע אויסדרוקן ון דעם ָאדער יענעם געביט‪,‬‬ ‫ַ‬ ‫כאטש “ איז געווען ַאזוי‬ ‫ווארט „ ָ‬ ‫דאס ָ‬ ‫געווארן ווינציקער ָאפּגעהיטן — ָאדער ָ‬ ‫ָ‬ ‫איז ש פּ עטער‬ ‫סײדן די‬ ‫נגבאר אין מער‪ַ . . .#‬‬ ‫ַ‬ ‫גא‬ ‫דאס איז ניט ַ‬ ‫ארגעסן‪ַ ,‬אז ָ‬ ‫האט שוין ַ‬ ‫ארשפּרייט ַאז ער ָ‬ ‫ַ‬ ‫באעוולט׃‬ ‫האבן אונדז ַ‬ ‫מער‪#‬דיקע איבערדרוקער ון „צאינה ־ וראינה “ ָ‬ ‫מאל‬ ‫אר אין צו ׳׳ ר ‪ָ 9‬‬ ‫„לכל ־ הפּחות “ קומט ָ‬ ‫מאל‬ ‫און אין „ מליץ ־ יושר “׃ ‪ָ 6‬‬ ‫מאל‬ ‫אר אין צו ׳׳ ר ‪ָ 15‬‬ ‫גלײך “ קומט ָ‬ ‫„ווען ־ ַ‬ ‫מאל‪. . .‬‬ ‫און אין „מליץ ־ יושר “׃ ‪ָ 6‬‬ ‫ווארט אין‬ ‫ארטרעטן ַאן ַאנדער ָ‬ ‫גלײך “ ַ‬ ‫זײן ַאז טייל ון די ־ ָא „ ווען ־ ַ‬ ‫געמאלט ַ‬ ‫ָ‬ ‫צי קען אשר‬ ‫ארלוירענע פּוילישע דרוקן ?‬ ‫דעם מחברס כּת‪ #‬־ יד און ַאילו אין די ַ‬ ‫סלאווישע ווערטער‬ ‫ַ‬ ‫כאטש “ איז ון די‬ ‫האב איך געהערט ַא מיינונג ַאז „ ָ‬ ‫געזאגט‪ָ ,‬‬ ‫ָ‬ ‫ווי‬ ‫באוו וּ סט‪,‬‬ ‫יא אין מער‪ #‬אויך‪ָ ,‬אבער מיר איז עס ון מער‪#‬דיקע מקורים ניט ַ‬ ‫וואס מע געינט ָ‬ ‫ָ‬ ‫בײשפּילן ווי די ון „ מליץ ־ יושר “‪.‬‬ ‫און איך קען בכלל ניט קיין עלטערע ַ‬ ‫„כאטש “‬ ‫ָ‬ ‫בײ מיר דער עלטסטער‬ ‫האב ניט געלייענט דעם „ מליץ ־ יושר “ איז ַ‬ ‫ביז איך ָ‬ ‫מאל‪,‬‬ ‫אר בלויז איין ָ‬ ‫געווען אין „ גלילות ־ ישׂראל “‪ ,‬געדרוקט אין לובלין ‪ ,1635‬וווּ עס קומט ָ‬ ‫יארן‬ ‫דאס איז מיט ַא טוץ ָ‬ ‫האט זיך געדרוקט אין פּוילן‪ ,‬און ָ‬ ‫וואס ָ‬ ‫דאס איז אויך ַא בוך ָ‬ ‫און ָ‬ ‫ש פּעטער ווי דער ערשטער „ מליץ ־ יושר “ !‬ ‫כאטש‬ ‫מאדערן‪ָ ,‬‬ ‫גאנץ היימיש און ָ‬ ‫וואס קלינגען ַ‬ ‫עס עלן אויך ניט אין בוך אויסדרוקן‪ָ ,‬‬ ‫שטאמיקע‬ ‫ַ‬ ‫סלאוויש ־‬ ‫ַ‬ ‫ווײל זיי זענען ניט קיין‬ ‫זייער געשיכטע איז שווערער צו דערגרונטעווען ַ‬ ‫און זייער געשיכטע הייבט זיך ַאוודאי ָאן אין מער‪.#‬‬ ‫דארטן אין‬ ‫דא און ָ‬ ‫וואס געינען זיך ָ‬ ‫ָ‬ ‫פּאר ווערטער‬ ‫דערמאנען ַא ָ‬ ‫ָ‬ ‫לאמיך בלויז‬ ‫ָ‬ ‫„ מליץ ־ יושר “‪.‬‬ ‫וואס געינען זיך אויך אין ריִ ערדיקע טעקסטן‪,‬‬ ‫רנאטירט ווערטער ָ‬ ‫א ָ‬ ‫האב ַ‬ ‫איך ָ‬ ‫רעלאטיוו זעלטענע און חנעוודיקע דערצו‪ ,‬ווי למשל עטלעכע שיינע‬ ‫ַ‬ ‫וואס זענען ָאבער‬ ‫ָ‬ ‫„פּאלעש “ ‪ /‬פּאלש ‪ ,71va ) /‬ש‪ ( 41 ,37 ,34 ,31 ,29 ,25 ,23 .‬די געשיכטע‬ ‫ָ‬ ‫ירקומענישן ון‬ ‫סעמאנטיק “ (‪,‬‬ ‫ַ‬ ‫„היסטארישער ייִ דישער‬ ‫ָ‬ ‫באשריבן אין איר‬ ‫האט רוי טים ַ‬ ‫ווארט ָ‬ ‫ון דעם ָ‬ ‫פּארטיציפּ ן‬ ‫דאקטוירים “ ‪ /‬דוקטורים ‪ ,39va ) /‬ש‪ ,( 37 .‬די ַ‬ ‫אר דער מ ׳׳ צ „ ָ‬ ‫בײשפּיל ַ‬ ‫איין ַ‬ ‫געמאסטן “ ‪ /‬גימאשטן ‪ ,37v b ) /‬ש‪,( 37 .‬‬ ‫ָ‬ ‫געארכטן “ ‪ /‬גיארכטן ‪ ,51va ) /‬ש‪ (19 .‬און „‬ ‫ָ‬ ‫„‬ ‫‪360‬‬ ‫‪Simon Neuberg : Die Sprache des Meliz-jȯšer 361‬‬ ‫דער אויסדרוק „ מיטן דערינען “ ‪ /‬מיטן ד ) א ( רינן ‪ ,9 ra) /‬ש‪ ,37 ra ,58 .‬ש‪ ,64 ra ,19 .‬ש‪,32 .‬‬ ‫ווארט‬ ‫ָ‬ ‫דאס‬ ‫דא אין צו ׳׳ ר‪ ,‬ווי אויך ָ‬ ‫וואס איז ַאג‪ #‬אויך ָ‬ ‫ָ‬ ‫‪ ,64r b‬ש‪ ,69 ra ,13 — 12 .‬ש‪(46 .‬‬ ‫ווארט‬ ‫דאס ָ‬ ‫אדעם “ ‪ /‬אדם ‪ /‬עדם )ל׳׳ר( ‪ ,31v b) /‬ש‪ ,40 va ,18 .‬ש‪ ,54v b ,29 .‬ש‪ָ ,(38 ,34 .‬‬ ‫„ ָ‬ ‫באליבטסטער‬ ‫מײן ַ‬ ‫אר‪ַ ,‬‬ ‫דארטן קומט עס ניט ָ‬ ‫וואס ָ‬ ‫„ אומעטום “ ‪ /‬אומטום ‪ ,55 ra) /‬ש‪ָ (52 .‬‬ ‫זאץ איז ָאבער מסתּמא דער ־ ָא ׃‬ ‫ַ‬ ‫‪( 46 ra, l. 56 ) do is̱ koše̱ pe̍šitẹ wen er wert‬‬ ‫‪ru’e̍n bei’ Jiśro ’el hakodeš-boruch-hu’ .‬‬ ‫‪un’ wi’ hėbt sich an da̍ s̱ es solt hkb ’h‬‬ ‫]‪mi’es̀ sein fa̍ r Jiśro ’el . der thėrez is̱ [...‬‬ ‫] ‪ [ 6‬דא איז קשה פשיטא ווען ער ווערט רואן‬ ‫בייא ישראל הקדוש ברוך הוא • אונ ׳ וויא היבט‬ ‫זיך אן דז עש זאלט הקב ׳ ה מיאוס זיין ר ישראל‬ ‫• דער תירוץ איז ] ‪[ . . .‬‬ ‫נעגאטיווע און‬ ‫ַ‬ ‫זײן “ ) אין‬ ‫געמאלט ַ‬ ‫ָ‬ ‫זײן‪,‬‬ ‫טײטש „ מעגלעך ַ‬ ‫אר „זיך ָאנהייבן “ מיטן ַ‬ ‫דא קומט ָ‬ ‫ָ‬ ‫האבן געלייענט אין ַא ריִ ערדיקן‬ ‫זאל עס ָ‬ ‫דאס געדענק איך ניט‪ַ ,‬אז איך ָ‬ ‫רעגזאצן (‪ָ .‬‬ ‫ַ‬ ‫אין‬ ‫מאל (‪,‬‬ ‫אר ) ‪ָ 13‬‬ ‫וואס עס קומט ָ‬ ‫דאס‪ָ ,‬‬ ‫טשיקאווע זעט מיר אויך אויס ָ‬ ‫ַ‬ ‫טעקסט‪ . . .‬און זייער‬ ‫וואדען ? “ — רעג איך זיך‪ ,‬צי עס איז‬ ‫געזאגט „ אלא ָ‬ ‫ָ‬ ‫וואלט מסתּמא‬ ‫„ אלא ודאי “ ‪ 3‬וווּ איך ָ‬ ‫בײ ַאנדערע !‬ ‫דארף איך ָאבער שוין רעגן ַ‬ ‫דאס ַ‬ ‫ארבינדונג ‪ָ . . .‬‬ ‫ניטא אשר ַא ַ‬ ‫ָ‬ ‫דא ָאן ַא‬ ‫נאך ָ‬ ‫דערמאנען ַאז ס׳איז ָ‬ ‫ָ‬ ‫געוואלט‬ ‫ָ‬ ‫האב איך דער עיקר‬ ‫מיט דער ־ ָא רשימה ָ‬ ‫אויסגעארשט — און יעדער בוך‬ ‫ָ‬ ‫דארף ערשט ווערן‬ ‫וואס זייער געשיכטע ַ‬ ‫שיעור ווערטער ָ‬ ‫צושטײער‪.‬‬ ‫ַ‬ ‫זײן‬ ‫ברענגט דערצו ַ‬ ‫רגלײכן ביידע חיבורים‪ ,‬לייגט זיך אוין שׂכל‬ ‫ַ‬ ‫א‬ ‫האבן שוין ָאנגעהויבן ַ‬ ‫ָאבער ַאז מיר ָ‬ ‫ווײזן ַאז געוויסע טיילן‪,‬‬ ‫האב געניצט אויף צו ַ‬ ‫וואס איך ָ‬ ‫נטראלירן די קריטעריעס ָ‬ ‫ָ‬ ‫כקא‬ ‫ָ‬ ‫נא‬ ‫ָ‬ ‫נאר ַאז ער‬ ‫באנד צו ׳׳ ר זענען דווקא ניט ון דעם זעלביקן מחבר‪ָ ,‬‬ ‫דער עיקר ונעם צווייטן ַ‬ ‫וואס‬ ‫דאס זעט זיך דורך דעם‪ָ ,‬‬ ‫האט איבערגעשריבן ָאדער איבערגעדרוקט ון גרייטן‪ָ — .‬‬ ‫ָ‬ ‫זײן‬ ‫וואס זענען געוויינטלעך ניט אין ַ‬ ‫אר ָ‬ ‫דארט ָ‬ ‫געוויסע ווערטער און אויסדרוקן קומען ָ‬ ‫בולאר‪.‬‬ ‫ַ‬ ‫קא‬ ‫ווא ַ‬ ‫ָ‬ ‫דאס‬ ‫באלד ָ‬ ‫זײן אין „ מליץ ־ יושר “‪ ,‬ווי ַ‬ ‫טארן אין פּרינציפּ אויך ניט ַ‬ ‫די ־ ָא ווערטער ָ‬ ‫טאקע געינט זיך צ ׳׳ב נישט ‪(1‬‬ ‫שפּראך‪ַ — .‬‬ ‫ַ‬ ‫זײן‬ ‫באשריבן ַ‬ ‫האב גוט ַ‬ ‫ָ‬ ‫זײנס און איך‬ ‫איז ַ‬ ‫מאל אין צו ׳׳ ר אין דער קליינער כּמו ־ מגילה וועגן‬ ‫אר ‪ָ 5‬‬ ‫וואס קומט ָ‬ ‫„צונויף “ ) ‪ /‬צו ־ הויף ‪ָ ( /‬‬ ‫נישטא אין‬ ‫ָ‬ ‫דאס איז בכלל‬ ‫חורבן ־ ירושלים ) זיכער נישט ון דער עדער ון בעל ־ הצו ׳׳ ר (‪ָ .‬‬ ‫נישטא אין „ מליץ ־ יושר “‪.‬‬ ‫ָ‬ ‫דעם רעשט טעקסט — און אויך‬ ‫שטאטס „ער הערט “‪( 7 ,‬‬ ‫ָ‬ ‫הארט “ ) ‪ /‬הורט ‪( /‬‬ ‫ארעם ‪„ ( 5‬ער ָ‬ ‫ַאזוי איז אויך מיט דער ָ‬ ‫רגאנגענע‬ ‫א ַ‬ ‫אר ־ “‪ (13 ,‬די ַ‬ ‫שטאטס „ער ־ ‪ַ /‬‬ ‫ָ‬ ‫אר ווערבן‬ ‫אר ־ “ ) ‪# /‬ור ‪ ( /‬ווי ַא פּרעיקס ַ‬ ‫„ ָ‬ ‫וואר “ ָאדער „ איז געווען “‪ ,‬און ‪„ (14‬מענטש “ מיט ַא טית ווי‬ ‫שטאטס „ ַ‬ ‫ָ‬ ‫וואס “ ) ‪ /‬וואש ‪( /‬‬ ‫צײט „ ַ‬ ‫ַ‬ ‫אר איין‬ ‫יא ָ‬ ‫מאדערנעם כּללישן אויסלייג‪ַ .‬אנדערע ון די „געפּסלטע “ ווערטער קומען ָ‬ ‫אין ָ‬ ‫זײן קיין שטער‪ .‬איין קריטעריע ָאבער‬ ‫זאל ניט ַ‬ ‫מאל‪ָ ,‬אבער גענוג זעלטן‪ ,‬עס ָ‬ ‫פּאר ָ‬ ‫ָאדער ַא ָ‬ ‫מאל אין „ מליץ ־ יושר “‪,‬‬ ‫אר ‪ָ 179‬‬ ‫גארנישט “ קומט ָ‬ ‫טײטש „ ָ‬ ‫פּ ַאסט ניט׃ „ ניקס “ מיט דעם ַ‬ ‫רמאל‬ ‫ַ‬ ‫נא‬ ‫רמאלע “ טיילן ון צו ׳׳ ר‪ . . .‬אין צו ׳׳ ר איז ָ‬ ‫ַ‬ ‫נא‬ ‫נישטא אין די „ ָ‬ ‫ָ‬ ‫כאטש עס איז כּמעט ווי‬ ‫ָ‬ ‫מאל — אין „מליץ ־ יושר “‬ ‫דארטן מער ווי ‪ָ 700‬‬ ‫וואס טרעט זיך ָ‬ ‫ווארט „ נישט “ ) ָ‬ ‫ָ‬ ‫דאס‬ ‫ָ‬ ‫גאנצן (‪.‬‬ ‫מאל אין ַ‬ ‫נאר ‪ָ 7‬‬ ‫ָ‬ ‫דהײנו׃ ‪ ,2r b‬ש‪ ,2 va ,58 .‬ש‪ ,18 v b ,11 .‬ש‪ ,26v b ,36 .‬ש‪ ,28 ra ,10 .‬ש‪ ,32 ra ,32 .‬ש‪ ,36v b ,24 .‬ש‪,44 r b ,19 .‬‬ ‫ַ‬ ‫‪3‬‬ ‫ש‪ ,56 ra ,27 .‬ש‪ ,64 va ,48 .‬ש‪.39 .‬‬ ‫הײנט‬ ‫לקט ‪ +‬ייִ דישע שטודיעס ַ‬ ‫זײן‪ַ ,‬אז דער מחבר‬ ‫ס׳איז שווער צו אינטערפּרעטירן דעם ־ ָא מצ‪ — #‬עס קען פּשוט ַ‬ ‫באמערקנדיק ַאז דער‬ ‫געוווינטשאט אין דעם פּרט‪ ,‬אשר ַ‬ ‫ַ‬ ‫זײן‬ ‫טאקע געביטן ַ‬ ‫ַ‬ ‫האט‬ ‫ָ‬ ‫גארנישט “‪ ,‬אין‬ ‫שפּראך איז ַאריבער צו „ ָ‬ ‫ַ‬ ‫מאדערנע‬ ‫אומקלאר‪ .‬די ָ‬ ‫ָ‬ ‫טײט ון „ נישט “ איז‬ ‫בא ַ‬ ‫ַ‬ ‫גאר זעלטן‬ ‫מאדערנעם ייִ דיש ָ‬ ‫וואס איז אין ָ‬ ‫דא די ַאנדערע לייזונג „ ניקס “‪ָ ,‬‬ ‫„ מליץ ־ יושר “ איז ָ‬ ‫קאנט‪.‬‬ ‫אומבא ַ‬ ‫ַ‬ ‫ארט נישט‬ ‫ָאבער ָ‬ ‫‪4‬‬ ‫האבן געווען‬ ‫כאטש עס קען ָ‬ ‫אלס׃ נישט איינער ון די זעצערס איז שולדיק — ָ‬ ‫יעדן ַ‬ ‫דאס‬ ‫דעמאלט וועלן מיר ָ‬ ‫ָ‬ ‫דרוקארבעט‪ ,‬און‬ ‫ַ‬ ‫קטאר צווישן דעם מחבר און דער‬ ‫ָ‬ ‫רעדא‬ ‫ַ‬ ‫ַא‬ ‫צאלן‪,‬‬ ‫ארשטייט ון די ָ‬ ‫ראן‪ ,‬ווי מע ַ‬ ‫א ַ‬ ‫מאל ניט וויסן אויף זיכער! „ ניקס “ איז ַ‬ ‫מס תּ מא קיין ָ‬ ‫ונאנדערשיידן לויט‬ ‫ַ‬ ‫וואס מען קען‬ ‫אומאפּהענגיק ון די זעצערס ָ‬ ‫ָ‬ ‫גאנצן בוך —‬ ‫איבערן ַ‬ ‫דאפּטירט‬ ‫האט ַא ָ‬ ‫אויסלייג ־ אייגנקייטן זייערע ‪ . . .‬אשר וועט איר מיינען ַאז אונדזער מחבר ָ‬ ‫זײן ריִ ערדיקן‬ ‫האט געשריבן ַא לעצט שטיקל ון ַ‬ ‫ווארט „ ניקס “ שוין איידער ער ָ‬ ‫דאס ָ‬ ‫ָ‬ ‫יא געשריבן‬ ‫האט ָ‬ ‫וואס ער ָ‬ ‫רויסזאגן וועגן דעם‪ָ ,‬‬ ‫ָ‬ ‫מײנע ַא‬ ‫דארף רעווידירן ַ‬ ‫בוך — און ַאז מע ַ‬ ‫נאך „ ניקס “‪.‬‬ ‫בײט זיך ָ‬ ‫בארויִ קן׃ צוליב דער קריטעריע ַאליין ַ‬ ‫אײך ַ‬ ‫וואס נישט ‪ . . .‬קען איך ַ‬ ‫און ָ‬ ‫ווײזט זיך ַארויס אין דעם בוך‪ ,‬ווי אין עטלעכע ַאנדערע‪ַ ,‬אז‬ ‫געזאגט‪ ,‬עס ַ‬ ‫ָ‬ ‫ווי ריִ ער‬ ‫בײט זיך‬ ‫איינצײטיק אויף אים און ַאז דער גרענעץ וווּ עס ַ‬ ‫ַ‬ ‫געארבעט‬ ‫ַ‬ ‫האבן‬ ‫צוויי זעצערס ָ‬ ‫נײעם קונטרס‪ ,‬אין דעם‬ ‫אלט זיך צונויף מיט דעם ָאנהייב ון ַא ַ‬ ‫האנט ַ‬ ‫די ַארבעטנדיקע ַ‬ ‫דאס בוך איז געדרוקט‬ ‫זאגט מען ַאז ָ‬ ‫)דעראר ָ‬ ‫ַ‬ ‫טאפּלבלעטער‬ ‫אל ַא קונטרס ון צוויי ָ‬ ‫ַ‬ ‫פּאר ָאטע‬ ‫ווארט ָאדער ַא ָ‬ ‫דאס אויג צו געינען ַא ָ‬ ‫שארן ָ‬ ‫דארף ַ‬ ‫ביניאנען “(‪ — .‬מע ַ‬ ‫ָ‬ ‫אין „‬ ‫שרײבן‪.‬‬ ‫ַ‬ ‫באליבטן און זיי צו‬ ‫האבן ַאן ַאנדערן ַ‬ ‫בײ וועלכע ביידע זעצערס ָ‬ ‫ווערטער ַ‬ ‫גראישע‬ ‫טיפּא ַ‬ ‫ָ‬ ‫ראקטעריסטישער‪ ,‬אויב מע קען געינען‪ ,‬זענען טעכנישע‬ ‫כא ַ‬ ‫נאך ַ‬ ‫ָ‬ ‫האבן מיר עפּעס ון דעם מין׃ ַא זעצער‬ ‫אל ָ‬ ‫מינהגים מחוץ דעם אויסלייג גוא‪ — .‬אין דעם ַ‬ ‫רײנצוזעצן‬ ‫אויסצושרײבן די ווערטער „ הקדוש ברוך הוא “ און זיי נישט ַא ַ‬ ‫ַ‬ ‫האט ליב‬ ‫וואס ָ‬ ‫ָ‬ ‫ציטאט ] ‪[ 4‬‬ ‫ַ‬ ‫אלן ַאזעלכע‪ ,‬זע‬ ‫האט איר ָאקערשט געזען צוויי ַ‬ ‫האלבע ל‪#‬נות ) צועליק ָ‬ ‫אין ַ‬ ‫ארם מיט‬ ‫באגנוגנט זיך בדרך ־ כּלל מיט דער געקירצטער ָ‬ ‫און ] ‪ ,( [ 6‬בשעת דער ַאנדערער ַ‬ ‫בײ‬ ‫קלאמערן ַ‬ ‫ַ‬ ‫האלבע ל‪#‬נות‪ .‬די‬ ‫יא אין די ַ‬ ‫מאל ָ‬ ‫דאס ָאבער ָאט ָ‬ ‫נאר יר אותיות — און ָ‬ ‫ָ‬ ‫ראקטעריזירן !‬ ‫כא ַ‬ ‫ווארט קלעקן שוין אים צו ַ‬ ‫דעם ־ ָא זייער ָאטן ָ‬ ‫וואלט געווען ַא‬ ‫סטאטיסטיק ָ‬ ‫ַ‬ ‫גאנצע‬ ‫אויסגעהאלטן און די ַ‬ ‫ַ‬ ‫גאנצן‬ ‫קיינער איז נישט אין ַ‬ ‫אר זייער ָאט אויף ַאלע‬ ‫קלאמערן קומט ָ‬ ‫ַ‬ ‫ארקירצונג ָאן‬ ‫ווײל די ַ‬ ‫רפּלאנטערט ) ַ‬ ‫ָ‬ ‫א‬ ‫ביסל ַ‬ ‫אלן ׃ ‪(1‬‬ ‫נאר די „עקסטרעמע “ ַ‬ ‫טראכט ָ‬ ‫ַ‬ ‫בא‬ ‫ציטאט ] ‪ ; ( [ 6‬אויב ָאבער נעמען אין ַ‬ ‫ַ‬ ‫זײטלעך‪ ,‬׳׳גל‬ ‫ַ‬ ‫באקומט‬ ‫קלאמערן‪ַ ,‬‬ ‫ַ‬ ‫ארקירצט ָאבער דווקא מיט‬ ‫קלאמערן און ‪ַ ( 2‬‬ ‫ַ‬ ‫אויסגעשריבן ָאבער ָאן‬ ‫ארצייכנט אויף‬ ‫האב איך ַ‬ ‫דאס ָ‬ ‫איבערצײגן‪ָ .‬‬ ‫ַ‬ ‫באלד‬ ‫דארף‪ ,‬מיין איך‪ַ ,‬‬ ‫וואס ַ‬ ‫זיך ַא צעטיילונג ָ‬ ‫סובסטאנטיוו ) „ ַא‬ ‫ַ‬ ‫סטוטשקאווס אוצר ׃ אין נר‪ ) 545 .‬שפּ‪615 .‬א ( ווי ַא‬ ‫ָ‬ ‫מאל אין‬ ‫אר יר ָ‬ ‫‪ „ 4‬ניקס “ קומט ָ‬ ‫זאנגשפּיץ און דער‬ ‫אבל „ דער ַ‬ ‫אר אין יהואשס ַ‬ ‫סובסטאנטיוו קומט ָ‬ ‫ַ‬ ‫גארנישט‪ַ ,‬א נישטל ] ‪ַ [ . . .‬א ניקס “; דער‬ ‫ָ‬ ‫ארנט‬ ‫לאגישע איינסן׃ „ ניקס איז גוט צו די אויגן “‪ָ „ ,‬‬ ‫זעא ָ‬ ‫רא ָ‬ ‫ַ‬ ‫מאל אין‬ ‫דרײ ָ‬ ‫ַ‬ ‫מווארט ז‪ ( 72 .‬און‬ ‫ָ‬ ‫גרא‬ ‫ַ‬ ‫שטרוי “ ווי ַא‬ ‫יקס און אינעווייניק ניקס “ ) ביידע נר‪ ,56 .‬שפּ‪ 43 .‬ב (‪ „ ,‬אויבן יקס‪ ,‬אונטן ניקס “ ) נר‪ ,529 .‬שפּ‪594 .‬א ( — ַאג‪#‬‬ ‫דא אין ַ‬ ‫שפּריכווארט איז ָ‬ ‫ָ‬ ‫געגראמט‬ ‫ַ‬ ‫זא‬ ‫ַא ַ‬ ‫פּראג‬ ‫ָ‬ ‫דײטש )‪ ( Wander: » ĳix « 10 & 16‬און אין „מראה מוסר “ )‬ ‫ַ‬ ‫‪ 1614‬און שפּעטערדיקע‬ ‫אויסגאבעס ( ׃ ‪ . fornėn ĳiks un’ hintėn niks‬צו די ַאנדערע קריטעריעס זענען די‬ ‫ָ‬ ‫צאלן ַאזוי ) ׳׳ גל נויבערג ז‪ ( 115 — 109 .‬׃ ‪noch denȯchte̍r ( 3 — he̍nein (1×), hinein (1×), * hinaus (0) ( 2‬‬ ‫)×‪an-špreche̍n (1×), an-zu-špreche̍n (1×), (6 — in teitsche̍n (1×) (4 — (1×), denȯch (1×), denȯcht (1‬‬ ‫] )×‪ikliche̍m (11 — niks (179×) (10 — ge̍frogt ( 2×) ( 9 — wede̍r (1×) ( 8 — šprecht ( 2×) [+ šprich-wort ( 2‬‬ ‫)×‪. zu kope̍n (1×) (12 — (1‬‬ ‫‪362‬‬ ‫‪Simon Neuberg : Die Sprache des Meliz-jȯšer 363‬‬ ‫קלאמערן ַארום „הקבה “ איז‬ ‫ַ‬ ‫וואס זעצט‬ ‫ארן זעצער ָ‬ ‫ראקטעריסטיש ַ‬ ‫כא ַ‬ ‫טאבעלע‪ַ — .‬‬ ‫ַא ַ‬ ‫דאס מיט ַאן‬ ‫שרײבט ָ‬ ‫ַ‬ ‫קאלעגע‬ ‫זײן ָ‬ ‫„אײער “ מיט ַאן ַאלף ׃ ‪ /‬אייאר ‪ַ ) /‬‬ ‫ַ‬ ‫שרײבט‬ ‫ַ‬ ‫וואס ער‬ ‫אויך ָ‬ ‫נאך דער ַאלף׃ ‪ /‬אודר ‪. /‬‬ ‫וואוו ָ‬ ‫„אדער “ מיט ַא ָ‬ ‫שרײבן ָ‬ ‫ַ‬ ‫האט ליב צו‬ ‫וואס ער ָ‬ ‫עין׃ ‪ /‬אייער ‪ ( /‬און ָ‬ ‫אר איין‬ ‫גרויסהאנטיקע סימנים ַ‬ ‫ַ‬ ‫טאבעלע‬ ‫קלארקייט ניץ איך אויף דער ַ‬ ‫ָ‬ ‫לשם‬ ‫ווײל דער סימן „ אויסגעשריבן הקב ׳׳ ה מיט דער‬ ‫קאלעגע‪ַ .‬‬ ‫זײן ָ‬ ‫אר ַ‬ ‫קליינהאנטיקע ַ‬ ‫ַ‬ ‫זעצער‪,‬‬ ‫האב איך צוגעגעבן דעם ‪o‬‬ ‫„קליינהאנטיקן “ ָ‬ ‫ַ‬ ‫אר דעם‬ ‫לענג “ איז צו זעלטן ַ‬ ‫אר „ ָאדער “‬ ‫ַ‬ ‫ראקטעריסטיש‬ ‫כא ַ‬ ‫וואס זענען אויך גענוג ַ‬ ‫באלד “ מיט ַאן ַאלף‪ָ ,‬‬ ‫אר „ ַ‬ ‫וואוו און דעם ‪ַ a‬‬ ‫מיט ַא ָ‬ ‫באנוץ ון דער ָאדער יענער‬ ‫וואס זענען בלויז ַאן ָאטערער ַ‬ ‫אר אים‪ .‬אויב ניצן סימנים ָ‬ ‫ַ‬ ‫דאס דערקלערן די‬ ‫וואלט ָ‬ ‫ווארט‪ ,‬ווען ביידע זעצערס ניצן די זעלביקע צוויי‪ָ ,‬‬ ‫ארמע ון ַא ָ‬ ‫ָ‬ ‫איבערצײגנדיק‪ .‬איך‬ ‫ַ‬ ‫וואלט שוין געבליבן ניט‬ ‫גאנצע ָ‬ ‫דאס ַ‬ ‫געווארן צו שווער‪ ,‬און ָ‬ ‫ָ‬ ‫טאבעלע‬ ‫ַ‬ ‫רעלאציע מיט‬ ‫ַ‬ ‫קא‬ ‫וואס גיבן ַא גוטע ָ‬ ‫האב ָאבער איבערגעקוקט עטלעכע ַאנדערע סימנים‪ָ ,‬‬ ‫ָ‬ ‫זײט (‪.‬‬ ‫דא ) אויף דער קומענדיקער ַ‬ ‫וואס איר זעט ָ‬ ‫דעם ָ‬ ‫אויסצושרײבן „הקב ׳׳ ה “ און‬ ‫ַ‬ ‫האט ליב‬ ‫וואס ָ‬ ‫באקומט זיך ַאז איין זעצער — דער ָ‬ ‫עס ַ‬ ‫שפּארעוודיק‬ ‫ָ‬ ‫וואס איז ָאבער‬ ‫באלד “ מיט ַא לענגערן „ ָאדער “‪ָ ,‬‬ ‫שרײבט אויך ַא לענגערן „ ַ‬ ‫ַ‬ ‫דערווײל‬ ‫ַ‬ ‫בײ מיר‬ ‫וואס הייסט ַ‬ ‫טאבעלע‪ָ ,‬‬ ‫„קליינהאנטיקער “ אויף דער ַ‬ ‫ַ‬ ‫קלאמערן — דער‬ ‫ַ‬ ‫מיט‬ ‫צונאמען ‪A‬‬ ‫ָ‬ ‫מיטן‬ ‫זײן‬ ‫גראדן נומער‪ ,‬בשעת ַ‬ ‫ָ‬ ‫האט אויסגעזעצט ַאלע קונטרסים מיט ַא‬ ‫— ָ‬ ‫מאל‪ ,‬ווען‬ ‫ארנומען מיט די קונטרסים מיט ַאן אומען נומער‪ַ . . .‬אחוץ צוויי ָ‬ ‫האט זיך ַ‬ ‫קאלעגע ָ‬ ‫ָ‬ ‫ארענדיקן די ערשטע העלט ון די קונטרסים ‪8‬‬ ‫אונטערגעהאלן ַ‬ ‫ָ‬ ‫נאך‬ ‫האט דערצו ָ‬ ‫ער ָ‬ ‫בײ דער צווייטער‬ ‫בלאט און ַ‬ ‫ַ‬ ‫שפּאלט ון דעם ‪30‬סטן‬ ‫ַ‬ ‫מאל דעם לעצטן‬ ‫און ‪ ,10‬זעצנדיק איין ָ‬ ‫ארשטייט זיך ניט‬ ‫אלן איז‪ַ ,‬‬ ‫שפּאלטן ונעם ‪38‬סטן ! ‪ . . .‬אין די ַ‬ ‫ַ‬ ‫דרײ‬ ‫ַ‬ ‫גאנצע‬ ‫געלעגנהייט ַ‬ ‫שפּאלט ‪ָ . . .‬אבער איך‬ ‫ַ‬ ‫טאקע ָאנגעהויבן מיט דער ערשטער שורה ון‬ ‫האט ַ‬ ‫זיכער‪ ,‬צי ער ָ‬ ‫אר‪.‬‬ ‫וואס אין יעדער שורה קומט ָ‬ ‫דעטאליזירן ָ‬ ‫ַ‬ ‫צײט צו‬ ‫האב שוין ניט קיין ַ‬ ‫ָ‬ ‫אלן (‪,‬‬ ‫קאנט ון ַאנדערע ַ‬ ‫בא ַ‬ ‫וואס איז ַ‬ ‫זײן ) לויט דעם ָ‬ ‫געזאגט‪ ,‬מען קען זיך משער ַ‬ ‫ָ‬ ‫ווי‬ ‫נאר צו‬ ‫מסטערדאמער דרוקער‪ָ ,‬‬ ‫ַ‬ ‫אר די ַא‬ ‫ַאז די ־ ָא אייגנקייטן זענען ניט ספּעצייש ַ‬ ‫האט מען‬ ‫מסטערדאם ָ‬ ‫ַ‬ ‫אויסגאבע‪ ,‬און ַאז אין ַא‬ ‫ַ‬ ‫די לובלינער דרוקער ון דער ערשטער‬ ‫זײטן און די קונטרסים פּונקט ַאזוי ווי אין דער‬ ‫איבערגעדרוקט אות ־ באות‪ ,‬ברעכנדיק די ַ‬ ‫בלײבן‬ ‫ַ‬ ‫קאנווענצן‬ ‫בײטן זיך די אויסלייג ־ ָ‬ ‫אויסגאבע‪ַ ,‬אזוי ַאז די גרענעצן וווּ עס ַ‬ ‫ַ‬ ‫ערשטער‬ ‫בײטנדיק‬ ‫רמאט‪ ,‬און ַ‬ ‫ַ‬ ‫א‬ ‫וואלט געדרוקט אין ַאן ַאנדער ָ‬ ‫לאגישע ‪ — .‬אויב מע ָ‬ ‫גראיש ָ‬ ‫טיפּא ַ‬ ‫ָ‬ ‫ארשטיין‬ ‫וואלט אונדז ָאנגעקומען ַא סך שווערער צו ַ‬ ‫דארטן דעם אויסלייג‪ָ ,‬‬ ‫דא און ָ‬ ‫דערבײ ָ‬ ‫ַ‬ ‫דערמאנונגען ון דער לובלינער‬ ‫ָ‬ ‫זאגן אונדז עלטערע‬ ‫באדויערן ָ‬ ‫דא טוט זיך ) צום ַ‬ ‫וואס ָ‬ ‫ָ‬ ‫בײ דער השערה (‪.‬‬ ‫בלײבן ַ‬ ‫ַ‬ ‫רמאגט‪ ,‬מוזן מיר‬ ‫ָ‬ ‫א‬ ‫האט ַ‬ ‫אויסגאבע ניט וויל בלעטער זי ָ‬ ‫ַ‬ ‫ארשונג׃‬ ‫נײע בקשה צו דער שפּעטערדיקער ָ‬ ‫באקומט זיך ָאבער ַא ַ‬ ‫ון דער השערה ַ‬ ‫כאטש איין‬ ‫ראן אין ָ‬ ‫א ַ‬ ‫נאך ַ‬ ‫יא ָ‬ ‫וואס זענען ָ‬ ‫נאליזירן די לובלינער דרוקן ָ‬ ‫זאל מען ַאזוי ַא ַ‬ ‫ָ‬ ‫ווײזן‪ַ ,‬אז די זעלביקע צוויי‬ ‫זײן מעגלעך צו ַ‬ ‫עקזעמפּלאר אויף דער וועלט‪ ,‬ס׳וועט אשר ַ‬ ‫ַ‬ ‫בײ ַאנדערע דרוקן — און ַאז מע וועט וויסן גענוג‬ ‫מיטגעארבעט ַ‬ ‫ַ‬ ‫דארטן‬ ‫האבן ָ‬ ‫ַארבעטער ָ‬ ‫געוווינטשאטן ון פּוילישע זעצערס אין ‪17‬טן י ׳׳ ה וועט מען אשר‬ ‫ַ‬ ‫וועגן די אויסלייג ־‬ ‫האט זיך געדרוקט די ערשטע צו ׳׳ ר ? אין לובלין‪,‬‬ ‫ראגע׃ וווּ ָ‬ ‫ַ‬ ‫ארענטערן די‬ ‫ַאילו קענען ַ‬ ‫קראקע ?‬ ‫ָ‬ ‫צי אין‬ ‫וואגיקע‬ ‫נאך ירלייגן ַא סך ַא סך ָ‬ ‫‪ . . .‬און בכלל‪ ,‬וועגן דעם „ מליץ ־ יושר “ קען מען ָ‬ ‫באגנוגן איך זיך מיט דעם ָא איבערבליק איבערן‬ ‫דערווײלע ַ‬ ‫ַ‬ ‫פּראיעקטן — ָאבער אויף‬ ‫ָ‬ ‫טעריאל !‬ ‫ַ‬ ‫מא‬ ‫ַ‬ ‫ריאנטן אין מליץ ־ יושר ׃ צוויי זעצערס‬ ַ ‫ווא‬ ַ ‫אויסלייג ־‬ L. 1ra 1rb 1va 1vb 2ra 2rb a o3 a o1 2va 2vb 3ra 3rb 3va 3vb 4ra 4rb 4va 4vb (H2 (H2 (H12 o1 a a hak1 a3 (H15 (H1 (H3 (H2 o1 a5 hak8 a hak2 a2 o2 (H3 (H2 hak1 o1 hak2 o1 a a (H1 (H4 0 1 = 1–4 (H1 (H1 2 = 5–8 3 = 9 – 12 (H1 (H1 (H2 (H3 364 ‫הײנט‬ ַ ‫ ייִ דישע שטודיעס‬+ ‫לקט‬ 4 = 13 – 16 (H1 hak1 o2 (H1 hak1 a hak7 o4 a a (H1 (H1 a a3 5 = 17 – 20 (H1 6 = 21 – 24 a2 7 = 25 – 28 (H5 (H6 (H4 (H4 (H8 (H13 (H1 8 = 29 – 32 hak2 o1a hak4 o2 hak3 o1 hak5 hak2 o3 hak2 hak1 o1 (H3 9 = 33 – 36 (H5 (H4 (H9 (H4 (H4 (H16 (H4 (H1 (H1 (H3 10 = 37 – 40 hak2 o4a2 hak3 o3a3 hak2 a2 hak4 (H4 (H9 (H9 hak3 hak5 o1 11 = 41 – 44 (H4 (H2 (H2 (H1 (H5 (H7 (H8 (H7 (H3 12 = 45 – 48 hak1 o4 hak5 o2 hak7a hak4 o4 hak2 hak1 hak3 o1 hak2 hak1 13 = 49 – 52 (H3 hak2 o1 hak2 a 14 = 53 – 56 15 = 57 – 60 (H15 (H1 (H1 o1 o2 hak1 hak1 (H1 hak5 o1 hak1 a (H1 hak2 (H3 (H1 (H1 (H4 (H2 (H4 hak7 hak5 a hak10 o1 hak7 hak2 hak5 (H6 (H9 (H1 (H3 (H6 (H6 hak2 hak1 o1 hak1 (H9 (H15 16 = 61 – 64 hak7 o2 hak2 17 = 65 – 68 (H3 (H3 hak1 o1 (H2 (H3 (H2 hak1 hak1 o2 (H3 o1 (H2 (H5 hak2 o1 hak1 o1 hak6 o1 (H2 (H1 (H4 o1 o1 (H2 (H4 (H5 o1 hak1 hak4 o1 (H7 (H3 (H1 o1 hak9 hak1 o2 o1 hak2 o1a (H1 (H1 o1 hak2 o1a hak2 o1 hak1 o1 hak2 (H5 (H10 (H5 (H10 (H7 (H3 (H1 (H3 (H1 (H3 o3 a hak3 (H11 (H1 (H6 hak1 hak1 o1a hak4 hak4 hak7 hak1 (H2 (H6 (H2 (H2 (H3 hak1 (H3 (H10 hak1 hak4 o1 hak4 hak4 o3 18 = 69 – 72 hak2 hak2 o4 hak4 hak2 o2 hak2 o2 hak7 o2 hak1 hak4 o1 a o1 hak1 o1a2 hak4 a2 hak1 hak4 hak1 19 = 73 – 76 (H4 (H3 (H14 (H1 (H4 (H3 (H8 (H2 (H7 (H3 hak1 hak2 hak1 a (H = ‫)הקב ” ה (י‬ hak = ‫הקדוש ברוך הוא‬ o = ‫אודר‬ a = ‫באלד‬ hak2 Simon Neuberg : Die Sprache des Meliz-jȯšer 365 ‫גראיע‬ ַ ‫ביבליא‬ ָ Geršȯn ben Eli ‘ eser, 1635 : Ge̓liless-’ erez-Jiśro ’ el. Lublin. [ Shmeruk 53, ed. Ben-Zvi, Jerusalem 1953 ] Ja‘e̍kov̄ b. Jizḥok Ašcenasi, 1687 / 88 : Meliz-jȯšer. Amsterdam. ‫ראן אין אינטערנעץ ׃‬ ַ ‫א‬ ַ ‫ ( איז‬jüd. germ. 30 ) ‫עקזעמפּלאר‬ ַ ‫ראנקורטער‬ ַ ‫] דער‬ ‫ראן‬ ַ ‫א‬ ַ ‫עקזעמפּלאר איז‬ ַ ‫קסארדער‬ ָ ‫( ; ון דעם ָא‬urn:nbn:de:hebis:30:2-3467 ) [ ‫אויסגאבע‬ ַ ‫מיקראיש ־‬ ָ ‫ַא‬ – 1622 : Ze̍’ene̱-uRe̍’ene̱. » Basel « ( Hanau ) – Amsterdam 1648. ‫מסטערדאמער און ון דעם‬ ַ ‫אויסגאבעס ון דער ַא‬ ַ ‫מיקראיש ־‬ ָ ‫דא‬ ָ ‫] עס זענען‬ [ ‫אויסגאבע‬ ַ ‫באזעלער‬ ַ ‫באנד ון דער כּמו ־‬ ַ ‫ערשטן‬ Neuberg, Simon, 1999: Pragmatische Aspekte der jiddischen Sprachgeschichte am Beispiel der » Zenerene « ( = jidische schtudies 7 ). Hamburg: Buske. Selikma̍ n Ulma Ginzburg, 1614 : Mar’e̱-mus̀ar ; der zucht-špige̍l. Prag. ַ ‫]שפּעטערדיקע‬ ( Prag 1678, Frankfurt am Main 1680, Offenbach ‫אויסגאבעס‬ ‫זאץ געינט‬ ַ ‫ דער ציטירטער‬.‫ זענען צוטריטלעך אין אינטערנעץ‬1716, Sulzbach ) [“ ‫( ׃ „ איסתרא בלגינא קיש קיש קריא‬72 ‫זוכווארט ) א ־‬ ָ ‫בײם‬ ַ ‫זיך‬ Shmeruk, Khone, 1981 : Sifrūt yīdīš bě-Pōlīn. Jerusalem: Magnes. Stutchkoff, Nokhem, 1950 : Der oytser fun der yidisher shprakh. New York: yivo. Timm, Erika, 2005 ( unter Mitarb. von Gustav Adolf Beckmann ) : Historische jiddische Semanti k; die Bibelübersetzungssprache als Faktor der Auseinanderentwicklung des jiddischen und des deutschen Wortschatzes. Tübingen : Niemeyer. Wander, Karl Fr. W., Hg., 1867 – 1880 : Deutsches Sprichwörterlexikon. 5 Bde. Leipzig : Brockhaus. Yehoyesh, 1912 : Fablen. New York : Oyfgang. ‫לינגוויסטיק‬ Sprachwissenschaft Linguistics Roland Gruschka Von Petach Tikwa über Jaffa nach Meknès Eine jiddische Postkarte aus dem Jahre 1902 als sprachgeschichtliche Quelle Die Vorgeschichte des Jiddischen im heutigen Israel ist noch wenig erforscht. Dies gilt in verstärktem Maße für die Zeit vor 1917, in der das Land unter osmanischer Herrschaft stand. Trotz der verdienstvollen Pionierarbeiten Mordechai Kosovers 1 sind gerade die Sprachverhältnisse der Aschkenasim innerhalb der bereits vor 1882 dort ansässigen jüdischen Gemeinschaft ( des sog. › Alten Jischuw ‹ ) 2 wie auch der Zuwanderer der › Ersten Alija ‹ ( 1882 – 1903 ) erst in Ansätzen dokumentiert, ebenso die konkreten Sprachfakten, die über Entwicklungen in dem von ihnen gesprochenen Jiddisch Auskunft geben.3 Eine deutliche Forschungslücke besteht hinsichtlich der Sprachverhältnisse in den zwischen 1870 und 1900 gegründeten Agrarkolonien, allen voran Petach Tikwa oder Gedera, deren Bewohner in den Anfangsjahren mehrheitlich jiddischsprachig gewesen sein müssen.4 Die jüdischen Zuwanderer setzten sich bis weit ins 19. Jahrhundert hinein vorwiegend aus kleinen Gruppen und Individuen unterschiedlicher Herkunft und zumeist religiöser Ausrichtung zusammen, die sich vor allem in den alten Städten, später auch in den neuen Jerusalemer Vororten, konzentrierten. Erst ab 1870 entstanden landwirtschaftliche Siedlungen, in denen sich überwiegend Aschkenasim zusammenfanden. Von den geschätzten 30 . 000 jüdischen Einwanderern der Jahre 1882 – 1903 blieben rund 10 . 000 im Land, knapp die Hälfte von ihnen in den Agrarkolonien.5 Die Mehrheit der Zuwanderer im 19. Jahrhundert waren Aschkenasim, von denen ein Großteil Jiddisch sprach. Eine dokumentarische Erfassung der ( letztlich unbeständigen ) jiddischen Sprachlandschaft, die sich im Gefolge dieser frühen Zuwanderungen 1 Kosovers wichtigste Ergebnisse sind in seiner Dissertation ( Kosover 1966 ) zusammengefasst, die auf seinen Forschungen in den 1930er Jahren beruht, vgl. die in der Bibliographie dort, S. 417, genannten Titel, vor allem Kosover 1932, Kosover 1939. 2 Zu Terminologie und Periodisierung vgl. die entsprechende Diskussion bei Bartal 1981, Bartal / Ettinger 1982, Kaniel 1981. 3 Die Arbeiten von Arye Pilowsky und Yael Chaver behandeln vor allem den » Sprachenkampf « in der Mandatszeit und nach der Staatsgründung und die Ausblendung des Jiddischen aus der zionistischen Geschichtsschreibung, vgl. Pilowsky 1986, Chaver 2004. 4 Vgl. Chaver 2004 : 25 – 29. 5 Petry 2001 : 91, Bartal / Ettinger 1982 : 198, Louvish 2007 : 333 – 335. 370 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ herausbildete, einschließlich der heute verschwundenen jiddischen Sprachinseln, sollte ihren Ausgang sinnvollerweise in Fall- und Mikrostudien zum Sprachgebrauch einzelner Personen oder kleiner Gruppen nehmen, die sich geographisch möglichst eindeutig verorten lassen. Die Ergebnisse solcher Studien würden sich im Zuge daran anschließender Forschungen zu einem wie auch immer mosaikhaften Gesamtbild zusammenfügen. Eine wichtige sprachgeschichtliche Quelle stellen ohne Zweifel jiddische Briefe und Postkarten dar, deren Verfasser sich als dauerhaft im Lande lebende Einwohner identiĳizieren lassen. Derartige Textzeugnisse sind um so ergiebiger, je weniger in ihnen der individuelle Ausdruck und damit auch die dialektale Prägung des Verfassers durch Schreibkonventionen oder literatursprachliche Normen und Standards überformt oder gar überdeckt werden. Besondere Aufmerksamkeit verdient daher eine jiddische Postkarte, die 1902 in Petach Tikwa geschrieben wurde. Dies der Forschung bislang unbekannte Dokument soll im Folgenden vorgestellt werden. Dazu wird der Text im jiddischen Original und deutscher Übersetzung mit Erläuterungen abgedruckt. Im Anschluss daran nehme ich eine Dokumentation auffälliger sprachlicher Eigenarten des vom Verfasser gebrauchten Jiddisch vor und versuche, eine erste Einordnung der Befunde in sprachgeschichtliche Zusammenhänge zu geben. 1. Die Postkarte 1 . 1 Beschreibung – Das Objekt beĳindet sich im Privatbesitz eines Mannheimer Sammlers. Es handelt sich um eine Ganzsachenpostkarte der Deutschen Post in der Türkei bzw. dem Osmanischen Reich ( Michel Nr. P7, Typ i ) aus rot bedrucktem Karton ( Vordruck 10 Pf. / Aufdruck 20 Para 6 ). Maße : 140 x 90 mm Laut Poststempel wurde die Karte am 15. Mai 1902 beim Deutschen Postamt in Jaffa aufgegeben, kam am 25. Mai bei der Deutschen Post in Tanger an und wurde am 2. Juni 1902 in Meknès zugestellt. Als Empfänger ist auf Französisch ( ohne accents ) » Dr. H. L. Slor, Medecin de la Comunite Israëlite [ sic ], Meknes, Marocco « 7 eingetragen. Auf der Rückseite ĳindet sich eine handschriftliche Mitteilung im traditionellen jüdischen Briefstil ( Datum nach dem jüdischen Kalender, hebräische Eingangs- und Schlussformel, jiddischer Kerntext ). 6 7 Para : s. u. Fußnote 31. » Dr. H. L. Slor, Arzt der jüdischen Gemeinde von Meknès, Marokko. « Roland Gruschka : Von Petach Tikwa über Jaffa nach Meknès 371 1 . 2 Verfasser. Historischer Hintergrund – Der Verfasser der Postkarte gehört zu den Gründern der Stadt Petach Tikwa. Chaim Mojsche ( Mosche ) Slor 8 wird 1859 in Jelissawetgrad ( heute Kirovohrad ) in der Ukraine geboren.9 Sein Vater, der Talmudgelehrte Benjamin Bejnisch Slor ( gest. 1888 ), ist ein früher Zionist und Anhänger der Idee, das Hebräische als jüdische Nationalsprache wiederzubeleben. In Russland gehört er zu einer der zahlreichen streng-religiösen Strömungen, aus deren Reihen später die Bewegung der › Zionsfreunde ‹ hervorgeht. Als Chaim Mojsche Slor zwei Jahre alt ist, wandert die Familie nach Jerusalem aus, wo sich sein Vater als Gold- und Silberschmied niederlässt. Bei der Gründung von Petach Tikwa im Jahr 1878 erwerben die Slors einen Anteil des Siedlungslands. Der erste Versuch einer Ansiedlung scheitert an der Malaria, an Missernten und Streitigkeiten unter den Kolonisten.10 8 In hebräischen Dokumenten erscheint der Verfasser zuweilen auch einfach nur als Mosche Slor oder Chaim Slor. Die englische Sekundärliteratur gebraucht die Formen Hayim Moshe Slor bzw. Moses Slor. Die Schreibweise des Familiennamens im Hebräischen schwankt anfangs noch zwischen ‫ סלור‬und ‫סלאר‬. 9 Als biographische Quellen vgl. im Folgenden Tidhar 1947 (i ) : 307 ; Raphael 1971 ( iv ) : 136 f ; Aharonson 2000 : 144 ; sowie ( nur bedingt verlässlich ) im Netz <www.rishonim.org.il/ petach-tikva/info/founder_show.aspx ?id=35> ( letzter Zugriff : 24.02.2012 ). Die Familie Slor wird auch kurz in den Erinnerungen Chaim Ehrenreichs erwähnt, vgl. Ehrenreich 1957 : 110 f. 10 Zur frühen Geschichte von Petach Tikwa vgl. im Folgenden Hasson / Gilboa 2007 ; Nawratzki 1919 : 92 f. 372 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Ein zweiter Versuch wird 1882 unternommen, und die Neugründung hat Bestand. Ab diesem Jahr leben Chaim Mojsche und sein Bruder Henoch ( Chanoch, 1872 – 1934 ) Slor dauerhaft in der Kolonie, in der die Familie drei Parzellen bewirtschaftet. In den 1880er Jahren begibt sich Petach Tikwa wie die meisten jüdischen Agrarkolonien im Land unter die Patronage des Baron Rothschild, die 1900 von einer Verwaltung durch die Jewish Colonization Association ( jca, auch : ica ) abgelöst wird.11 Chaim Mojsche Slor, wie sein Vater gelernter Silberschmied, ĳindet bei verschiedenen Ingenieuren Anstellung als Vermessungsgehilfe und arbeitet sich bis 1890 zum ofĳiziellen Landvermesser der Rothschildschen Kolonien hoch. Später führt er selbständig Vermessungsarbeiten für die jca und andere Auftraggeber durch.12 Wie seine Schilderung der Lebensumstände, die er in der Postkarte gibt, vermuten lässt, ist Slor in dieser Zeit immer auch auf andere Erwerbsquellen angewiesen.13 Sein Bruder Henoch ( Chanoch ) ist anscheinend durchgehend in der Landwirtschaft tätig.14 In der Selbstverwaltung Petach Tikwas bekleidet Chaim Mojsche Slor im Laufe der Jahre verschiedene Ämter. 1902 ist er gewählter Vorsteher der Kolonie.15 1 . 3 Der Adressat. Marokko – Der Adressat der Postkarte ist Slors jüngster Bruder Hirsch Lejb ( auf Hebräisch : Zwi Arié ), der zu jener Zeit ein eher unstetes Abenteurerleben geführt zu haben scheint. Zu seiner Person liegt bislang nur eine Handvoll lückenhafter biographischer Skizzen vor, die z. T. einander widersprechende, ungenaue oder nicht verlässliche Angaben machen.16 Hirsch Lejb Slor wird 1875 in Jerusalem geboren. Als junger Mann geht er nach Deutschland mit dem Ziel, dort Medizin zu studieren. Er unternimmt ausgedehnte Reisen und gelangt auf abenteuerlichen Wegen – eine Darstellung 17 nennt als Stationen den Eintritt in die Fremdenlegion, Kampfeinsatz in Mauretanien, Fahnenflucht, Gefangennahme durch Berber und erneute Flucht – nach Marokko. Das ma11 Zu Einzelheiten s. Aharonson 2000 : 108 – 119. 12 Ibid. : 144. 13 Siehe aber auch die Einschätzung von Karlinsky 2005 : 60. 14 Vgl. Tidhar 1947 ( ii ) : 591 f. 15 Vgl. ibid. : 640 f. 16 Vgl. z. B. Ya‘akōvā ’ 2005, oder im Netz <www.rishonim.org.il/petach-tikva/info/founder_show.aspx ?id=285> ( letzter Zugriff : 24. 02. 2012 ). Zu Hirsch Lejb bzw. Zwi Arié Slor gibt es weder in Tidhars noch in Raphaels Enzyklopädie einen Eintrag. Ein anscheinend bisher wenig beachtetes Dokument zu seiner Biographie ist eine auf den Namen » Hirsch Leib Slor « ausgestellte und auf den 10. März 1926 datierte Schiffskarte für eine Überfahrt von Cherbourg nach New York, zu ĳinden über <www.ancestry.co.uk> ( letzter Zugriff: 24. 02. 2012 ). 17 Ya‘akōvā’ 2005 : 30. Roland Gruschka : Von Petach Tikwa über Jaffa nach Meknès 373 ghrebinische Sultanat ist zu jener Zeit noch unabhängig, auch wenn die untereinander rivalisierenden europäischen Großmächte, allen voran Frankreich, bereits auf eine koloniale Unterwerfung hinarbeiten und nachhaltig in die Geschicke des Landes eingreifen. Noch bevor das Königreich 1912 ofĳiziell in ein französisches und ein spanisches › Protektorat ‹ aufgeteilt wird, sind Europäer dort an zahlreichen Orten präsent. Um die Jahrhundertwende ist auch Hirsch Lejb Slor in Marokko ansässig und praktiziert in verschiedenen jüdischen Gemeinden des Landes als Arzt. Wie die Postkarte zeigt, ist er dabei anscheinend so erfolgreich, dass er eine Familie ernähren und seine Verwandten in Petach Tikwa ĳinanziell unterstützen kann. Die im Maghreb lebenden Juden gehörten entweder den Sepharden oder einer der alteingesessenen, Arabisch und z.T. auch Berberisch sprechenden Gemeinschaften an. Slor ist jedoch nicht der erste und zu seiner Zeit auch nicht der einzige aschkenasische Jude in Marokko. Die 1862 gegründete Alliance Israélite Universelle ( aiu ) unterhielt im Land ein Netz von jüdischen Schulen, deren Lehrkräfte und Funktionäre vor den 1880er Jahren überwiegend aus Europa, darunter auch dem Elsass, stammten.18 Daneben gibt es für die Zeit um 1900 spärliche Hinweise auf eine Anwesenheit zionistischer Aktivisten aus Osteuropa.19 Angesichts dieser wenigen, eher verstreut und vereinzelt lebenden Individuen, bei denen sich eine Sprachkompetenz im Jiddischen zumindest vermuten lässt, wäre es allerdings verfehlt, bereits von einer jiddischen Sprachgemeinschaft in Marokko sprechen zu wollen.20 1901 – 1905 wohnt Hirsch Lejb Slor in Meknès, bevor er in seine Heimat zurückkehrt.21 1911 lässt er sich in Kfar Saba als Apotheker nieder und lebt dort mit Unterbrechungen bis zu seinem Tod im Jahre 1959. 1 . 4 Lebensbedingungen. Anfänge des Orangenbaus in Petach Tikwa – Die Lebensbedingungen und die wirtschaftlichen Veränderungen in den jüdischen Agrarkolonien spiegeln sich in kleinen Details des Postkartentextes wieder. Dazu zwei Beispiele : 22 Ende des 19. Jahrhunderts tritt in Petach Tikwa noch die Malaria auf,23 an der anscheinend auch 18 Vgl. Laskier 1983 : 3, 44, 109, 128 f. 19 Vgl. ibid. : 197 – 203. 20 Die religiösen und auch sprachlichen Beziehungen zwischen den jüdischen Gemeinschaften Marokkos auf der einen und dem osteuropäischen Aschkenas auf der anderen Seite bedürfen noch vieler Forschung. Interessante Beobachtungen zu diesem Thema ĳinden sich z. B. bei Laskier / Bashan 2003 : 479 f. 21 Ya‘akōvā ’ 2005 : 31. 22 Vgl. im Folgenden Nawratzki 1919 : 92 – 96 ; Szold 1915. 23 Dazu vgl. z. B. Bambus 1898 : 87 ; Suĳian 2007, insbesondere S. 103, 108. 374 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Slors Frau Mattel erkrankt ist. Um 1894 beginnen die ersten Kolonisten mit der Anlage von Orangenpflanzungen.24 Nach wenigen Jahren löst der Anbau von Zitrusfrüchten den bis dahin vorherrschenden, von Rothschild unterhaltenen Weinbau als Hauptwirtschaftszweig der Kolonie ab. Auch Henoch Slor baut mit der ĳinanziellen Unterstützung seiner Verwandten ab etwa 1898 eine Orangenplantage auf, die um 1902 noch keine Erträge erbracht haben dürfte.25 Der wenige Jahre später einsetzende geschäftliche Erfolg des Zitrusanbaus 26 macht sich auch bei den Slors bemerkbar. Henoch Slor wird im Export von Ethrogim tätig. Chaim Mojsche Slor spendet dem während der Mandatszeit gegründeten Tochterhaus der orthodoxen Jeschiwa von Łomża in Petach Tikwa eine größere Summe Geld.27 1 . 5 Editorische Notiz – Der Originaltext ist in einem durchgeschrieben, und die Zeichen Komma und Punkt lassen sich nicht immer klar unterscheiden. Unter 1 . 6 folgt ein ( nicht zeilengetreuer ) diplomatischer Abdruck des Textes der Rückseite. In der deutschen Übersetzung ( 1 . 7 ) habe ich der besseren Lesbarkeit wegen Absätze eingefügt und gebe ( mögliche ) Kommata an einigen Stellen durch einen Punkt wieder. Die hebräischen Begrüßungs- und Schlussformeln des Originals erscheinen in der Übersetzung kursiv und ausgeschrieben. Modernhebräische, im Jiddischen nicht vorhandene Ausdrücke sind ebenfalls kursiv gesetzt. Hebräisch-jiddische Abkürzungen und formelhafte Wendungen im Kerntext wie z. B. hashem yisborekh werden in der Übersetzung ausgeschrieben, arabische Ziffern bleiben stehen. Kurze, erklärende Zusätze stehen in eckigen, Konjekturen in spitzen Klammern. Weitere Erläuterungen werden in Fußnoten gegeben. Bei der Transkription hebräischer Namen habe ich die aschkenasische Aussprache gewählt, also › Jankew ‹ statt › Ja ‘ akov ‹, › Efrojim ‹ statt › Ephraim ‹ usw. ; die moderne israelische Aussprache ist zusätzlich auf der unten stehenden Personenliste aufgeführt. 24 Im Folgenden vgl. Karlinsky 2005 : 52 – 56. 25 Vgl. Tidhar 1947 ( ii ) : 591 f ; Karlinsky 2005 : 60. Zu Anlageaufwand und Vorlaufszeit solcher Unternehmen vgl. Nawratzki ( 1919 : 128 – 130 ), insbesondere S. 130 : » Die Orangenplantage beginnt erst nach 7 Jahren in Produktion zu treten, in Vollproduktion erst nach 12 Jahren. « 26 Vgl. Nawratzki 1919 : 92 ; Karlinsky 2005 : 56. 27 Insgesamt 225 Ägyptische Pfund, vgl. die Gedenktafel über die Spende, Wortlaut der Inschrift abgedruckt bei Grajewski 1930 : Nr. 1068. Jahresangabe fehlt. Roland Gruschka : Von Petach Tikwa über Jaffa nach Meknès 375 ‫הײנט‬ ‫לקט ייִ דישע שטודיעס ַ‬ ‫‪1 . 6 Jiddisch-hebräischer Originaltext der Postkartenrückseite‬‬ ‫ב ” ה יום ה’ ח’ אייר תרס ” ב פה פ ” ת ת‬ ‫כבוד אחי היקר מו ” ה הירש לייב ס’ עם רעות‪ ,‬הכבודה מ’ עטיל ת’ איך האב‬ ‫קארטיל פון א’ דחוה ” ח פסח‪ ,‬דוא האסט אין מיר אנאייע‬ ‫היינט ערהאלטין דיין ַ‬ ‫נשמה איין גיזעצט מיט דיין שרייבען צוא מיר‪ ,‬וויא דיר גייט‪ .‬איך דאנק השי ” ת‬ ‫פאר דיא חסדים וואס ער האט מיט דיר גיטאן נאך אזוא פיל פלאגען זיך וויא דוא‬ ‫האסט זיך נעבעך גיפלאגט‪ ,‬איבער הויפט בין איך זייער צופרידין פון דיין הצלחה‬ ‫אין דאקטאריע‪ ,‬דיין געלט וואס דיא שיקסט קיין א ” י‪ ,‬גייט זייער אין אגוטע האנט‪,‬‬ ‫און דאס וועט דיר איה ” ש בריינגין צוא אגוטין תכלית‪ ,‬חנוך ארבעט מיט לייב און‬ ‫לעבין אין דער ביארע‪ ,‬און מעדערקענט דיא געלט וואס מע לייגט אין איר אריין‪,‬‬ ‫זיא שטאייגט פון טאג צוא טאג‪ ,‬פון מיר מיין ליבער ברודער האב איך דיר קיין‬ ‫מאטיל האלט ל ” ע אין איין קריינקען‪,‬‬ ‫פרייליכע נאייס צוא שרייבין‪ ,‬ערשטינס איז ַ‬ ‫ווען זיא איז בעסער טרעפט אויך ניט דיא וואך וואס זיא זאל ניט ליגין צוא בעט‬ ‫‪ 3–2‬טאג‪ .‬וואלט איך חאטש פאר דינט‪ ,‬וואלט גיווען פאר וואס צוא קריינקען‪ ,‬עס‬ ‫איז ָאבער שוין ב ” ה מער וויא ‪ 1 /2‬יאהר דאס איך האב פון מיין ארבעט איין פארא‬ ‫ניט פאר דינט‪ ,‬ארבעט איז דא פיל באיי דיא איקא‪ ,‬נאר זייא האבין באצוגין איין‬ ‫אינזינער פון וויען‪ ,‬וואש האט צוא זיך גינומען ַא ‪ 10‬שילערס פון מקוה ישראל‬ ‫און לערינט זייא דיא ארבעט‪ ,‬איז וואו מע קערט זיך זענען זייא פול‪ .‬עס איז צוא‬ ‫דאנקען השי ” ת פאר דיא שטעלע וואס איך האב באיי ה’ וואייס פון וויען אויף זיין‬ ‫מיל אין כרם און ביארא‪ ,‬קען איך לאייען אויף דעם סמך‪ ,‬איך זאג לאייען‪ ,‬ווַ יל דער‬ ‫פאר קראכין אין איין‬ ‫מענטש שיקט מיר אויך קיין געלט שוין ‪ 7‬מאנאייט‪ ,‬ער איז ַ‬ ‫נאיי גישעפט און קען קיין געלט ניט ארויס נעמען‪ ,‬נאר זיכער איז דאס‪ ,‬חלילה איך‬ ‫וואלט ניט האבין דיא שטעלע וואלט איך פשוט אויף ברויט ניט גיהאט‪ ,‬נאר אויף‬ ‫לעבין מיט קריינקען סטאייען ניט דיא ‪ 70‬פראנק אמאנאייט‪ ,‬איך האב גיוואלט‬ ‫מאטלען אוועק שיקין קיין רוסלאנד‪ ,‬איז אן שאשקען וועט זיא ניט פארין‪ ,‬און מיט‬ ‫שאשקען‪ ,‬איז ערשטין האט ניט דיא ווערט דער פארין‪ ,‬און צווייטין קריג איך ניט‬ ‫פאס מיט איין קינד‪ ,‬נאר מהסתם וועט השי ” ת אויף מיר רחמנות האבין‪ ,‬און‬ ‫קיין ַ‬ ‫זיא וועט דא גיזונט ווערין‪ .‬ווייטער שאשקע איז אן איין עין הרע אוואויל מיידיל‪,‬‬ ‫זיא לערינט און רעט און שרייבט העברייאיש‪ .‬איך גריס דיין פרויא‪ ,‬אגריס פון‬ ‫יעקב מיט מלכה מיט דיא קינדער‪ 2 ,‬קינדערלעך וויא דיא גאלד‪ ,‬אגריס פון אפרים‬ ‫מיט זיין פאמיליע‪ ,‬שעפסיל מיט זיין פאמיליע‪ ,‬אחיך חיים משה סלאר‪.‬‬ ‫‪1 . 7 Deutsche Übersetzung mit Erläuterungen‬‬ ‫‪Mit Gottes Hilfe ! Den 5. Ijjar 5662 [ 12. Mai 1902 ] zu Petach Tikwa <das‬‬ ‫>‪Bestand haben möge‬‬ ‫‪Ehre meinem verehrten, teuren Bruder und gelehrten Herrn Hirsch Lejb‬‬ ‫‪S., mit Gemahlin, der hochgeehrten Frau Ettel, sie soll leben. Ich habe‬‬ ‫‪heute deine Karte vom 1. <Halbfeiertag> des Pessach-Festes [ 16. Nis‬‬‫‪san 5662 / 23. April 1902 ] erhalten. Du hast mir eine neue Seele ein‬‬‫‪gepflanzt mit deinem Schreiben an mich, wie es dir geht. Ich danke‬‬ ‫‪Gott, er sei gelobt, für die Gnaden, die er dir erwiesen hat nach so‬‬ ‫‪vielen Mühen, wie du Armer dich abgeplagt hast, überhaupt bin ich‬‬ ‫‪376‬‬ Roland Gruschka : Von Petach Tikwa über Jaffa nach Meknès 377 sehr zufrieden über deinen beruflichen Erfolg als Arzt. Dein Geld, das du nach Israel schickst, kommt in sehr gute Hände, und das wird dir, so Gott will, ein gutes Geschäft einbringen. Henoch arbeitet mit Leib und Leben in der Bajara,28 und man erkennt das Geld, das man dort anlegt, jeden Tag geht es mit ihr ein Stück voran.29 Von mir, mein lieber Bruder, habe ich dir keine frohen Neuigkeiten zu schreiben, erstens ist Mattel, möge euch solches Unglück erspart bleiben,30 in einem fort kränkelnd, selbst wenn es ihr einmal besser geht, gibt es auch keine Woche, in der sie nicht 2 – 3 Tage zu Bett liegen muss. Würde ich nur Geld verdienen, dann gäbe es etwas, was das Kranksein wert wäre, es dauert aber schon leider Gottes mehr als ein halbes Jahr, dass ich mit meiner Arbeit nicht eine einzige Para31 verdiene. Arbeit gibt es viel bei der ica,32 aber sie haben einen Ingenieur aus Wien geholt, der etwa 10 Schüler von der Mikwe Israel33 unter seine Aufsicht genommen hat und sie die Arbeit lehrt, und wohin man nur schaut, sind sie da.34 Ich muss Gott dafür danken, dass ich eine Stelle bei dem Herrn <Weiß> aus Wien35 auf seiner Mühle in Kerem 36 und Bajara habe, auf dieser Grundlage kann ich [ mir Geld ] leihen, ich sage : leihen, weil mir der Mensch auch schon 7 Monate lang kein Geld schickt, er hat sich in ein neues Unternehmen vergraben und kann kein Geld daraus abziehen, nur gewiss ist eines, würde ich, Gott behüte, die Stelle nicht haben, würde ich schlicht kein Geld für Brot haben, aber für ein Leben mit Krankheit reichen die 70 Francs pro Monat nicht, ich wollte Mattel nach Russland fortschicken, aber ohne Schoschke 37 wird sie nicht fahren, und zusammen mit Schoschke hat es erstens wenig Wert zu fahren und zweitens bekomme ich keinen Pass für ein Kind, aber sicher wird Gott, er sei gelobt, Erbarmen mit mir haben und sie wird hier gesund werden. Außerdem ist Schoschke, unberufen,38 ein gutes Mädchen,39 sie lernt und spricht und schreibt Hebräisch. Ich grüße deine Frau, ein Gruß von Jankew und Malke mit 28 Bajara : jidd. bayáre ( < arab. baiyāra ), byáre ( < arab. biara ), [ Orangen- ]Plantage, vgl. z. B. Kosover 1966 : 284, Nr. 435. 29 jeden Tag… : Im Original idiomatisch › sie steigt von Tag zu Tag ‹. 30 möge… : Im Original idiomatisch loy aleykhem › nicht auf Euch gesagt ‹. 31 Para : jidd. páre, kleinste Silbermünze im Osmanischen Reich, vgl. Kosover 1966 : 274, Nr. 396. 32 ica, auch : jca, jidd. ika : Jewish Colonization Association. 33 Mikwe Israel : jüdische Landwirtschaftsschule, 1870 von der Alliance Israélite Universelle gegründet, gehört heute zur Stadt Cholon. Vgl. Bambus 1898 : 50 – 55. 34 sind sie da : Im Original idiomatisch zenen zey ful › sind sie voll ‹. 35 Herr <Weiß> aus Wien : Identität nicht geklärt. 36 Hebr. : › Weinberg ‹. 37 Schóschke : jidd. Form des Namens › Schoschana ‹. 38 unberufen : im Original idiomatisch on eyn ayen-hóre › kein Böses Auge ‹. 39 ein gutes Mädchen : im Original a voyl meydl, auch : › ein kluges Mädchen ‹. 378 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ ihren Kindern, 2 Kinderlein wie Gold, ein Gruß von Efrojim und seiner Familie, [ und von ] Schepsl mit seiner Familie, Dein Bruder Chaim Mojsche Slor Personenübersicht : 40 Chaim Mojsche ( Mosche ) Slor ( 1859 – 1946 ), Verfasser Efrojim ( Ephraim ) Slor ( 1865 – 1919 ) : Bruder Ettel Slor, geb. Dinowitz : Hirsch Lejb Slors erste Frau Henoch ( Chanoch ) Slor ( 1872 – 1934 ) : Bruder Hirsch Lejb ( Zwi Arié ) Slor ( 1875 – 1959 ) : Bruder, Adressat Jankew ( Ja ‘ akov ) : s. Malke Malke ( Malka ) : Schwester, verheiratet mit Jankew ( Ja‘akov ) Mattel Slor : Ehefrau Schepsl : Identität nicht geklärt Schoschke ( Schoschana ) Slor : Tochter 2. Sprachverhältnisse 41 2 . 1 Sozialisation – Chaim Mojsche Slors Sozialisation im Jiddischen, seiner Erstsprache, fand im Jerusalem der 1860er – 1870er Jahre statt. Unter den dort wie auch anderswo im Land lebenden Aschkenasim war Jiddisch zu jener Zeit die vorherrschende Umgangssprache und als Kommunikationsmittel letztlich unverzichtbar. Die aschkenasischen Einwanderer, die sich ab 1812 in kleinen Gruppen in Jerusalem niederließen, stammten aus verschiedenen Regionen Europas.42 Obwohl sich die einzelnen religiösen Gemeinden z. T. stark voneinander absonderten, mussten sie doch auf begrenztem Raum zusammenleben. In dieser Situation konnte sich der Gebrauch des Jiddischen nicht auf die eigene Familie oder Gemeinde beschränken, so dass die unterschiedlichen Herkunftsdialekte im Alltag aufeinandertrafen und nach einer gewissen Zeit aufeinander abfärbten. Slors Eltern haben wahrscheinlich soj oder zoj gesprochen, was in seinem Jiddisch noch erkennbare Spuren hinterlassen hat. Doch bereits 40 Angaben zu Namen und Daten sind den folgenden Quellen entnommen : Tidhar 1947 – 1981, Rafael 1958 – 1983, <www.rishonim.org.il>. 41 Für die Dialekte und Varietäten des Jiddischen werden die folgenden Abkürzungen verwendet : zoj = Zentralostjiddisch, soj = Südostjiddisch, noj = Nordostjiddisch, wj = Westjiddisch, süj = Südliches Übergangsjiddisch ; msj = Modernes Standardjiddisch ; als Adjektive entsprechend zoj., soj. usw. Die Klassiĳikation der Dialekte folgt dem lcaaj, bzw. Katz 1983 ; Jacobs 2005 : 59 – 66. 42 Vgl. im Folgenden Kosover 1966 : 42 – 115, insbesondere S. 61, 74 f ; Frankl 1858 ( ii ) : 44, 47 – 53 ; Halper 1991 : 3, 6 f, 74 – 89 ; aus charedischer Sicht vgl. Rossof 1998. Roland Gruschka : Von Petach Tikwa über Jaffa nach Meknès 379 in chejder und Jeschiwa werden er und seine Brüder bei Sprechern des noj die traditionellen Unterrichtsgegenstände gelernt haben. Chaim Mojsche Slor besuchte die Jeschiwa Etz Chaim, welche 1855 von den Peruschim, Anhängern des Gaon von Wilna, in Jerusalem gegründet wurde.43 Der Kern dieser um 1812 zugewanderten religiösen Gruppe stammte aus Litauen und Belarus, also dem noj. Sprachgebiet. Später kamen Anhänger aus anderen Gegenden, darunter Ungarn, hinzu. Darüber hinaus scheinen über Heiraten Verbindungen zur Gemeinde der aus dem Deutschen Reich, Österreich und Holland zugewanderten Aschkenasim bestanden zu haben.44 Damit wird Slor dem noj, dem ungarischen zoj sowie möglicherweise auch Varietäten des wj und süj begegnet sein. Dieser Sprach- und Dialektkontakt setzt sich nach der Übersiedlung nach Petach Tikwa mehr oder weniger ungebrochen fort. An der Gründung der Kolonie waren Jerusalemer Juden, vor allem aus der Gemeinde der Peruschim, sowie Neuzuwanderer aus dem damaligen Königreich Ungarn beteiligt, die ab 1883 durch Aktivisten aus Białystok, also noj. Dialektgebiet, verstärkt wurden.45 Aus einer 1892 durch das sog. › Odessaer Komitee ‹ der › Zionsfreunde ‹ erstellten Statistik geht hervor, dass die meisten Bewohner Petach Tikwas aus Litauen und Belarus stammten, gefolgt von der Ukraine, dem übrigen Russland, Ungarn, Jerusalem und anderen Regionen.46 2 . 2 Sprachpolitik – Der Gebrauch des Jiddischen ist in den Agrarkolonien weder institutionell verankert noch von den europäischen Förderern – in erster Linie die Vereine der › Zionsfreunde ‹, Baron Rothschild, die jca – für die Dauer vorgesehen. Die in den Siedlungen eingerichteten Schulen sind zumindest ihrem Anspruch nach hebräischsprachig oder räumen dem Hebräischunterricht einen zentralen Ort im Lehrplan ein. Dennoch scheinen einzelne Gruppen wie z. B. die Bewohner von Gedera stärker am Jiddischen festgehalten zu haben als andere.47 Der Übergang zum Hebräischen als Umgangssprache war in den Agrarkolonien gegen Ende des Ersten Weltkriegs noch längst nicht vollzogen. So stellt ein Kommissionsbericht der Partei Poale Zion von 1920 fest, dass » die Mehrheit der Koloniebevölkerung bis heute jüdisch [ = Jiddisch ] spricht «.48 Auch wenn diese Aussage im Kontext innerzionisti43 Zur Jeschiwa Etz Chaim vgl. Rossof 1998 : 233 – 236. 44 Vgl. Frankl 1858 ( ii ) : 5o f. 45 Vgl. Aharonson 2000 : 50 f, 83 – 86 ; zu den Anführern der Gründer vgl. Halper 1991 : 110 – 112, 151 – 153 ; Rossof 1998 : 318, Tidhar 1947 ( i ) : 304. 46 Vgl. Kressel 1953 : 215 – 220. 47 Vgl. z. B. Bambus 1898 : 83. 48 Rubaschow 1922 : 19. Rubaschows Darstellung der Kolonisation erschien 1920 als Teil des von ihm herausgegebenen Berichts der » Palästina-Arbeiter-Kommission « der Partei Poale Zion in jiddischer Sprache und 1922 als selbständige Publikation in deutscher Über- 380 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ scher Polemiken zu sehen ist,49 besteht kein Anlass, an ihrer Richtigkeit zu zweifeln. 2 . 3 Hebraismus – Die Postkarte verrät eine Orientierung auf das Hebräische hin. Die von Slor gewählte traditionelle Briefform – hebräische Eröffnungs- und Schlussformel, jiddischer Kerntext – bewegt sich noch im Rahmen der für das orthodoxe Milieu charakteristischen jiddischhebräischen Zweisprachigkeit mit ihren klaren Funktionstrennungen und Statusunterschieden : Hebräisch, die Sakral- und Hochsprache, war das Medium der religiösen Gelehrsamkeit und der gehobenen Schriftlichkeit. Für eine Korrespondenz unter gelehrten jüdischen Männern galt es als die eigentlich würdige Sprache. Jiddisch war dagegen die alltägliche, › niedere ‹, aber in der Realität unverzichtbare Umgangssprache und zugleich Medium gewöhnlicher Schriftlichkeit. Die jüdische Nationalsprache der Zukunft sollte für Slor jedoch allein das Hebräische sein : So ist er stolz auf seine Tochter, weil sie Hebräisch in Wort und Schrift beherrscht – was wiederum zeigt, dass eine solche Sprachkompetenz um 1900 auch unter der jüngeren Generation im Lande noch nicht selbstverständlich war. Er selbst hat das Hebräische vermutlich zu bestimmten Gelegenheiten, soweit möglich, aktiv gesprochen, war aber sicher in den meisten Fällen auf das Jiddische angewiesen.50 Entwicklungen innerhalb der jiddischen Schreibsprache jener Zeit werden von Slor dagegen nur begrenzt mitvollzogen ( s. u. 3 . 1 ), und dies wohl nur zum Teil aus Mangel an Mitteln oder Möglichkeiten. Dem in Osteuropa stattĳindenden Ausbau des Jiddischen zu einer modernen Literatursprache stand er anscheinend gleichgültig gegenüber, sofern er ihn überhaupt wahrnahm. In seiner Schreibart folgt er offenkundig den im chejder erlernten Konventionen, auch gebraucht er Wortformen, die keinen Eingang in die Literatursprache fanden ( s. u. 3. 2. 2 ). 2 . 4 Fremdsprachen – Zu den vielen Fremdsprachen, mit denen Slor in seiner Lebenswelt in Kontakt gekommen ist, zählen das Französische und das Deutsche. Französisch war im gesamten Osmanischen Reich als Verkehrssprache unverzichtbar ( und daher Lehrfach in den Schulen setzung, s. ibid. 5, 68. 49 Der Bericht erklärt das Modell der privatwirtschaftlich-kapitalistischen Agrarkolonie für gescheitert und favorisiert die Gründung von Genossenschaften, s. Rubaschow 1922 : passim. Vgl. auch Chaver 2004 : 23. 50 Vgl. dazu Chaver 2004 : 23 f. Roland Gruschka : Von Petach Tikwa über Jaffa nach Meknès 381 der Kolonien ).51 Darüber hinaus begegnete dem Kolonisten die Sprache in der Verwaltung des Barons Rothschild. Slor muss über relativ gute Deutschkenntnisse verfügt haben : Zwei der Ingenieure, für die er als Vermessungsgehilfe arbeitete, waren Deutsche.52 Seine Anstellung bei einem » Herrn Weiß aus Wien « spricht ebenfalls dafür. 3. Sprachdokumentation 53 3 . 1 Schreibart – Die von Slor gebrauchten Schreibkonventionen erlauben nur eine begrenzte Aussage über die tatsächliche Aussprache der Wörter. Eine Analyse einzelner Grapheme deutet jedoch darauf hin, dass seine Aussprache der Haupttonvokale54 sowohl noj. wie auch soj. oder zoj. Färbungen aufwies. 3 . 1 . 1 Tsvey yudn – Das Graphem ‫ ( איי‬alef-tsvey yudn ) steht für / aj / oder / āj /. Gesichert ist diese Lesart für die folgenden Fälle : ‫אנאייע‬ ( a ) naye ; ‫ נאייס‬nay (e) s ; ‫ נאיי‬nay ; ‫ ה’ וואייס‬her Vays ; ‫ סטאייען‬stayen ; ‫שטאייגט‬ shtaygt ; ‫ לאייען‬layen ; ‫ באיי‬bay ; daher wohl auch ‫ מאנאייט‬monayt. Ein solcher Gebrauch von ‫ איי‬alef-tsvey yudn dient anscheinend der Verdeutlichung der Aussprache in Unterscheidung von ‫יי‬, den › einfachen ‹ tsvey yudn, deren Aussprache mehrdeutig bleibt. So stehen die einfachen tsvey yudn auf Vokal 21 vor / ŋg / und / ŋk / eindeutig für / ej / : ‫ בריינגין‬breyngen ; ‫ קריינקען‬kreynken. Diese Aussprache war vor allem im noj und im nördlichen Gebiet des soj verbreitet.55 Dagegen handelt es sich beim Gebrauch des › einfachen ‹ Graphems für Vokal 34 um eine feste Schreibkonvention, der verschiedene Aussprachen – zoj. / a /, soj. / ā / oder noj. / aj / – entsprochen haben können : ‫ * מיין‬/ man / , * / mān / oder * / majn /, msj. mayn. Ebenso lassen sich bei Vokal 22 und 24 die einfachen tsvey yudn entweder als / aj / oder als / ej / lesen, also : ‫ * גיין‬/ gejn / oder * / gajn /, msj. geyn ; ‫ * צווייטין‬/ cvejtn / oder * / cvajtn /, msj. tsveytn. 51 Vgl. Grunzel 1903 : 141, 148 ; Bambus 1898 : 87, 135. 52 Vgl. Tidhar 1947 ( i) : 307, und die biographischen Quellen in Fußnote 9. Sowohl Rothschild als auch die jca beschäftigten deutschsprachige Spezialisten wie etwa den in der Postkarte erwähnten » Ingenieur aus Wien «. 53 Im Folgenden werden jiddische Wörter oder Phrasen nach dem msj transkribiert, sofern Slors tatsächliche Aussprache unerheblich ist. Ein Asterisk zeigt rekonstruierte Ausspracheweisen an. 54 Im Folgenden verwende ich Weinreichs Notation zur Bezeichnung der Haupttonvokale. Dazu vgl. lcaaj ( i) : 10 – 14 ; Katz 1983 : 1021 – 1024 ; Jacobs 2005 : 28 – 31 ; M. Weinreich 1973 ( ii ) : 321 – 382. 55 Vgl. lcaaj ( i ) : 22 sowie Karten 11 und 16 ; Mark 1951 : 434 ; vgl. auch Kiefer / Neumann 1995 : 110, 116, 162. 382 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ 3 . 1 . 1 . 1 Vor diesem Hintergrund lässt sich Slors Aussprache von aleftsvey yudn im Vokalanlaut nicht mit letzter Sicherheit klären. Der Gebrauch von ‫ איין‬als unbestimmtem Artikel ( vgl. 3 . 5 . 3 . 1 ) deutet eher auf eine Aussprache als / aj / hin. In der Phrase ‫ האלט ל ” ע אין איין קריינקען‬halt l ” a [ = loy aleykhem ] in eyn / ayn kreynken ( wo es auf ein substantiviertes Zahlwort zurückgeht, vgl. dt. › in einem fort ‹ ) sowie als Zahlwort in ‫איין‬ ‫ פארא‬eyn / ayn pare lässt es sich als / ej / oder / aj / lesen, je nachdem, ob sich bei diesem Wort in Slors Aussprache eine soj. bzw. noj. oder aber eine zoj. Dialektfärbung von Vokal 24 durchgesetzt hat. Im Präĳix ist / aj / ( oder / ā / ) zu lesen : ‫ איין גיזעצט‬ayngezetst. 3 . 1 . 1 . 2 Inwieweit es sich bei der Unterscheidung von alef-tsvey yudn und einfachen tsvey yudn um eine in bestimmten Kreisen verbreitete Schreibkonvention handelt oder eher um einen individuellen Sprachgebrauch, ist noch nicht erforscht. 3 . 1 . 2 Das Wort ‫ ( ווַ יל‬msj. vayl ) lässt sich als / vajl /, / vāl / oder / val / lesen. Die auffällige Schreibweise lässt sich als ein sporadisches Hineinwirken einer kontinuierlichen Lese- und Schreibpraxis im Modernen Hebräisch in Slors Jiddisch deuten, gleichzeitig auch als Sofortkorrektur für das fehlende yud. 3 . 1 . 3 Vov und yud – In Slors persönlicher Handschrift, insbesondere in dem flüchtigen Schreiben der Postkarte, werden die Unterschiede zwischen einzelnen Buchstaben, allen voran yud und vov, nicht selten bis zur Unkenntlichkeit verwischt. Die zweimal auftretende klare Schreibung ‫ * אגריס‬/ ( a ) gris /, msj. ( a ) grus deutet jedoch darauf hin, dass Slor die Vokale 51 und 52 in soj. oder zoj. Weise als i-Klänge aussprach. 3 . 1 . 4 Auffällig ist die Wiedergabe des Phonems / ž / durch ein einfaches zayen : ‫ אינזינער‬inzhiner. In der jiddischen Literatursprache scheint sich das heute dafür übliche Graphem ‫ זש‬zayen-shin erst in der Zeit ab 1903 wirklich durchzusetzen.56 Aufgekommen ist diese Schreibkonvention allerdings spätestens im ersten Drittel des 19. Jahrhunderts.57 Slors Gebrauch einer zu seiner Zeit schon veraltenden jiddischen Schreibkonvention erklärt sich am ehesten als Konservatismus, wenn nicht Gleichgültigkeit gegenüber der Entwicklung der modernen jiddischen Literatursprache ( s. o. 2 . 3 ). 56 Die ab 1903 in Sankt Petersburg erscheinende Zeitung Der fraynd verwendet wie selbstverständlich das Graphem zayen-shin, so wie vor ihm bereits Scholem Alejchem in seiner Folksbiblyotek. In verschiedenen Ausgaben der Erzählungen A. M. Diks aus den letzten Jahrzehnten des 19. Jahrhunderts ĳindet sich jedoch noch einfaches zayen für / ž /, z. B. in ‫אר ָגאן‬ ְ ַ‫ז‬ zhargon ( Dik 1889 : 1 ). 57 Mendel Leĳin Satanower führt die Schreibweise in der Vorrede zu seiner jiddischen Psalmenübersetzung den Lesern gegenüber als Neuerung ein, vgl. Gruschka 2004 : 7, Gruschka 2007 : 219. Roland Gruschka : Von Petach Tikwa über Jaffa nach Meknès 383 3 . 1 . 5 Ein weiterer konservativer Zug in Slors Schreibart ist der Gebrauch des › stummen Alef ‹ im Vokalauslaut : ‫ דיא‬di ; ‫ צוא‬tsu. 3.2 Wortschatz 3 . 2 . 1 Verb › sein ‹ – Slor gebraucht die soj. und zoj. Form ‫ זענען‬zenen für › sind ‹. 3 . 2 . 2 › Monat ‹ – Vermutlich sprach Slor das Wort ‫* מאנאייט‬monayt genau so aus, wie er es geschrieben hat. Der Gebrauch dieser Form mit aj-Diphthong ist um so bemerkenswerter, als er über einen längeren Zeitraum Sprachkontakt mit dem Neuhochdeutschen hatte ( vgl. 2 . 4 ) und daher das nhd. Wort Monat oft genug gehört haben muss. Dennoch sind ( zumindest in dieser Quelle ) keine Interferenzen zwischen beiden Formen zu beobachten.58 3 . 2 . 2 . 1 Schreibweisen des Wortes mit tsvey yudn, die auf eine diphthongierte Aussprache hindeuten, sind im Jiddischen kein Einzelfall. So ist z. B. in den Briefen des Shimshon Gerye, der 1855 aus dem galizischen Janów ( Bezirk Tarnopol ) nach Amerika auswanderte, die eindeutig vorherrschende Form ‫ * מאנייט‬/ munajt / ( 9 Vorkommen gegen jeweils ein ‫ * מאנייד‬/ munajd / und einmal ‫ * מאנאד‬/ munad / ).59 Ein früher Beleg ( 7 Vorkommen von ‫ * מאנייט‬/ monajt / neben 5 Vorkommen von ‫מאנהייט‬ * / monhajt / und zwei mal ‫מאניט‬, dessen Aussprache * / monet / oder * / monajt / gelautet haben kann ) ĳindet sich in der Leipziger Handschrift des Achaschwerosch-Esther-Spiels von 1697 ( Nachlass Wagenseil ),60 wobei die sprachgeographische Zuordnung schwierig bleibt.61 3 . 2 . 2 . 2 In der jiddischen Literatur des ausgehenden 19. Jahrhunderts waren die Formen ‫אנ ֵהייט‬ ְ ‫ * ָמ‬/ monhejt / bzw. ‫אנ ַהייט‬ ְ ‫ * ָמ‬/ monhajt / weit verbreitet.62 Dov Sadan belegt diese Variante vor allem bei Autoren, die aus dem noj. Sprachgebiet stammen, u. a. bei A. M. Dik, Shomer und Elyokem Tsunzer.63 58 Anders in den unter 3.5.3 geschilderten Fällen. 59 Für einen Abdruck der Briefe mit Einführung s. Eshelman 2005. 60 Für einen Abdruck des Stückes siehe Frakes ( 2004 : 772 – 810 ), Shmeruk ( 1979 : 155 – 210 ). Nach der von Shmeruk eingeführten Zeilenzählung ĳindet sich ‫ * מאנייט‬/ monajt / in den Zeilen 464, 478, 487, 489, 503, 512, 514 ; die Form ‫ * מאנהייט‬/ monhajt / in den Zeilen 483, 520, 524, 534, 536 ; sowie ‫ * מאניט‬/ monet / oder * / monajt / in den Zeilen 468, 476, vgl. Frakes 2004 : 786 – 788. 61 Wie Bernhard Weinryb ( 1936 : 416 – 418 ) überzeugend gegen Ignacy Szyper ( Yitskhok Shiper ) nachweist, stammte zwar der Kopist aus Krakau, die Handschrift selbst aber wurde in Altdorf angefertigt, und die literarische Vorlage ist in Deutschland zu suchen. 62 Vgl. z. B. Dik ( 1858 : 82 [ falsche Paginierung, richtig : 38 ] ) : ‫אנ ַהייט‬ ְ ‫* ַאיין ָמ‬ayn monhayt › ein [ ganzer ] Monat ‹ ; sowie Szulhof ( 1863 : 10 ) : ‫אנ ֵהייט‬ ְ ‫* ִאן ֵאיין ָמ‬in eyn monheyt › innerhalb eines Monats ‹. 63 Vgl. Sadan 1972. Leider gibt Sadan die Beispiele nicht mit Originalpunktierung. 384 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ 3 . 2 . 2 . 3 Entstehung und Verbreitung dieser diphthongierten Formen – *monayt, *munayt, *monhayt und *monheyt – im Jiddischen und ihre sprachgeschichtliche Abhängigkeit voneinander sind noch nicht erforscht. Vermutlich gehen sie auf hyperkorrekte Aussprachen in deutschen Dialekten zurück ( vgl. mhd. môneit, môneid, mâneid ).64 In jedem Fall muss der h-Einschub eine spätere Entwicklung gewesen sein. Theoretisch könnte *monayt / *munayt ursprünglich auch eine innerjiddische Hyperkorrektur ( im Grenzgebiet von zoj und wj oder von zoj / soj und noj ) gewesen sein.65 Unabhängig davon scheint die von Slor gebrauchte Form *monayt von allen genannten Varianten ( wenn überhaupt ) am wenigsten in der Buchsprache vorzukommen. 3 . 3 Genera – Es fällt auf, dass im Postkartentext di gelt und di gold weiblich sind und der substantivierte Inĳinitiv der forn männlich. Diese Genusverschiebungen gehen wohl auf den Einfluss des noj zurück : Der lcaaj belegt ein Femininum di gelt fast ausschließlich für noj. Gebiet.66 Die Bildung der Präpositionalphrase vi di gold folgt dem Muster für Feminina der Unterkategorie › Stoff, Masse ‹ ( sog. mass subgender ), die im noj an die Stelle entsprechender Neutra getreten sind und als bestimmten Artikel nur ein nicht-flektiertes di besitzen.67 Substantivierte Inĳinitive sind im noj stets männlich,68 worüber sich das Auftreten von der forn erklären lässt.69 3 . 3 . 1 Die in der Postkarte gebrauchte weibliche Form di vert ( im msj ist das Wort männlich ) geht auf ein historisches Maskulinum zurück ( vgl. mhd. der vërt ). Ohne eine Einzelerhebung zum betreffenden Lexem kann im konkreten Fall nicht sicher entschieden werden, aus welchem Dialekt diese Genusverschiebung stammt. Ein Einfluss des noj ist jedoch nicht auszuschließen.70 64 Zur Aussprache der mhd. Formen vgl. Brenner 1894 : 476 ; dagegen allerdings Schirokauer 1923 : 82. 65 So könnte das Aufeinandertreffen der Aussprachen von Vokal 34 als / aj / im wj und / ā / im zoj oder von kurzem / a / im soj und / aj / im noj die Hyperkorrektur verursacht haben. Für einen ähnlich gelagerten Fall von Hyperkorrektur vgl. die laut Wolf ( 1969 : 196 ) bei einzelnen Sprechern des soj und zoj beobachtete Form lutvak für litvak. 66 Vgl. Wolf 1969 : 155, Karte 4 :2. Für das soj. Gebiet zeigt die Karte einige wenige, verstreute Belege an. 67 Vgl. Wolf 1969 : 116 – 118, 127 f, 211 f ; Jacobs 1990. 68 Vgl. Mark 1951 : 452. 69 Darüber hinaus sind nach Meyer Wolf ( 1966 : 175 – 188 ) Genusverschiebungen von Neutrum zu Maskulinum gerade im nordwestlichen Grenzgebiet des noj gehäuft nachweisbar ; dies schließt insbesondere die Gegend westlich von Białystok mit ein. 70 Wolf ( 1969 : 167 – 171 ) untersucht u. a. die Verbreitung der Feminina di haldz, di lefl, di tsuker, di zok, di grub und kommt anhand der Befunde – Vorkommen im noj, gestaffeltes Ausgreifen in das nördliche Grenzgebiet des soj – zu dem Schluss, dass das noj ein Hauptzentrum der Genusverschiebungen von Maskulinum zu Femininum ist. Allerdings doku- Roland Gruschka : Von Petach Tikwa über Jaffa nach Meknès 385 3 . 3. 2 Die Adjektive in den Phrasen eyn / ayn nay gesheft und a voyl meydl weisen die Nullendung der ( schwachen ) Deklination für Neutra auf. Angesichts des gehäuften Auftretens typisch noj. Genusverschiebungen im Postkartentext und mangels weiterer Belege muss jedoch offen bleiben, inwieweit sich diese Nomina in Slors Dialekt noch in jeder Hinsicht wie echte Neutra verhalten ( also dem soj. Gebrauch bzw. der msj. Norm folgen ). Zumindest a voyl meydl könnte eine erstarrte Reliktform sein.71 Ebenso gut könnte in Slors Jiddisch die Deklination der Adjektive vor gesheft und anderen ( historischen ) Neutra zwischen noj. und soj. Mustern variiert haben. 3 . 4 Kasus – Slors Sprache zeigt den besonders für das zoj und den noj. Unterdialekt von Kurland charakteristischen Kasuszusammenfall von Dativ / Akkusativ für das Femininum Singular :72 bay di ika ; far di shtele ; die Phrase vi di gold ist eher ein Grenzfall, vgl. oben, 3 . 3. Diese Erscheinung tritt auch im Adjektiv auf : zeyer in a gute hant. Für die geographisch zwischen Zentralpolen und Kurland liegende westliche Grenzregion des noj, zu der auch Białystok gehört, wurde ein solcher Kasuszusammenfall im Femininum zumindest bei einem attributiven Adjektiv in indeĳinitem Kontext beobachtet.73 Nur einmal ĳindet sich die im soj für den weiblichen Singular vorherrschende Dativendung auf -er : in der b (a) yare.74 3 . 4 . 1 Pronomina werden in Verbindung mit transitiven Verben dagegen nach dem soj. ( und msj. ) Muster gebeugt, d.h. beim Einsatz nach Präposition oder als indirektes Objekt stehen sie im Dativ : Fun mir mayn liber bruder hob ich dir keyn freylikhe nayes tsu shraybn ; mihastam vet [ hashem-yisborekh ] af mir rakhmones hobn. 3 . 4 . 2 Reflexiva – Slor gebraucht anscheinend zikh › sich ‹ als einheitliches Reflexivpronomen für alle Kasus und Numeri : nokh azoy ĳil plogn zikh vi du host zikh nebekh geplogt. Dies ist eine Eigenart des noj, die jedoch ( vermutlich über die Literatursprache ) ins soj streut.75 mentiert Wolf ( 1969 : 180 – 192 ) auch eine Anzahl von Genusvariationen, deren geographische Verteilung sich nicht den Grenzen der Hauptdialekte anschließt. 71 Yudl Mark ( 1951 : 451 f ) belegt eine Reihe solcher Relikte ( u. a. : a gut-vort ; a beyz-vunder ). Die Lexeme gesheft und meydl ĳinden sich jedoch nicht darunter. Vgl. auch Wolf 1969 : 198 – 201. 72 Vgl. Wolf 1969 : 129 – 142. 73 Vgl. ibid. : 132 f, Karte 3 : 4. Erfragt wurde dabei die Phrase fun a fule(r) flash. 74 Die Schriftform erlaubt keine Erschließung der genauen Aussprache des bestimmten Artikels ‫ דיא‬in den genannten Beispielen, damit ist auch keine sichere Rückführung des Kasuszusammenfalls auf phonologische Erscheinungen ( z. B. r-Ausfall ) möglich. 75 Vgl. Katz 1983 : 1031. Für Streubelege im soj vgl. z. B. in Kiefer / Neumann 1995 die Interviews Nr. xiv / 28, S. 168, und Nr. xiv / 36, S. 138. 386 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ 3 . 5 Einflüsse anderer Sprachen 3 . 5 . 1 Arabisch – b (a) yáre, b (a) yára ( entweder < arab. baiyāra, oder < arab. biara ) › Orangenhain ‹, im weiteren Sinne › Obstplantage mit Bewässerungsanlage ‹, vgl. Kosover ( 1966 : 284, Nr. 435 ). 3 . 5 . 2 Modernes Hebräisch / Ivrith 3 . 5 . 2 . 1 Wortschatz – kerem › Weinberg ‹. Das im Jiddischen übliche Wort ist vayngortn ( vgl. mhd. wîn-gart ). In den Rothschildschen Kolonien wird kerem als terminus technicus geläuĳig gewesen sein. 3 . 5 . 3 Neuhochdeutsch 3 . 5 . 3 . 1 Der Gebrauch von ‫ איין‬eyn ( oder ayn ? ) als unbestimmtem Artikel geht vermutlich auf den Einfluss des Deutschen zurück ( vgl. dt. › ein( er ) ‹ usw. ) : mit eyn / ayn kind. In drei Fällen könnte es sich auch um eine ( ans Deutsche angelehnte ) hyperkorrekte Schreibweise handeln, der eine tatsächliche Aussprache als a (n) zu Grunde liegt : eyn / ayn inzhiner fun Vin ; in eyn / ayn nay gesheft ; on eyn / ayn ayen-hore. 3 . 5 . 3 . 2 Die Wortform ‫ ערהאלטין‬erhalten ist eindeutig aus der nhd. Schriftsprache übernommen. 3 . 5 . 3 . 3 Gebrauch von dos als Konjunktion ( vgl. dt. › dass ‹ ) : Es iz ober shoyn b ” h [ = beavoyseynu horabim ] mer vi ½ yor dos ikh hob fun mayn arbet eyn pare nit fardint. 3 . 5 . 3 . 4 Verneinung – Zweimal bildet Slor die Verneinung nach deutschem Muster mit einfachem › kein ‹ : Fun mir mayn liber bruder hob ikh dir keyn freylikhe nayes tsu shraybn ; [ … ] vayl der mentsh shikt mir oykh keyn gelt shoyn 7 monayt. Diese Abweichung von der jiddischen Grammatik trat vermutlich auch in seiner Rede sporadisch auf, ohne jedoch die für das Jiddische regelgerechte doppelte Verneinung zu verdrängen. Letztere wird zumindest im Postkartentext ebenso häuĳig gebraucht : er [ … ] ken keyn gelt nit aroys nemen ; [ … ] krig ikh nit keyn pas. 4. Sprachgeschichtliche Einordnung und Ausblick In Slors Jiddisch mischen sich die Dialekte. In der Aussprache lassen sich sowohl soj. wie noj. Färbungen beobachten ( 3 . 1 . 1 ; 3 . 1 . 3 ). Eine zoj.soj. Prägung hat sich in Teilen des Grundwortschatzes erhalten ( 3 . 2 . 1 ), was vermutlich auf die Herkunft seiner Eltern zurückgeht. Im Kasusund Genusgebrauch herrscht dagegen offenkundig der Einfluss des noj vor ( 3 . 3 ; 3 . 4 ). Dieser Befund passt sehr gut mit Slors oben skizzierter sprachlicher Sozialisation in Jerusalem und mit den zu seiner Zeit in Petach Tikwa bestehenden Dialektkontakten zusammen ( vgl. 2 . 1 ). Roland Gruschka : Von Petach Tikwa über Jaffa nach Meknès 387 Die Frage, inwieweit die im Postkartentext beobachteten konkreten Ausprägungen von Dialektmischung oder andere sprachliche Eigenarten Slors auch wirklich typisch für das an den genannten Orten gesprochene Jiddisch sind, erfordert allerdings noch weitergehende, umfangreiche Quellenstudien. Zwei Zeugnisse aus späterer Zeit lassen jedoch in Verbindung mit den Befunden aus Slors Postkarte die Linien einer möglichen Entwicklung des Jiddischen in Petach Tikwa und Jerusalem erkennen : In beiden Orten scheint eine Annäherung an das noj, wenn nicht ein vollständiger Übergang zu diesem Dialekt stattgefunden zu haben. 4 . 1 Jerusalem – In Jerusalem war nach Kosovers Beobachtung Anfang der 1930er Jahre der noj. Dialekt vorherrschend.76 Sogar die in Jerusalem geborenen Nachfahren aschkenasischer Einwanderer aus Polen oder Ungarn sollen » dos litvishe yidish «, also noj, gesprochen haben.77 Diese Feststellung beschreibt jedoch allenfalls den Endpunkt einer wechselhaften, langjährigen Entwicklung ; sie ist möglicherweise auch durch die Wahl der Informanten aus den Reihen religiös-konservativer, charedischer Gruppen ( des › Alten Jischuw ‹ ) mitbestimmt. Für die Jahre 1860 – 1900 ist dagegen von einer größeren Variation an Dialektmischung auszugehen, in der das noj lediglich einen, wenn auch vielleicht den gewichtigsten, Faktor ausmacht. Einige von Kosover selbst dokumentierte Eigenarten des Jerusalemer Jiddisch deuten auf ein stärkeres Gewicht zoj. und soj. Dialekte in früherer Zeit hin.78 4 . 2 Petach Tikwa – Bei den aus dem Königreich Ungarn stammenden Zuwanderern unter den Gründern Petach Tikwas hat vermutlich ebenfalls Dialektmischung, wenn nicht Angleichung an das noj stattgefunden. Einen Hinweis darauf geben die Erinnerungen der aus Petach Tikwa stammenden hebräischen Dichterin Esther Raab : 79 [ We ] spoke Yiddish, Hungarian Yiddish. I am from Hungary. Then the Lithuanian Jews came, and the whole household adopted Yiddish, that nice Yiddish that the Bialystokers spoke… Yiddish is a beautiful language [ … ] 76 Kosover 1932 : 43 ; Kosover 1966 : 117, Fn. 56 ; Katz 1983 : 1031. 77 Kosover 1932 : 43. 78 So etwa der zoj. und soj. Gebrauch von ire mit Zahlworten zur Benennung von Gruppengrößen, nach Kosover ( 1966 : 364 f ) » heard everywhere in the Old Yishuv, even among Jews from Lithuania where the word was not current «. 79 Zitiert nach Chaver 2004 : 29. 388 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Raab wurde 1899, also lange nach Gründung der Kolonie geboren. Daher gibt ihre Darstellung wohl nicht unmittelbar Erlebtes, sondern eher die Familienlegende oder das gemeinsame Narrativ der ersten Kolonisten wieder. Soweit ihre Erzählung zutrifft, könnte der beschriebene Übergang zum noj Endpunkt einer langjährigen Entwicklung gewesen sein. 4 . 3 Kontinuität und Bedeutung – Slors Nachfahren gingen anscheinend, ebenso wie die Mehrheit der Einwohner Petach Tikwas, innerhalb von zwei Generationen vollständig zum Hebräischen über. Damit hat die von Slor gesprochene Varietät des Jiddischen wohl keine Fortsetzung in Petach Tikwa gefunden. Unabhängig von der Frage einer unmittelbaren Kontinuität wäre ein Vergleich mit den Sprachverhältnissen lohnend, die im Milieu der Charedim in den Jahren nach der Gründung des Staates Israel oder in den USA nach dem Zweiten Weltkrieg geherrscht haben müssen : In beiden Lebenswelten trafen noj, zoj und soj ohne den regulierenden Einfluss der modernen Literatursprache, ganz zu schweigen von den Normen msj. Schulgrammatiken, aufeinander. Die Suche nach Parallelen und Abweichungen im Bereich der Dialektmischung oder der Entwicklung des Genus- und Kasussystems könnte sich als aufschlussreich erweisen. In dieser Hinsicht ist die Vorgeschichte des Jiddischen im heutigen Israel auch für die Erforschung der aktuellen und zukünftigen Entwicklungen dieser Sprache von nicht zu unterschätzender Bedeutung. Zitierte Literatur Aharonson, Ran, 2000 : Rothschild and the Early Jewish Colonization in Palestine. Lanham, md : Rowman & Littleĳield. Bambus, Willy, 1898 : Palästina. Land und Leute. Reiseschilderungen. Berlin : Siegfried Cronbach. Bartal, Israel, 1981 : » › Old Yishuv ‹ and › New Yishuv ‹ : Image and Reality. « In : Jerusalem Cathedra 1 : 215 – 231. – und Ettinger, Shmuel, 1982 : » The First Aliyah : Ideological Roots and Practical Accomplishments. « In : Jerusalem Cathedra 2 : 197 – 227. Brenner, Otto, 1894 : » Zum deutschen Vocalismus. « In : Beiträge zur Geschichte der deutschen Sprache und Literatur 19 : 472 – 485. Chaver, Yael, 2004 : What Must be Forgotten : The Survival of Yiddish in Zionist Palestine. Syracuse : Syracuse University Press. Roland Gruschka : Von Petach Tikwa über Jaffa nach Meknès 389 Dik, Ayzik-Meyer, 1858 : Di dinst-meydl, oder : ayn shpil des shikzals. Wilna : Romm. – 1889 : Evgenye, oder : di geheymnise fun frantseyzishn hoyf. Bd. 1. Wilna : Romm. Ehrenreich, Chaim, 1957 : Lender un mentshn. Rayze bashraybungen. New York : tsiko. Eshelman, Nicholas, 2005 : » ›All Alone, Without Money, No Language – Just Yiddish ‹ : An Immigrant ’ s Letters from Missouri to Galicia. « In : UConn Libraries Published Works ( 2005 ), Paper 14. <http://digitalcommons.uconn.edu/libr_pubs/14 > ( letzter Zugriff : 24. 02. 2012 ). Frankl, Ludwig August, 1858 : Nach Jerusalem ! 2 Bde. Leipzig : Baumgärtner ’ s Buchhandlung. Frakes, Jerold C., Hg., 2004 : Early Yiddish Texts 1100 – 1750. Oxford : Oxford University Press. Grajewski, Pinchas, 1930 : » Lūḥōt ’avnēy zikkārōn «, Folge 7. In : Ders., Hg., Bēyt hā- ’ ōẓār, Bd. 2. Jerusalem : Selbstverlag ( separate Paginierung ). Grunzel, Joseph, 1903 : Bericht über die wirtschaftlichen Verhältnisse des Osmanischen Reiches. Wien : k. u. k. Hof- und Staatsdruckerei. Gruschka, Roland, 2004 : » Einige Beobachtungen zur Grammatik im Jiddisch von Mendel Leĳin Satanowers Bibelübersetzungen. « In : Jiddistik-Mitteilungen 32 : 1 – 26. – 2007 : Übersetzungswissenschaftliche Aspekte von Mendel Leĳin Satanowers Bibelübersetzungen. Hamburg : Buske. Halper, Jeff, 1991 : Between Redemption and Revival : The Jewish Yishuv of Jerusalem in the Nineteenth Century. Boulder : Westview Press. Hasson, Shlomo, und Gilboa, Shaked, 2007 : » Petah Tikvah. « In : Michael Berenbaum und Fred Skolnik, Hg., Encyclopedia Judaica. 2. Aufl. Bd. 16. Detroit : Macmillan, 14 f. Herzog, Marvin I., 1969 : » Yiddish in the Ukraine : Isoglosses and Historical Inferences. « In : Marvin I. Herzog, Wita Ravid und Uriel Weinreich, Hg., The Field of Yiddish : Studies in Language, Folklore and Literature 3. London : Mouton, 58 – 81. Jacobs, Neil G., 1990 : » Northeastern Yiddish Gender-Switch : Abstracting Dialect Features Regionally. « In : Diachronica 7 ( 1 ) : 69 – 100. – 2005 : Yiddish : A Linguistic Introduction. Cambridge : University Press. Kaniel, Yehoshua, 1981 : » The Terms › Old Yishuv ‹ and › New Yishuv ‹ : Problems of Deĳinition. « In : Jerusalem Cathedra 1, 232 – 245. Karlinsky, Nahum, 2005 : California Dreaming. Ideology, Society and Technology in the Citrus Industry of Palestine, 1890 – 1939. Albany : suny Press. 390 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Katz, Dovid, 1983 : » Zur Dialektologie des Jiddischen. « In : Werner Besch, Ulrich Knoop, Wolfgang Putschke und Herbert E. Wiegand, Hg., Dialektologie. Ein Handbuch zur deutschen und allgemeinen Dialektforschung, Bd. 2. Berlin : de Gruyter, 1018 – 1041. Kiefer, Ulrike, und Neumann, Robert, 1995 : Gesprochenes Jiddisch. Textzeugen einer europäisch-jüdischen Kultur. Tübingen : Niemeyer. Kosover, Mordechai, 1932 : » Vegn yidish fun altn ashkenazishn yishev in Erets-yisroel. « In : yivo-bleter 4 : 43 – 50. – 1939 : » Der alter yishev in Erets-yisroel ( 60er un 70er yorn fun fargangenem yorhundert ). « In : yivo-bleter 14 : 405 – 424. – 1966 : Arabic Elements in Palestinian Yiddish : The Old Ashkenazic Jewish Community in Palestine, its History and its Language. Jerusalem : Rubin Mass. Kressel, Getzel, 1953 : ’Ēm ha-mōšavōt Petaḥ Tiqwāh. Petach Tikwa : Stadt Petach Tikwa. Laskier, Michael M., 1983 : The Alliance Israélite Universelle and the Jewish Communities of Morocco 1862 – 1962. Albany : suny Press. – und Bashan, Eliezer, 2003 : » Morocco. « In : Reeva Spector Simon, Michael Menachem Laskier und Sara Reguer, Hg., The Jews of the Middle East and North Africa in Modern Times. New York : Columbia University Press, 471 – 504. lcaaj = Marvin I. Herzog u. a., Hg., 1992 – 2000 : The Language and Culture Atlas of Ashkenazic Jewry. Bisher 3 Bde. Tübingen : Niemeyer. Louvish, Misha, 2007: » Aliyah and Absorption : Modern Aliyah, 1880– 1948. « In : Michael Berenbaum und Fred Skolnik, Hg., Encyclopædia Judaica. 2. Aufl. Bd. 10. Detroit: Macmillan, 333–339. Mark, Yudl, 1951 : » Undzer litvisher yidish. « In : Mendl Sudarski, Urye Katsenelnbogn und Yitskhok Kisin, Hg., Lite, Bd. 1. New York : Kultur-gezelshaft fun litvishe yidn, 429 – 472. Nawratzki, Curt, 1919 : Das neue jüdische Palästina. Berlin : Jüdischer Verlag. Petry, Erik, 2001 : » Die › Erste Alija ‹. Geschichte und Wirkung der ersten großen jüdischen Einwanderung 1882 – 1904. « In : Yaron Perry und Erik Petry, Hg., Das Erwachen Palästinas im 19. Jahrhundert. Stuttgart : Kohlhammer, 91 – 100. Pilowsky, Arye, 1986 : Tsvishn yo un neyn. Yidish un yidish-literatur in Eretsyisroel, 1907 – 1948. Tel Aviv : Veltrat far yidish un yidisher kultur. Raphael, Yitzhak, 1958, 1960, 1956, 1971, 1983 : ’Enẓīqlōpedyāh šel ha-ẓiyyōnūt ha-dātīt. 5 Bde. Jerusalem : Mosad Ha-Rav Kook. Rossof, Dovid, 1998 : Where Heaven Touches Earth : Jewish Life in Jerusalem from Medieval Times to the Present. Jerusalem : Feldheim. Roland Gruschka : Von Petach Tikwa über Jaffa nach Meknès 391 Rubaschow [ Šazar ], Salman, 1922 : Privatwirtschaftliche und genossenschaftliche Kolonisation in Palästina. Berlin : Friedrich Ostertag. Sadan, Dov, 1972 : » Tsvishn monat un monheyt. « In : Ders., Kheyn-gribelekh, Bd. 2. Buenos Aires : Alvetlekher yidisher kultur-kongres, 121 – 129. Schirokauer, Arnold, 1923 : » Studien zur mhd. Reimgrammatik. « In : Beiträge zur Geschichte der deutschen Sprache und Literatur 47 : 1 – 126. Shmeruk, Chone, 1979 : Maḥazōt miqrā ’ īm bě-yīdīš, 1697 – 1750. Jerusalem : Israelische Akademie der Wissenschaften. Szulhof, Dawid [ Dovid Shulhof ], 1863 : Kores itos Napoleon. Warschau : Zysberg. Sufian, Sandra M., 2007 : Healing the Land and the Nation : Malaria and the Zionist Project in Palestine. Chicago : University of Chicago Press. Szold, Henrietta, 1915 : » Recent Jewish Progress in Palestine. « In : American Jewish Yearbook 5676 : 25 – 198. Tidhar, David, 1947 – 1971 : ’Enẓīqlōpedyāh la-ḥalūẓēy ha-yiššūv ū-vōnāw. 19 Bde. Tel Aviv : Selbstverlag. Weinreich, Max, 1973 : Geshikhte fun der yidisher shprakh. Bagrifn, faktn, metodn. 4 Bde. New York : yivo. Weinryb, Bernhard, 1936 : » Zur Geschichte des älteren jüdischen Theaters. Über die Leipziger Hs. des Ahasveros-Esther-Spiels. « In : Monatsschrift für Geschichte und Wissenschaft des Judentums 80 [ n.F. 44 ] : 415 – 424. Wolf, Meyer, 1969 : » The Geography of Yiddish Case and Gender Variation. « In : Marvin I. Herzog, Wita Ravid und Uriel Weinreich, Hg., The Field of Yiddish : Studies in Language, Folklore and Literature 3. London : Mouton, 102 – 215. Ya‘akōvā’ , Mě’īrāh, 2005 : » Bě-Sěfārad, bě-Marōqō, ū-vi-Kěfar Sābā ’ . « In : ‘ Et-mōl 184 : 30 – 32. Ewa Geller Die vielfach verkannte Jiddische Grammatik des Ludwik Zamenhof Die Ideen und Postulate der jüdischen Aufklärung erlangten bei den osteuropäischen Juden ihre volle Geltung erst mit einer einhundertjährigen Verzögerung, nämlich als der Prozess der technischen und gesellschaftlichen Modernisierung in Europa gar nicht mehr aufzuhalten war. Der Emanzipationswille äußerte sich neben anderem in der innerjüdischen Debatte um die Nationalsprache der Juden in Osteuropa, wie nicht zuletzt anhand der im Jahre 1908 in Czernowitz ausgerichteten jüdischen Sprachkonferenz deutlich wird. Um den Status der Nationalsprache der Juden in Osteuropa konkurrierten seit dem Beginn der zionistischen Bewegung bekanntlich zwei Sprachen : das Jiddische, die alltägliche Umgangssprache der breiten jüdischen Bevölkerung, und das Hebräische, genauer : das damals zur Wiederbelebung anstehende Neuhebräische, das genau vier Jahrzehnte später tatsächlich zur Amtssprache des neugegründeten Staates Israel wurde. Aber im Jahre 1908 schien dieser Wettbewerb noch nicht entschieden zu sein, wenn auch das Gewicht der vorgebrachten Argumente ungleich verteilt war : Hier stand Quantität ( sechs Millionen Jiddischsprecher ) gegen Qualität ( Prestige der Sprache von Bibel und Talmud ). Ungeachtet der abwertenden Bezeichnung › jüdischer Jargon ‹ sollte das Jiddische nach dem Willen der Jiddischisten in den erlauchten Kreis der modernen europäischen Kultursprachen aufsteigen. Daher kam es auf der Konferenz selbst und in ihrem Umkreis zu heftigen Auseinandersetzungen zwischen den Verfechtern der beiden Optionen.1 Die Debatte spiegelte die ideologischen Gegensätze und auch widersprüchlichen Vorstellungen wider, die unter jüdischen Eliten hinsichtlich der Frage herrschten, wie die zukünftige Modernisierung des osteuropäischen Judentums am Vorabend des Zerfalls der alten Ordnung Europas verlaufen solle. Der vorliegende Beitrag ist eine stark überarbeitete und verkürzte deutsche Fassung der polnischen Einführung » Jidyszysta Ludwik Zamenhof « ( = Geller 2012 ) zur ersten kritischen polnischen Gesamtausgabe der forthin als Studie bezeichneten Grammatik des Jiddischen von Ludwik Zamenhof ( = Zamenhof [ 1880 ] 2012 ). 1 Für nähere Informationen und eine Einschätzung der tatsächlichen und der symbolischen Bedeutung dieser Veranstaltung mit viel Literatur zum Thema s. Fishman 2008. 394 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Zu der beide jüdischen Sprachen betreffenden Entscheidung kam noch die Frage nach der Akkulturation an die Landessprachen hinzu. Unter den damaligen geopolitischen Machtverhältnissen kämpften Russisch, Polnisch und Deutsch um das Primat, und im Laufe der Zeit wurden sie immer häuĳiger zu Assimilationssprachen der jüdischen Eliten und allmählich umfassten sie immer breitere Schichten der jüdischen Bevölkerung in Osteuropa.2 Zu eben diesem Umfeld gehörte Ludwik Zamenhof, ein Augenarzt aus Warschau, der später als Begründer der Plansprache Esperanto weltbekannt werden sollte. Geboren 1859 im polnischen Białystok, damals eine multikulturelle Provinzgroßstadt im Westen des Russischen Reiches, wuchs er im assimilationsfreundlichen Milieu der jüdischen Aufklärung ( Haskala ) auf, deren Hauptidealen er bis zum Lebensende treu blieb.3 Das sprachpolitische Programm der Berliner Haskala bahnte sich nur langsam seinen Weg durch das multinationale und multikulturelle russische Zarenreich. Zamenhof selbst ist ein ausgezeichnetes Beispiel für die damals besonders für osteuropäische Juden selbstverständliche Vielsprachigkeit.4 Gerade die Erfahrung multiplen Sprachkontakts wurde, wie Zamenhof immer wieder betonte, zu einem wichtigen Motiv für seine erste linguistische Reflexion, dann für sein anhaltend reges Interesse am Sprachkontakt und seine aktive Beschäftigung mit praktischer Sprachwissenschaft – all dies konvergierte zu seinem Lebenswerk, der Plansprache Esperanto. Dokumentierte Anfänge von Zamenhofs linguistischem Interesse, das über seine kindliche Faszination von der Legende vom Turm zu Babel hinausgeht, reichen in die zweite Hälfte der siebziger Jahre des 19. Jahrhunderts zurück. Ungefähr in den Jahren 1876 – 1880 erarbeitete er einen » Versuch einer Grammatik der neujüdischen Sprache ( Jargon ) «,5 worunter die moderne jiddische Sprache, wie er sie in Białystok und später in Warschau kennengelernt hatte, zu verstehen ist ( Das Werk 2 Für das Polnische als Assimilations- und Akkulturationssprache der polnischen Juden im 20. Jh. vgl. z. B. Steffen 2004 und Geller 2010. 3 Ausführlich zu Leben und Werk von Ludwik Zamenhof z. B. Künzli 2010. 4 Zamenhof sprach fließend Russisch, Polnisch, Deutsch und gewiss auch Jiddisch. Russisch war seine erste Sprache ; nach seinem Umzug nach Warschau ging er zum Polnischen über. Darüber hinaus verfügte er über Schulkenntnisse in Latein, Griechisch, Hebräisch, sowie Französisch und Englisch, s. Künzli ( 2010 : 97 – 100 ). Zum Thema der traditionellen Mehrsprachigkeit unter Juden s. z. B. Harshav ( 1990 : 9 – 27 ) sowie Bartal ( 1993 ). 5 Original auf Russisch unter dem Titel Opyt gramatiki novoevrejskago jazyka ( žargona ), wörtl. » Versuch einer Grammatik der neujüdischen Sprache ( Jargon ) «, verfasst ; Datierung nach Künzli ( 2010 : 102 ) und Gold ( 1980 : 304 ). Zamenhof selbst sagt über seine Studie zur jiddischen Grammatik in einem Brief vom März 1910 an die Redaktion von ‫לעבּען אוּן‬ ָ 30 ‫„ העכער‬, vor über 30 Jahren geschrieben wurde ( Zamen‫וויסע נשאפט‬, dass diese ” ‫יאר צוריק‬ hof 1910 b : 99 ). Ewa Geller : Die Jiddische Grammatik des Ludwik Zamenhof 395 wird im Folgenden zitiert als Studie zur jiddischen Grammatik oder kurz : Studie ). Seine in dieser Schrift vertretene, für jene Zeit revolutionäre Idee einer › Grammatisierung ‹ des jüdischen › Jargons ‹ verwarf Zamenhof jedoch bald. Die Gründe für die Aufgabe seiner Arbeit an der Reform des Jiddischen erklärt er zwei Jahrzehnte später vor dem breiteren Hintergrund der › Judenfrage ‹ in seinem sozial-philosophischen Traktat Hillelismus. Projekt zur Lösung der Judenfrage von 1901 : 6 Der Leser sollte nicht glauben, wir gehörten zu den Feinden des Jargons. Im Gegenteil : In einer Zeit, wo unsere Intelligenz fast ohne Ausnahme ( nicht einmal ausgenommen die Schriftsteller des Jargons ) den Jargon voller Verachtung behandelt und ihn für eine Art Ungeheuer hält, behandeln wir ihn mit Liebe und werden es weiter tun, denn wir sehen in dem sogenannten Jargon eine Sprache wie alle anderen. Vor etwa 20 – 25 Jahren erforschten wir eifrig und fasziniert diese Sprache und gelangten damals zu der Überzeugung, dass sie sich nicht nur durch einen Reichtum an Formen auszeichnet, sondern dass sie auch eine komplexe und konsequente Grammatik besitzt, die in vieler Hinsicht originell und außergewöhnlich ist. Wir bereiteten systematische Darstellungen dieser Grammatik vor und waren bereit, sie zu veröffentlichen, wobei wir davon träumten, auf diese Weise eine Grundlage für eine reine und zivilisierte neujüdische [ =jiddische ] Literatur zu liefern anstatt der jetzigen ungebildeten und wirren. Aber später kamen wir zu der Überzeugung, dass dieser Plan kein Ziel und keine Zukunft habe, dass der Jargon als ein vollständig orts- und zeitgebundenes Idiom keine Verbindung zum Judentum besitzt und dass wir mit seiner Kultivierung dem Judentum keinen guten Dienst erweisen würden.7 Auf ähnliche Weise gab er übrigens auch andere visionäre Ideen auf,8 treu blieb er allein der utopischsten von ihnen : der Schaffung einer internationalen Weltsprache. Und gerade deren Verwirklichung brachte ihm weltweiten Ruhm, der ihn überlebte. Daher verwundert es nicht, dass Zamenhofs späterer Titel als › Schöpfer des Esperanto ‹ seine anderen sprachwissenschaftlichen Leistungen in Vergessenheit geraten ließ, 6 Es handelt sich um eine von Zamenhof unter dem Pseudonym › Homo Sum ‹ auf Russisch verfasste Broschüre, die er 1901 in Warschau unter dem Titel : Hillelismus. Projekt für die Lösung der Judenfrage als sein ideologisches Manifest veröffentlicht hat ; mehr dazu und deutsche Übersetzung s. Künzli 2010 : 422 – 480. 7 Fragment nach Künzli ( 2010 : 102 ). Übersetzung von mir, nach der Textedition von Jagodzińska 2012. 8 Es geht u.a. um die Idee einer Wiederbelebung des Hebräischen und die Errichtung eines autonomen jüdischen Territoriums, worauf er an anderer Stelle in seinem Traktat Hillelismus eingeht. 396 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ darunter auch seine Pionierarbeit auf dem Gebiet der Kodiĳizierung und Normierung der Sprache der osteuropäischen Juden. Zum Glück sind seine jugendlichen Bemühungen, das » chaotische «, ja » unkultivierte « 9 Jiddisch zu » zivilisieren «, als Handschrift in seinem schriftstellerischen Nachlass erhalten geblieben.10 Die Studie Ludwik ( Leyzer ) Zamenhofs ist nicht allein für die Erforschung der Entstehung des modernen Standardjiddisch von hohem Wert, sie ist nicht minder wichtig für die Geschichte des jüdischen Denkens über den Umbruch im 19. und 20. Jahrhundert. Als Gradmesser moderner Identität stand die Sprache im Zentrum des innerjüdischen Diskurses um die Jahrhundertwende. Nach Ansicht von Dovid Katz, dürfte die Czernowitzer Konferenz im Jahre 1908 den damals schon weltberühmten Schöpfer der internationalen Sprache Esperanto dazu veranlasst haben, seine bereits verworfene Studie zur jiddischen Grammatik zu veröffentlichen.11 Zamenhof betraute mit dieser Aufgabe A. Litvinov 12, den Herausgeber der neuen Monatsschrift ‫לעבּען אוּן וויסענשאפט‬, die seit 1909 in Wilna erschien. Das russischsprachige Manuskript der jiddischen Grammatik, das zu diesem Zeitpunkt bereits 30 Jahre lang in Zamenhofs Schublade gelegen hatte, sollte nun zum ersten Mal denen zugänglich gemacht werden, an die es gerichtet war – den Sprechern des Jiddischen. Der Artikel, für den Zamenhof das Pseudonym » Dr. X « wählte, trug die Überschrift ‫יוִּישער ְש ְפּ אך‬ ֶ ‫ֶעפאְם !ער‬ ָ ‫אטיק אוּן‬ ִ ‫אמ‬ ַ ‫יוִּישער ְג‬ ֶ ‫עגען א‬ ֶ ֶ‫וו‬.13 Er erschien in der ersten Nummer der Zeitschrift, ohne Hinweis darauf, dass es sich um eine Übersetzung aus dem Russischen ins Jiddische handelte, genauer : um ein Fragment eines ursprünglich russischen Werks ( und damit auch ohne Nennung des Übersetzers ). Der Veröffentlichung des ersten Fragments der Studie war ein Vorwort des Autors vorangestellt, welches im russischen Original fehlt. Der Einleitungssatz 9 Im Russischen verwendet er das Attribut безграмотный / bezgramotnyj / , welches in sich die Bedeutungen‚ › des Lesens und Schreibens unkundig ‹, › ungebildet ‹ und › unkultiviert ‹ vereinigt. 10 Das Original beĳindet sich im Archiv der Nationalbibliothek in Jerusalem in der Švadron-Handschriften Sammlung ( vgl. Jagodzinska 2012 ). Zum ersten Mal wurde das vollständige Manuskript von Adolf Holzhaus ins Esperanto übersetzt und im Jahre 1982 publiziert. Demnächst erscheint eine annotierte polnische Übersetzung des Manuskripts in einer Quellensammlung Zamenhofs ( Zamenhof [ 1880 ] 2012 ). 11 Vgl. Katz 1994 a, 1994 b. 12 Pseudonym von Shmuel Hurwitz ( 1862 – 1943 ). Mit ‫ לעבּען אוּן וויסענשאפט‬wollte der Herausgeber eine jiddischsprachige Zeitschrift schaffen, die sich an den führenden wissenschaftlichen und kulturpolitischen Organen der europäischen Presse orientierte, s. Katz 1994 a. 13 Originalschreibung. Vgl. ‫ לעבּען אוּן וויסענשאפט‬Nr. 1 Mai 1909, S. 50 – 56 ; deutsche Übersetzung dieses Artikels unter dem nicht ganz gelungenen Titel : Jiddische Grammatik und Reform der Judensprache [ sic ! ] in Künzli 2010 : 496 – 500. Ewa Geller : Die Jiddische Grammatik des Ludwik Zamenhof 397 wurde später oft als Beweis der engen Verbindung des Esperantobegründers mit dem Jiddischen angeführt,14 wobei jedoch die darin vorgebrachten Einschränkungen gewöhnlich ausgelassen wurden : 15 Heiß lieb’ ich den sogenannten › Jargon ‹, aber [ meine Hervorhebung – E. G. ] aus verschiedenen Gründen, über die zu reden hier nicht der Ort ist, habe ich Zweifel, ob der Jargon irgendeine Zukunft hat und ob es sich überhaupt lohnt, ihm irgendeine Zukunft zu wünschen. Es verwundert nicht, dass die Redaktion der neuen – wohlgemerkt : in jiddischer Sprache erscheinenden – Zeitschrift, die sich an die neu aufgekommene jüdische Intelligenz richtete, ein Recht, ja geradezu die Pflicht verspürte, sich von den Ansichten des Autors zu distanzieren, auch wenn diese aus der Feder eines weltberühmten Experten auf dem Gebiet der Linguistik stammten. Im daran anschließenden Paragraphen der Einleitung äußert der Autor ungeschminkt seine pragmatischen Überlegungen zur Alltagssprache der osteuropäischen Juden und zu den wichtigsten Aufgaben der Verfechter des Jiddischen. Für Jiddisch gebe es zwar keine Zukunft, es sei aber immerhin das Idiom von 6 Millionen Juden, die einer anderen Sprache nicht kundig seien, da solle es wenigstens eine Sprache auf einem anständigen Niveau sein.16 Dem Jiddischen zu diesem Rang zu verhelfen, sei die Verantwortung jedes Einzelnen, der zur Feder greife, um in dieser Sprache zu publizieren. Wie im Weiteren deutlich wird, erwies sich diese durchaus › nüchterne ‹ Sicht auf das Jiddische nicht als Hauptgrund für die Bestürzung des Herausgebers. Zu seinem Vorbehalt zwang ihn sicherlich die radikale Reformidee Zamenhofs, das Jiddische zu latinisieren. Diese Forderung artikulierte Zamenhof bereits auf den ersten Seiten des in der ersten Nummer von ‫ לעבּען אוּן וויסענשאפט‬publizierten Fragments seiner Grammatik. Allerdings, bevor der Autor seine Beobachtungen und die sich daraus ergebenden Forderungen darlegt, hält er es für notwendig, die Leser davon zu überzeugen, dass der › Jargon ‹, entgegen verbreiteter Meinungen, genauso wie alle anderen Sprachen der Welt, eigene grammatische Regeln besitzt. Wäre dies nicht der Fall, belehrte Zamenhof 14 Vgl. z. B. Reyzen ( 1927 : 431 ) ( s. u. ), der dort dasselbe Fragment zitiert ( jedoch ohne Quellenangabe ). 15 Zamenhof 1909 : 50. Wenn nicht anders vermerkt, stammen alle Übersetzungen aus dem Jiddischen von mir. 16 Im Original gebraucht Zamenhof das Attribut ‫לײטיש‬ ַ / laytish / und das von ihm abgeleitete Substantiv ‫לײטישקײט‬ ַ , was eine Lehnübersetzung des poln. Adjektivs ludzki, adverbial po ludzku – dt. menschlich im Sinne › anständig ‹, in Bezug auf Sprache aber auch › verständlich ‹, vgl. poln. mów po ludzku – dt. › sprich verständlich ‹ ; hier sicherlich in beiden Bedeutungen verwendet. 398 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ seine Leser, dann könnten die Menschen einander nicht verstehen ; nun bedienten sie sich aber doch – und das notwendigerweise – der eigenen Sprache.17 Die grammatischen Regeln müsse man nur erkennen, darstellen und dann alle Schriftsteller verpflichten, sich nach ihnen zu richten ; auf diese Weise würde für die Massen der Jiddischsprecher ein Vorbild, ja ein Maßstab geschaffen, dem sie folgen würden. Aber um dieses Ziel zu erreichen, seien Grammatiken und Wörterbücher nötig, über die die jiddische Sprache leider nicht verfüge und dies – wohlgemerkt – im Gegensatz zu vielen exotischen und › wilden ‹ Sprachen ( z. B. den afrikanischen ). Darüber hinaus versicherte er in aufklärerischem Geiste den Lesern, dass nicht nur viele assimilierte Juden, die kein Jiddisch könnten, sondern auch viele Nichtjuden es gern erlernen würden. Aus Mangel an entsprechendem Lehrmaterial seien die am Jiddischen Interessierten gezwungen, solche löblichen Pläne aufzugeben. Zamenhofs Ausführungen sollten beweisen, dass das Verfassen und Publizieren einer Grammatik eine überaus dringende, ja unerläßliche Aufgabe sei, damit Menschen, die sich dieser Sprache bedienen, forthin zu den Kulturnationen gezählt werden könnten. Eine solche Anerkennung stehe den Juden angesichts ihrer bisherigen Errungenschaften voll und ganz zu. Es sei gerade der » ungehobelte Jargon «, der den Ruf der osteuropäischen Juden verderbe, meint Zamenhof. Erst gegen Ende seiner Ausführungen zum Status der Sprache und ihrer Sprecher konstatiert Zamenhof : 18 Wenn man jedoch aus dem Jargon eine Sprache von kulturellem Rang schaffen soll, und dies nicht nur für die jüdischen Massen, sondern auch für alle, die diese Sprache nicht verstehen, aber diese Fähigkeit erwerben, also sie auch erlernen möchten, muss man für den Jargon zu allererst die lateinische Schrift einführen. Zur Untermauerung seiner Forderung argumentiert Zamenhof weiter, dass Jiddisch als » arische «, Sprache – womit er eine indoeuropäische Sprache meinte – im lateinischen Alphabet geschrieben werden müsse.19 Selbst wenn Jiddisch eine semitische Sprache wäre, müsste man 17 Erwähnenswert ist an dieser Stelle, dass vom rein linguistischen Standpunkt aus für die Bezeichnung › Sprache ‹ statt › Jargon ‹ sich ebenfalls der international anerkannte, polnische Sprachwissenschaftler und Zeitgenosse von Zamenhof, Jan Baudouin de Courtenay ( 1845 – 1929 ) in einigen seiner Schriften und Vorträge über die sog. › Judenfrage ‹ einsetzte ; dabei bediente er sich – was nicht verwundert – der gleichen Argumente ; vgl. de Courtenay 1913, 1923. 18 Zamenhof 1909 : 51. 19 Dieses Problem behandle ich eingehend im Kommentar zur Studie zur jiddischen Grammatik ( § 1 ), welche demnächst in der polnischen kritischen Edition als Zarys gramatyki języka jidysz in : Jagodzińska ( 2012 ) erscheinen wird, vgl. Fn. 11. Ewa Geller : Die Jiddische Grammatik des Ludwik Zamenhof 399 die hebräischen Buchstaben aus praktischen Gründen durch die lateinische Schrift ersetzen. Das täten die meisten zivilisierten Gesellschaften, sogar » die stolzen Deutschen «, die schon längst angefangen hätten, ihre gotische Schrift ( Fraktur ) gegen die lateinische ( Antiqua ) einzutauschen, weil diese einfacher sei.20 Diese Forderung nach einer Latinisierung des Jiddischen, gleich im Vorwort so autoritär erhoben, entschied wahrscheinlich über das weitere Schicksal von Zamenhofs grammatischer Pionierarbeit. Trotz ihres unbestritten hohen wissenschaftlichen und praktischen Wertes wurde sie verworfen und ĳiel letztendlich der Vergessenheit anheim. Die Gründe für das gänzliche Verschwinden der Studie Zamenhofs aus der späteren Diskussion über die Standardisierung des Jiddischen erscheinen im Redaktionskommentar, der den Abdruck des Fragments in ‫לעבּען אוּן‬ ‫ וויסענשאפט‬begleitete : 21 Der Verfasser dieses Artikels, ein berühmter Sprachwissenschaftler, ist nicht nur einem bedeutenden Teil der jüdischen Leserschaft bekannt, denn noch bekannter als in der jüdischen Welt ist er bei der gesamten kulturellen Menschheit. Das ist er dank seines wichtigen Beitrags auf dem Gebiet der Sprachreformen. Somit wird der Leser bei einer Angelegenheit wie Reform und Grammatik des Jiddischen sicherlich daran interessiert sein, die Meinung einer weltbekannten Autorität der Sprachwissenschaft kennenzulernen. Das Problem, das wir hier berühren, behandeln wir mit vollem Ernst. Wir meinen jedoch, dass die in diesem Artikel vorgeschlagene Reform allzu schwerwiegend ist. Wie groß die Kompetenz des Autors auch sein mag, so ist hier auch mit der Psychologie des Volkes zu rechnen. Wir glauben nämlich, dass dies im gleichen Maße eine Angelegenheit der Nation ist wie ein wissenschaftliches und kulturelles Problem. Die Redaktion hält sich deshalb vorläuĳig mit Äußerungen ihrer eigenen Meinung zu dieser Reform zurück. Die Frage einer Ersetzung des jüdischen Alphabets durch das lateinische stellen wir zur Diskussion, den betreffenden Artikel veröffentlichen wir jedoch auf die Verantwortung des geschätzten Autors, der leider seinen wirklichen Namen nicht bekannt geben wollte. [ unterschrieben ] Redaktion Nach Kenntnisnahme der gesamten Studie können wir mit Gewissheit feststellen, dass die Einführung der lateinischen Schrift für das Jiddische nicht die einzige, ja nicht einmal die wichtigste Reform war, die der Linguist Ludwik Zamenhof forderte. Aber eben dieser Vorschlag traf den empĳindlichsten Punkt der jüdischen Identität und rief daher 20 Zamenhof 1909 : 51. 21 Ibid. : 50 Fn. 400 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ den stärksten Widerspruch hervor.22 In den folgenden Nummern der Zeitschrift protestierten die zur Teilnahme an der Diskussion ermunterten Leser gegen eine derart radikale Reform und übten scharfe Kritik an » Dr. x« und der » Wohltat «, die er der jiddischen Sprache erweisen wollte.23 Trotz dieser heftigen Ablehnung erschien ein weiteres Fragment seiner Studie, nun unter dem Titel : ‫מאטיק‬ ַ ‫גרא‬ ַ ‫פּראבן 'ון ַא ייִ דישער‬ ָ , in Ausgabe Nr. 7 ( Jan. 1910 ). Das letzte Fragment ‫מא־‬ ַ ‫גרא‬ ַ ‫פּראבן 'ון ַא ייִ דישער‬ ָ ‫די‬ ‫טיק‬, veröffentlicht in einer späteren Nummer ( Nr. 9, März 1910 ), ist ein langer, ursprünglich auf Russisch verfasster Brief Zamenhofs, den die Redaktion übersetzte ( worüber sie ihre Leser bei diesem Mal zu informieren für nötig hielt ). Darin schreibt Zamenhof : Mit großem Bedauern bemerke ich, dass die Auszüge aus meinem Manuskript » Proben einer jiddischen Grammatik «, die Sie abdrucken, den Lesern eine falsche Vorstellung vermitteln, von Charakter und Ziel meiner Arbeit [ d. h. ] einer Studie, die ich vor über 30 Jahren geschrieben und die ich [ … ] seither nie wieder durchgesehen habe. [ … ] Danach endet er mit einer Bitte : 24 Deshalb bitte ich Sie, Herr Redakteur, den Abdruck der Fragmente meines Manuskripts einzustellen, bis ich die Möglichkeit haben werde, sie vollständig mit den unerlässlichen Erklärungen und einer Einführung herauszugeben. Hochachtungsvoll Dr. x Die Redaktion kam der Bitte des Autors nach und stellte den weiteren Abdruck des Manuskripts ein. Und obwohl es an – teils sehr polemischen – redaktionellen Anmerkungen zu Zamenhofs normativen Vorschlägen nicht fehlte, beendete die Redaktion die Zusammenarbeit mit 22 Ausführlich zu diesem Thema s. Aleksandra Geller 2012. 23 Katz ( 1994 a, 1994 b ) stellt detailliert den Verlauf der in den weiteren Nummern von ‫ לעבּען אוּן וויסענשאפט‬geführten Diskussion dar. Dort fand sich u. a. eine polemische Aussage des damals jungen Noyekh Prilutski ( Prilutski 1909 a ), der wenige Jahre später einer der Begründer der modernen jiddischen Sprachforschung wurde. In Antwort auf Zamenhofs Forderungen nach der Latinisierung der Schrift argumentierte er u.a. : » Das ( jüdische ) Alphabet ist der Kitt, der auf organische Weise unsere beiden nationalen Sprachen, unsere beiden Hälften der Jahrtausende langen Geschichte verbindet. « ( Prilutski 1909 a : 147 ). Jedoch schon in der nächsten Nummer ( Nr. 5, September 1909 ) wird Prilutskis eigenes Grammatikprojekt, unter der Überschrift Materialien zur jiddischen Grammatik und Orthograĳie veröffentlicht ( Prilutski 1909 b ). 24 Zamenhof 1910 b : 103. Ewa Geller : Die Jiddische Grammatik des Ludwik Zamenhof 401 Dr. x mit einem Lobspruch auf dessen » fundamentale « Verdienste in der Diskussion um eine Reform des Jiddischen : 25 Wir halten es für notwendig, dem verehrten Dr. x zu versichern, dass wir ungeachtet der Tatsache, dass wir mit ihm in manchen Punkten seiner » Proben « nicht ganz einig sind, [ … ] seine Arbeit insgesamt für höchst wichtig für die Reformierung unserer Sprache halten. – und weiter – 26 Wir sind überzeugt, wenn die » Proben « von Dr. x in ihrer Gesamtheit erschienen sind, werden sie früher oder später das Fundament für die Schaffung einer Grammatik des Jiddischen bilden. Heute ist bekannt, dass Zamenhof nie wieder zu diesem Plan zurückgekehrt ist. Nach seinem Tod im Jahre 1917 lag das Manuskript der Studie 65 Jahre in den Archivregalen, bevor es 1982 durch den Esperantisten Adolf Holzhaus veröffentlicht wurde. Holzhaus übersetzte das russische Manuskript in die Weltsprache Esperanto, um es auf diese Weise der Vergessenheit zu entreißen und einem internationalen Publikum zugänglich zu machen.27 Auf der Seite der Forscher des Jiddischen erinnerte Zalmen Reyzen anlässlich Zamenhofs 10. Todestages in einem Artikel ‫ענהאף‬ ָ ‫זאמ‬ ַ ‫לודוויק‬ ‫ ַאלס ייִ דישיסט‬in der Warschauer Wochenzeitung ‫ליטערארישע בלעטער‬ ַ an 28 dessen jiddistische Arbeit. In seinem Artikel zitierte Reyzen, selbst Autor einer der ersten auf jiddisch verfassten Grammatiken dieser Sprache, anhand der 1909 – 1910 in ‫ לעבּען אוּן וויסענשאפט‬publizierten Fragmente aus der Studie zur jiddischen Grammatik und würdigte Zamenhofs Verdienste mit lobenden Worten : 29 Dr. Zamenhof bewahrte sich bis zum letzten Tag seines Lebens, in der Zeit seines größten Weltruhms, ein warmes Interesse für Jiddisch. Mit seinen Patienten sprach er Jiddisch, er dachte sogar daran, die in seinen Jugendjahren geschriebene Grammatik in überarbeiteter Form herauszugeben. Sein vorzeitiger Tod – er starb mit 58 Jahren – vereitelte diesen Plan. Somit wäre es ein Akt der Dankbarkeit gegenüber diesem Freund unserer Sprache, das Manuskript seiner jiddischen Grammatik von seinen Erben zu erhalten, um aus ihr zumindest die25 Ibid. 26 Ibid. : 104. 27 Die Ausgabe umfasst außer der vom handschriftlichen Manuskript abgetippten russischen Version eine Übersetzung ins Esperanto, s. Holzhaus 1982. 28 Reyzen 1927. 29 Ibid. : 433. 402 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ jenigen Teile zu publizieren, die bis heute ihre Gültigkeit nicht verloren haben. Einige Absätze zuvor distanzierte sich Reyzen allerdings von Zamenhofs Leistungen, indem er ihnen lediglich einen historischen Erkenntniswert zugesteht. Zamenhofs Ansichten hält er jedoch für interessant und wert, sie einem breiteren Publikum zugänglich zu machen, allein aus dem Grunde, dass sie aus der Feder eines weltberühmten Linguisten stammten : 30 In rein wissenschaftlicher Hinsicht haben die Ausführungen Zamenhofs zum Jiddischen stark an Aktualität verloren. Trotzdem lohnt es sich, eine breitere jüdische Leserschaft mit den Einsichten dieser sprachwissenschaftlichen Autorität [ … ] bekannt zu machen. Reyzens Meinung lässt sich allerdings schwerlich zustimmen, weil sogar aus heutiger Sicht die von Zamenhof formulierten normativen Forderungen ihrer Zeit entschieden voraus waren. Besonders interessant und neuartig waren Zamenhofs Erkenntnisse auf der morphologischen Ebene, die im Grunde die erst später von de Saussure eingeführte Unterscheidung in langue und parole vorwegnahmen. Beispielsweise unterscheidet Zamenhof in seiner deskriptiven Grammatik des Jiddischen starktonige und schwachtonige ( klitische ) Funktionswörter ( § 5 ), stellt die Silbenhaftigkeit der Sonoranten fest ( § 6 ), rekonstruiert ein vollständiges Flexionsparadigma des Imperativs ( § 28 ) und beschreibt viele andere Besonderheiten des jiddischen Sprachgebrauchs, die in späteren Untersuchungen über Dialekte bestätigt wurden.31 Dies sind Erkenntnisse, deren Sinnfälligkeit bis heute leider keinen Platz in den traditionellen grammatischen Ausarbeitungen des Jiddischen gefunden hat. Vor diesem Hintergrund erscheint Zamenhofs Grammatik denn doch auch weiterhin als bahnbrechend. Daher kann man nur bedauern, dass sie auf das Unverständnis der Epoche traf, denn die hervorragende deskriptive Leistung Zamenhofs hätte vermutlich den Prozess der damals dringend nötigen Standardisierung des › jüdischen Jargons ‹ um einige Jahrzehnte vorverlegt. Die Ursache für das radikale Ignorieren der Arbeit des schon damals bekannten Linguisten Zamenhof lag jedoch – wie es scheint – nicht allein in seiner revolutionären Forderung nach einer Latinisierung des Jiddischen. Dieser Vorschlag war in den folgenden Jahrzehnten wiederholt im La30 Ibid. : 433. 31 Zu den gleichen Ergebnissen bin ich bei einer ( induktiven ) Untersuchung des Warschauer Jiddischen ( Geller 2001 ) unabhängig von Zamenhof gelangt. Ewa Geller : Die Jiddische Grammatik des Ludwik Zamenhof 403 ger der Jiddischisten selbst Gegenstand der Diskussion. Vielmehr sind die Gründe für die unzureichende Rezeption der Studie in Zamenhofs Ansichten zur › Judenfrage ‹ und in seinen Auffassungen von der jiddischen Sprache zu suchen.32 In diesem Zusammenhang drängt sich eine weitere Frage auf : Was bewegte den Medizinstudenten der Moskauer Universität dazu, die Mühe auf sich zu nehmen, dem › Jargon ‹ auf die Beine zu verhelfen ? 1907, etwa zwei Jahre vor dem Erscheinen des ersten Fragments seiner Studie, erzählte Zamenhof selbst in einem Interview, das er der Londoner Zeitung Jewish Chronicle auf dem 3. Weltkongress der Esperantisten in Cambridge gab, von seinem intellektuellen Werdegang und ging dabei auch auf seine damaligen Motive ein. Auf die Frage » Haben Sie nie daran gedacht, Hebräisch oder Jiddisch zu einer internationalen Sprache zu machen ? « antwortete Zamenhof : 33 Nein, das wurde zwar behauptet, aber ich wurde falsch verstanden. Seinerzeit hatte ich zwar die Hoffnung, Hebräisch als die Sprache meiner Glaubensgenossen wiederzubeleben. Aber schnell kam ich zu der Überzeugung, dass dies unmöglich ist. Danach habe ich drei Jahre am Jiddischen gearbeitet in der Hoffnung, es auf das Niveau der europäischen Kultursprache anzuheben, und ich verfasste damals eine Grammatik des sogenannten › Jargons ‹ – die meines Wissens erste jemals geschriebene Grammatik des Jiddischen. Aber nach ihrer Fertigstellung kam ich zu dem Schluss, dass es für Jiddisch wirklich keine Zukunft mehr gibt, daher existiert meine Grammatik weiterhin nur als Handschrift. Im Weiteren tangiert Zamenhof einige für unsere Überlegungen ebenfalls wichtige Fragen. Das Feld seiner breit gefassten linguistischen Interessen schloss nämlich das seinerzeit utopische Projekt einer Wiederbelebung des Hebräischen als gesprochener Sprache ein. Aber auch diese visionären Pläne hat Zamenhof wieder verworfen. Andere sollten sie verwirklicht haben.34 32 Ausführlich dazu Geller 2012 und Jagodzińska 2012. 33 Zamenhof 1907 : 16. Aus dem Englischen übersetzt von Ewa Geller ; eine deutsche Fassung des sehr informativen Interviews ĳindet sich in Künzli 2010 : 487 – 495. 34 Heute ist bekannt, dass die Bedeutung des Modernen Hebräisch, das in Israel Staatssprache wurde, in der Welt von heute größer ist, als es die des Jiddisch oder Esperanto jemals war. Interessanterweise war der Vater dieses Erfolges, Eliezer Ben Jehuda, ein Altersgenosse, › litauischer ‹ Landsmann und gewissermaßen auch Kommilitone Ludwik Zamenhofs. Ben Jehuda ( eigentlich : Eliezer Izchak Perlman ( 1858 – 1922 ), wurde im weißrussischen Städtchen Lužki ( Vitebsker Gebiet ) geboren. Im Gegensatz zu Ludwik Zamenhof, der aus einer Familie stammte, die die Ideale der Haskala pflegte, wuchs Ben Jehuda in einem chassidischen Umfeld auf, wo er eine traditionelle religiöse Bildung erhielt. Als Stu- 404 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Ein ähnliches Schicksal erlebte auch seine jiddische Grammatik. Im Gesamtzusammenhang der Geschichte des Jiddischen war sie freilich nicht die erste linguistische Darstellung, weil Versuche, die Sprache der aschkenasischen Juden zu beschreiben, bekanntlich schon seit dem 16. Jahrhundert unternommen wurden. Wenn wir jedoch die Sprache der osteuropäischen Juden als eine vom Westjiddischen unabhängig entstandene Mischsprache betrachten,35 dann war Zamenhofs beschreibendes grammatisches Werk von 1880 zweifellos eine bahnbrechende Leistung. Erwähnenswert ist, dass Zamenhofs Studie ebenso aus didaktischen Motiven wie aus seiner puren linguistischen Leidenschaft entstand und lange vor der späteren, eher ideologisch als wissenschaftlich begründeten, Unterscheidung in West- und Ostjiddisch verfasst wurde.36 Sie fußte auf induktiver Analyse des aktuellen Sprachgebrauchs Man bekommt in der Tat den Eindruck, dass er beim Schreiben seiner Grammatik eigenständig, d.h. ohne Nutzung von früheren Arbeiten über das von den osteuropäischen Juden gesprochene Jiddisch arbeitete.37 So stammen die von ihm formulierten grammatischen Regeln alle aus seiner Feder, aber was noch wichtiger ist : er stützte sich auf direkte Beobachtungen zum alltäglichen Sprachgebrauch, benutzte also eine Methode, die erst durch den amerikanischen Deskriptivismus in der Linguistik eine breitere Anwendung fand. Zamenhof beschreibt seine Vorgehensweise folgendermaßen : 38 dent an der Jeschiwa von Połock ( russ. Polock ) lernte er die Ideale der jüdischen Aufklärung kennen, sagte sich vom traditionellen Judentum los und wurde nach kurzer Zeit ein leidenschaftlicher Anhänger des Zionismus. Er besuchte ein russisches Gymnasium und studierte in Paris Medizin – wie Zamenhof seinerzeit in Moskau. Aus gesundheitlichen Gründen musste Perlman das Medizinstudium abbrechen. 1881 übersiedelte er dauerhaft nach Palästina, wo er mit der Arbeit an seinem Projekt begann, das Hebräische als gesprochene Sprache wiederzubeleben ; mehr dazu z. B. bei Fellmann 1973. 35 Zur strittigen Frage der Herkunft des Jiddischen, vgl. z. B. Geller 2008, dort weitere Literaturhinweise. Übrigens bestätigen die von Zamenhof an vielen Stellen angeführten Beispiele und Beobachtungen die kontaktlinguistische Hypothese, dass das sog. Ostjiddische eine vom Westjiddischen unabhängige Sprachvariante ist. 36 Die Souveränität seiner Beschreibung ist sicherlich eines der wichtigsten Momente seiner Leistung und zeigt im Kontrast, wie stark der moderne Werdegang des Jiddischen als Sprache und der Jiddistik als Wissenschaft ideologisiert wurde. 37 Eine sehr gründliche Geschichte der Forschung über das Jiddische stellt Max Weinreich in seiner Doktorarbeit ( Weinreich [ 1923 ] 1993 ) dar. Aus seinen bibliograĳischen Angaben geht hervor, dass vom Ende des 18. Jahrhunderts bis zur Mitte des 19. Jahrhunderts vereinzelte Arbeiten erschienen, die das Thema Dialektunterschiede behandelten. Es ging dabei um charakteristische Unterschiede, wie das Jiddische » von Juden in Polen gebraucht wurde und wie in Litauen «, s. besonders Kapitel iii in Weinreich [ 1923 ] 1993 : 104 – 225. Es ist also nicht ausgeschlossen, dass Zamenhof während seines Studiums in Moskau und während der Arbeit an seiner jiddischen Grammatik zu diesen Publikationen Zugang hatte. Die Frage, ob und welche dieser Arbeiten von vor 1879 Zamenhof benutzen konnte, erfordert noch weitergehende Untersuchungen. Mehr zur Jiddischforschung s. Katz 1986, Frakes 2007. 38 Zamenhof 1910b : 99. Ewa Geller : Die Jiddische Grammatik des Ludwik Zamenhof 405 Als ich vor 30 Jahren mit heißer Leidenschaft über die jiddische Sprache arbeitete, war ich nicht bemüht, dabei etwas Neues zu schaffen oder Änderungen vorzuschlagen, sondern auf dem Wege der Induktion wollte ich die darin existierenden grammatischen Regeln suchen und bestimmen. Je länger ich arbeitete, desto überzeugter wurde ich, dass Jiddisch feste und oft sehr interessante grammatische Grundregeln besitzt. Das Extrahieren von grammatischen Regeln aus Sprachdaten nach der induktiven Methode ist eine anspruchsvolle Aufgabe, der ein durchschnittlicher Sprachliebhaber nicht gewachsen ist. Dabei war Jiddisch zu dieser Zeit erst am Anfang des langen Weges, sich zu einer modernen Literatursprache nach dem Vorbild von Mendele Moykher-Sforim, Sholem Aleichem und I. L. Peretz herauszubilden. Daher und wegen seines Mischcharakters war Jiddisch für die Einflüsse seiner Komponentensprachen fast unbegrenzt offen. Gerade diese ungewöhnliche Offenheit erweckte den Eindruck, Jiddisch beĳinde sich gewissermaßen ständig in statu nascendi.39 Die Behauptung eines Mangels an Stabilität im Jiddischen, naiv empfunden als Fehlen grammatischer Regeln, versuchte Zamenhof, wie wir gesehen haben, bei jeder Gelegenheit zu widerlegen. Seine Äußerungen in dem schon zitierten Brief an die Redaktion von ‫ לעבּען אוּן וויסענשאפט‬zeugen nicht nur von der Faszination am Phänomen der Sprache, den die von ihm entdeckten Gesetzmäßigkeiten auslösten, sondern auch und vor allem von seinen didaktischen Zielen. Er wollte nämlich, dass die Sprecher des Jiddischen die Verachtung der eigenen Muttersprache ablegten und ein Bewusstsein von ihren Strukturen und Funktionen bekämen : 40 Es ist nötig, die Grundregeln festzulegen und sie sich anzueignen, wenn wir wollen, dass unsere Sprache aufhört, ein sprachlicher Mischmasch, ein Jargon zu sein und zu einer wirklichen Sprache wird, so dass alle sie in gleichem Maße benutzen können ohne irgendwelche Zweifel. Denn anstatt im Dunkeln herumzuirren, würde jeder dann genau wissen, welche Form richtig ist und welche falsch. Eine weitere Schwierigkeit, auf induktivem Weg Grammatikregeln herzuleiten, stellten die Unterschiede zwischen den Dialekten des Jiddischen dar. Allein in Mittelosteuropa ließen sich drei große Dialektregi39 Vom Standpunkt der heutigen Sprachkontaktlinguistik aus ist das in Gesellschaften mit lang andauernder Mehrsprachigkeit eine ganz natürliche Erscheinung, die mit Sicherheit auch auf die osteuropäischen Juden in ihrer Masse zutrifft. Dennoch war gerade diese Offenheit gegenüber den umgebenden Regionalsprachen einer der Gründe, Jiddisch als Jargon, als › Sprache ohne Grammatik ‹ zu betrachten. 40 Zamenhof 1910b : 99. 406 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ onen unterscheiden. Wie Zamenhofs Biograĳie zeigt, lernte er im Laufe seines Lebens verschiedene jiddische Dialekte kennen. Dies blieb nicht ohne Einfluss auf die von ihm beschriebenen grammatischen Regeln. In Białystok, woher er stammte und wo er die ersten 14 Lebensjahre verbrachte, hörte er › litauisches Jiddisch ‹, also Nordostjiddisch, was vermutlich auch der Dialekt seiner Mutter war, von der er die Sprache lernte.41 In Warschau, wo er seine gesamte Gymnasialzeit verbrachte, begegnete er dem im größten Teil Polens gesprochenen › polnischen ‹ ( zentralostjiddischen ) Dialekt. Und obwohl das sog. › polnische Jiddisch ‹ zu jener Zeit ohne Zweifel der von den meisten osteuropäischen Juden gesprochene Dialekt war, schlug der Normativist Zamenhof als Erster vor, den › litauischen Dialekt ‹ als Grundlage für die sprachliche Norm des Jiddischen zu wählen. Die gleiche Forderung erhob 30 Jahre später der als Vater der jiddischen Sprachwissenschaft geltende Ber Borokhov 42 in seinem programmatischen Artikel ‫אוי'גאבן 'ון דער ייִ דישער‬ ַ ‫די‬ ‫לאגיע‬ ָ ‫'ילא‬ ָ .43 Am Ende wurde – trotz gegenläuĳiger Trends, repräsentiert vornehmlich durch Salomon Birnbaum ( 1918, 1979 )44 – der litauische Dialekt tatsächlich von den Begründern des Wilnaer YIVO als Grundlage für das neue Standard-Jiddisch angenommen. Die getroffene Entscheidung verwundert nicht, denn wie es scheint, sprechen dafür neben sprachstrukturellen Gründen vor allem soziolinguistische Faktoren, darunter hauptsächlich das › aufgeklärte ‹ Prestige der Benutzer des › litauischen Dialekts ‹, der zu einem großen Teil auch der Heimatdialekt der führenden Aktivisten des YIVO war. Im Falle Zamenhofs, der ja seine Zweifel an der Zukunft des Jiddischen nicht verbarg, war die Entscheidung, einen Muster- oder Normdialekt festzulegen, völlig unabhängig von ideologischen Faktoren und, wie man aus seinen eigenen Worten schließen darf, ausschließlich von Gründen im Sprachsystem diktiert.45 41 Zum Grad von Zamenhofs Kenntnis des Jiddischen s. Künzli 2010 : 101 sowie Gold 1980. 42 Borokhov [ 1913 ] 1966 a : 72 – 75. 43 Es ist anzunehmen, dass Borokhov als engagierter Jiddischist die in ‫לעבּען אוּן וויסענ־‬ ‫ שא פט‬publizierten und heiß diskutierten Auszüge aus der jiddischen Grammatik Zamenhofs zur Kenntnis nahm. Darüber hinaus verfasste er einen Zeitungartikel, in dem er u. a. die Stellungnahme Zamenhofs zur › jüdischen Frage ‹ auf dem Esperanto-Kongress in Krakau im Jahre 1912 widergab ; ausführlich darüber in Geller 2012. Trotzdem erwähnt er Zamenhofs Arbeit über das Jiddische in seinen beiden » Gründungsartikeln « für die Jiddistik aus dem Jahre 1913 nicht. 44 Salomon Birnbaum ( 1891 – 1989 ) war selbst Autor der ersten deutschsprachigen Grammatik des modernen Jiddisch ( Birnbaum 1918 ) ; er übte scharfe Kritik an der für ihn willkürlichen Entscheidung, die Aussprache des Standard-Jiddischen auf dem › litauischen Dialekt ‹ aufzubauen, obwohl die Zahl der Sprecher des sog. › polnischen Dialekts ‹ bei weitem größer war, vgl. Birnbaum 1979 : 100. 45 S. Zarys § 2. und mein Kommentar in der Fn. 16 in Zamenhof 2012. Ewa Geller : Die Jiddische Grammatik des Ludwik Zamenhof 407 Der › litauische Dialekt ‹ ist hinsichtlich der Phonetik durch eine ziemlich einfache Lautentwicklungsgeschichte im Verhältnis zum als Muster dienenden Mittelhochdeutschen charakterisierbar.46 Dieser Dialekt weist jedoch gegenüber dem Deutschen und den koterritorialen Sprachen eine morphologische Besonderheit auf : er besitzt nämlich – ähnlich wie das Hebräische, was freilich nicht ohne Bedeutung ist – kein Neutrum, das im Standard-Jiddischen im Singular gekennzeichnet ist durch den bestimmten Artikel ‫דאס‬ ָ . Diese Besonderheit des › litauischen Jiddisch ‹ wurde nicht ins Standard-Jiddische übernommen, das wie das Deutsche und das sog. › polnische Jiddisch ‹ im Singular drei Genera kennt. Als Beweis, dass Zamenhof seine grammatischen Regeln für das Jiddische unabhängig aufgestellt hat, sollte man hier anmerken, dass er anfangs plante, das › litauisch-jiddische ‹ System der zwei Genera ( ohne Neutrum ) als Norm für die Gesamtsprache zu übernehmen. Später jedoch – leider wissen wir nicht, wann und unter welchem oder wessen Einfluss – gab er diesen Gedanken auf. Das können wir anhand der von ihm gemachten Streichungen feststellen, die in der Handschrift von seiner Studie deutlich sichtbar sind.47 Im Hinblick auf die Neuartigkeit von Zamenhofs Grammatik mag man sich fragen, ob sich der junge Medizinstudent beim Formulieren der Regeln für das moderne Jiddisch ausschließlich auf die linguistische Intuition des späteren Begründers einer weltberühmten Plansprache stützte. Ebenso denkbar wäre es, dass er als leidenschaftlicher Liebhaber der Sprachwissenschaft die Möglichkeit hatte, laufend die neuesten Entdeckungen auf diesem Gebiet zu verfolgen, an denen es damals nicht mangelte. Man muss sich vergegenwärtigen, dass die moderne Sprachwissenschaft in den 1870er Jahren einen gewaltigen Aufschwung nahm und im folgenden Jahrhundert zu einer der sich am schnellsten entwickelnden Disziplinen avancierte. Ein paar Jahre vor Zamenhofs Niederschrift der Studie zur jiddischen Grammatik entstand in Deutschland die linguistische Schule der Junggrammatiker, zu deren wichtigsten Leistungen die Formulierung der › ausnahmslosen Lautgesetze ‹ zählt, die heute unter dem Namen › phonologische Regeln ‹ bekannt sind. Dass auch in seiner Grammatik ein besonderer Nachdruck auf phonetische Phänomene gelegt wurde, kam möglicherweise von der wissenschaftlichen Atmosphäre der Epoche sowie von der Redlichkeit, mit der Zamenhof seine Sprachforschungen betrieb. Sofern er sich bei den inhaltlichen Beobachtungen zur Struktur des Jiddischen auf die eigene Intuition – stark befruchtet vom lingu46 Vgl. Schemata der Entwicklung des jiddischen Protovokalismus, ausgearbeitet von Max Weinreich ( [ 1973 ] 2008 ( ii ) : 658 – 718. ). 47 S. Zarys § 7 und mein Kommentar dazu in der Fn. 121 in Zamenhof 2012. 408 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ istischen Geist der Epoche – verlassen konnte und keiner unmittelbaren Inspiration bedurfte, so scheint es wenig wahrscheinlich, dass die von ihm angenommene innere Struktur der Grammatik sein eigener originaler Gedanke war. Von heute aus gesehen ist das eher die traditionelle Wortart-und-Satzglied-Einteilung der sog. Schulgrammatik. Diese durfte Zamenhof als einem Absolventen des klassischen Gymnasiums bekannt gewesen sein. Im Schulunterricht hatte er außer den neueren Sprachen Russisch, Polnisch, Deutsch und Französisch auch die alten Sprachen Latein und Griechisch gelernt.48 In diesem Zusammenhang ist von Bedeutung, dass Ludwiks Vater, Markus ( Mordechai ) Zamenhof, Gymnasiallehrer für zwei Fremdsprachen, Deutsch und Französisch, war und als Verfasser eines mehrfach aufgelegten Lehrbuchs der deutschen Sprache für die russische Jugend hervorgetreten war.49 Ob und in welchem Maße der Sohn sich das Lehrwerk des Vaters zu Nutzen machte, kann nur in einer weitergehenden Untersuchung geklärt werden. Aber schon ein flüchtiger Vergleich der beiden Grammatiken bringt gewisse Parallelen an den Tag, vor allem in der Reihenfolge des dargebotenen Materials. Bemerkenswert ist auch, dass der sonst gegenüber einfacher Nachahmung des Deutschen kritisch eingestellte Zamenhof bei der Beschreibung des jiddischen Verbalsystems nach dem für die deutschen Grammatiken gängigen Konjugationsmodell starker und schwacher Verben verfährt.50 Die deutsche Grammatik von Zamenhofs Vater ist umfassender, denn sie enthält außer Phonetik und Wortbildung auch eine Darstellung der Syntax, die in der jiddischen Grammatik des Sohnes fehlt. Dafür enthält die Letztere einen Abschnitt über Versbau sowie einen anwendungsbezogenen Abschnitt über sprachliche Korrektheit. Ludwik Zamenhofs jiddische Grammatik gliedert sich in insgesamt 46 Paragraphen. Im ersten Paragraph, der die Orthographie behandelt, wird kurz und selbstbewußt die oben erwähnte Forderung zum Übergang zur lateinischen Schrift geäußert. Wie bereits erwähnt, verhinderte die Ablehnung gerade dieser radikalen Forderung eine positive Aufnahme der weiteren, durchaus klugen Vorschläge Zamenhofs zu einer Kodiĳizierung des Jiddischen. Die Neuartigkeit und Wissenschaftlichkeit von Zamenhofs Reflexionen über die Sprache ist besonders in den ersten Paragraphen ( §§ 2 – 6 ) zu erkennen, die phonologischen Phänomenen gewidmet sind. Dort stellt er z. B. phonologische Minimalpaare für das Jiddische auf, die erst in den letzten Jahrzehnten in 48 Wohingegen zu seinen Hebräischkenntnissen keine eindeutigen Angaben vorliegen, vgl. Gold 1980. 49 Markus Zamenhof 1875. 50 Vgl. Zarys § 30 und mein Kommentar dazu in Fn. 422 in Zamenhof 2012. Ewa Geller : Die Jiddische Grammatik des Ludwik Zamenhof 409 den modernsten Sprachlehrbüchern für europäische Sprachen ihren Platz gefunden haben. Es folgen unter dem Titel » Ausführlicher Teil « die einzelnen Wortarten, eingeleitet durch die folgenden Unterkapitel : Artikel ( § 7 ), Nomen ( § 8 – 15 ), Adjektiv ( § 16 – 19 ), Zahlwort ( § 20 – 21 ), Pronomen ( § 22 – 24 ), Verb ( § 25 – 36 ), Adverb ( § 37 – 38 ), Präposition ( § 39 – 42 ), Konjunktion und Interjektion ( § 43 ). Besondere Beachtung verdienen die drei letzten Paragraphen, betitelt » Allgemeine Grundsätze «, in denen Zamenhof die Grundlagen des Wortschatzaufbaus darlegt. Auch auf diesem Gebiet war er ein Visionär, der den Weg der › Sprachplanung ‹ vorzeichnete, den dann später auch die großen Jiddisten, allen voran Max Weinreich, einschlugen.51 Wie erwähnt, umfasst Zamenhofs deskriptive Studie nicht alle Bereiche der Sprache, die Syntax wird nicht behandelt. Dafür enthält sie drei interessante Anhänge. Im ersten Anhang, überschrieben » Muster richtiger und falscher Äußerungen und Orthographie « wird in einer vom Autor gründlich kommentierten Synopse ein und derselbe Beispieltext in einer unkorrekten, aber wie man vermuten kann, gängigen Version sowie in einer korrekten, d. h. der von Zamenhof vorgeschlagenen präskriptiv-normativen Version präsentiert. Diese zwei Varianten des Beispieltextes eignen sich gut dazu, Zamenhofs Gesamtkonzept einer » Grammatisierung « des Jiddischen zu veranschaulichen.52 Unkorrektes Jiddisch Korrektes Jiddisch Forgesterĕn bin ih́ gegangĕn hintrogĕn dos mehl un hob mih́ begenit mit Zalmen. Er iz nebih́ baj zeh́ azeu arogefallĕn noh́ der gancĕn geśih́ te ! Si iẑ zogar reh́ t auf ihm, denn er iẑ friher śeun gevezĕn ejn cu grojser nah́ al, un far dem hot ihn Gott ukaret, – es iz ober doh́ a rah́ mones euf a jidiśe zeele. Zajn vejnendik kol un dos blejh́ e ponim hot mih́ ongenumen baj dem harcĕn. Ejerneh́ tĕn bin ih́ gegangen avektrogĕn di mehl un hob̂ zah́ bagegĕnt mit Zalmenen. Er iẑ neboh́ ba zih́ azeu aropgefalĕn ( lies. : aroggefalĕn ) noh́ der gancer majse ! Ês iz aĳile reh́ t af ihm, vorem er iẑ friher śeun gevezĕn a cu greuser azesponim, un farderfar hot ehm Got baśtroft, – ês iz ober fort a rah́ mones af a jidiśe neśome. Zajn vejnediker kol un der blejh́ er ponim hot mih́ ongenumen ban harcĕn. 51 Detaillierte Prinzipien zur Erweiterung des jiddischen Wortschatzes wurden erst 1938 in Max Weinreichs programmatischen Artikel‫דײטשמעריש טויג ניט !י‬ ַ formuliert, ein bedeutender Teil der acht dort aufgeführten Postulate ist eine Wiederholung der von Zamenhof in seiner Studie fast 60 Jahre früher formulierten » allgemeinen Grundsätze «. Zum Thema der jiddischen Sprachplanung s. u. a. Peltz 1997, Kerler 1998, Geller 2011. 52 Die Tabelle stammt aus Zamenhof 2012. Die latinisierte Verschriftung des Jiddischen ist original, so wie er sie in seinem russischen Manuskript gebraucht hat. In der linken Spalte stehen im Originaltext in den Klammern hinter jedem wichtigen sprachlichen Problem Paragraphennummern, die auf die entsprechenden Stellen im Grammatiktext verweisen ; diese wurden hier der besseren Lesbarkeit wegen beseitigt. 410 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Vejst du, az men vart śejn baj unz den ah́ ten tog af dajnen bruder ; du musst doh́ vissĕn, varum er ist noh́ nit hir un vu er iz ject. Majn śvigerzun rih́ t zih́ jedĕn tog, dos er vert noh́ hajt kumen ; er libt ihm mehr vi zih́ allejn, und er zogt, az dos iz zajn bester frajnd un er ferlangt gor kejn besserĕn vi aza. Er ercehlt oft, vi dajn bruder hot ejn mol ĳir ehm zajn lebĕn rizikirt. Ibrigĕns, ver a za vahrĕn frajnd hot, der hot es gemusst fardinen : majn ejdim hot virklih́ zelbst a ejdlen karakter, un dos gance śtedtĕl undzer iẑ far ihm fajer un flamm. Vejsst du ( lies : vejssttu ), aẑ mi vartt śeun ban undz dem ah́ ttĕn tog af dajn bruder ; du muzst doh́ visĕn, far vos ( oder : vos iẑ di majse, vos ) er iẑ noh́ nit do ( lies : nitto ), un vu er iz ict. Majn ejdim rih́ tt zah́ jeder tog, az er vet noh́ hajnt kumen ; er hot ehm lib mehr vi zih́ allejn, un er zogt, aẑ dohs iẑ zajn besster frajnd un er farlangt gor nit kejn beserĕn vi azeunem. Er dercejlt oft, vi dajn bruder hot ejn mol far ihm ajngeśtelt zajn lehbĕn. Iberiks ( oder : iberikĕns ), verr es hot aza emesĕn frajnd, der hot es gemuzt fardihnen : majn ejdim hot in-dêr-emesĕn allejn an ejdelĕn karakter, un di gance śtetĕl undzere iẑ far ihm fajer un flam Die Auswertung von Zamenhofs Korrektheitsprinzipien und ihr Vergleich mit der für das Standardjiddische geltenden Sprachnorm böte genug Stoff für eine gesonderte Abhandlung.53 Hier sei nur darauf hingewiesen, dass Zamenhof in der » korrekten « Version das Neutrum abgeschafft hat.54 Des Weiteren schlägt er in Bezug auf die Lexik einen präskriptiven Weg ein, der später als › Antidajtschmerismus ‹ in die Jiddistik eingehen wird und mit dem Namen Max Weinreich verbunden ist. In Anhang ii » Über den Versbau « stellt Zamenhof nicht nur eigenes poetisches Talent unter Beweis, sondern leistet auch einen originellen Beitrag zur Theorie des Versbaus im Jiddischen. Der letzte Anhang iii enthält » Beispiele neujiddischer Sprichwörter und Redewendungen «, von denen heute, 130 Jahre nach ihrer Aufzeichnung, viele vergessen und für den heutigen Leser oft unverständlich sind. Wenn man abschließend Zamenhofs Studie zur jiddischen Grammatik bewerten möchte, der der Autor mehrere Jahre seiner linguistischen Arbeit gewidmet hat, in einem Zeitraum, in dem auch schon seine Konzeption einer künstlichen Sprache entstand, ist es unmöglich, die Verbindung zwischen beiden Projekten außer Acht zu lassen.55 An dieser Stelle soll lediglich hervorgehoben werden, dass sich bislang ausschließlich Esperantisten mit einem systematischen Vergleich zwi53 Vgl. Fn. 45. 54 Es sind auch einige Inkonsequenzen bei der latinisierten Verschriftung des » korrekten « Jiddisch in der Handschrift zu verzeichnen : z. B. <s> [ s ] in <visen, greuser> aber ( fehlerhaft ) <ss> in <vejsst, vejsstu>, die eher als Flüchtigkeitsfehler denn als beabsichtigte Norm zu werten sind. 55 Eingehend dazu vgl. den einleitenden Artikel von Agnieszka Jagodzinska ( 2012 ) in Zamenhof 2012. Ewa Geller : Die Jiddische Grammatik des Ludwik Zamenhof 411 schen Jiddisch und Esperanto beschäftigt haben.56 Der beste Beweis dafür ist, dass die erste vollständige Übersetzung von Zamenhofs jiddischer Grammatik auf Esperanto erschien.57 Das Desinteresse der zeitgenössischen Jiddistik an diesem wichtigen Werk hat vielleicht ähnliche Motive wie die inhaltlich völlig unberechtigte Nicht-Berücksichtigung von Zamenhofs Arbeiten bei der Standardisierung des Jiddischen durch die ersten Jiddisten.58 An dieser Stelle sei resümiert, dass die meisten der normativen Forderungen, die der junge Zamenhof in seiner Studie zur jiddischen Grammatik im Jahre 1880 formulierte, in den yivo-Standard eingingen.59 Man darf also feststellen, dass Zamenhof auf visionäre Weise, aber doch erstaunlich genau, die Richtung voraussah, die die späteren Architekten des modernen Standard-Jiddischen eingeschlagen haben. Um so mehr ist zu bedauern, dass Ludwik Zamenhofs Pionierleistungen, seine souveränen, wegweisenden und wissenschaftlich fundierten Studien auf dem Gebiet der Jiddistik in der Geschichte der Jiddischforschung weitgehend verschwiegen worden sind.60 Zitierte Literatur Birnbaum, Salomon, [ 1918 ] 1984 : Grammatik der Jiddischen Sprache. Hamburg : Buske Verlag. – 1979 : Yiddish : A Survey and a Grammar. Toronto & Buffalo : University of Toronto Press. Borokhov, Ber, 1912 : » Di yidn-frage bay dem esperanto-kongres. « In : Di varhayt, 5. September. New York. 56 Gold 1980, Golden 1982, Piron 2003, Prion 2004. 57 Holzhaus 1982. 58 Ohne das Wissen um die Tatsache, dass der Esperantist Zamenhof nicht gerade in Borokhovs ideologisches Programm des Jiddischismus passte, ist es schwer, die Nicht-Erwähnung seiner linguistischen Leistungen auf dem Gebiet der Jiddistik in der ansonsten objektiven akademischen Monographie Max Weinreichs ( [ 1926 ] 1993 ) nachzuvollziehen. 59 Ausführlich dazu vgl. die annotierte polnische Edition seiner Grammatik in Zamenhof 2012. Im Kommentarteil dieser Ausgabe habe ich versucht, die meisten von Zamenhofs präskriptiven Vorschlägen mit den Normen des heutigen Standardjiddisch zu vergleichen. 60 Erst im letzten Jahrzehnt des 20. Jahrhunderts versuchte Dovid Katz ( 1994 a, 1994 b ), selbst Verfasser einer jiddischen Grammatik ( Katz 1987 ), das jiddische Werk Zamenhofs für die Jiddistik neu zu entdecken. Zamenhofs Studie zur jiddischen Grammatik, auf deren Fragmente Katz beim Blättern in archivierten Nummern von ‫ לעבּען אוּן וויסענשאפט‬stieß, war so weit vergessen, dass sich der Autor mit Bitte um Hilfe zum Aufĳinden der Handschrift an die Leser des Forverts wandte. Katz betonte begeistert den Pioniercharakter von Zamenhofs Grammatik und stellte fest : » Könnte man sie veröffentlichen, wäre das auch heute noch eine historisch-wissenschaftliche Sensation « ( Katz 1994 a : 13 ). Und sie ist es in der Tat ! 412 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ – [ 1913 ] 1966 a : » Di oyfgabn fun der yidisher ĳilologye. « In : Ber Borokhov, Shprakh-forshung un literatur-geshikhte. Tel-Aviv : Farlag Y. L. Perets, 53 – 75. – [ 1913 ] 1966 b : » Di bibliotek funem yidishn ĳilolog. « In : Ber Borokhov, Shprakh-forshung un literatur-geshikhte. Tel-Aviv : Farlag Y. L. Perets, 76 – 136. de Courtenay, Jan Baudouin, 1913 : W » kwestii żydowskiej « : odczyt wygłoszony w Warszawie 7 lutego 1913 r. Warschau : Skład Główny Księgarni G. Centnerszwer. – 1923 : Kwestia żydowska w Państwie Polskim. Warschau : Skład Główny w Stowarzyszeniu Wolnomyślicieli Polskich. Bartal, Israel, 1993 : » From traditional bilingualism to modern monolingualism. « In : Lewis Glinert, Hg., Hebrew in Ashkenaz : A Language in Exile. Oxford : Oxford University Press, 141 – 150. Fellman, Jack, 1973 : The Revival of a Classical Tongue : Eliezer ben Yehuda and the Modern Hebrew Language. The Hague : Mouton. Fishman, Joshua, 2008 : » Czernowitz Conference. « In : Gershon D. Hundert, Hg. : The yivo Encyclopedia of Jews in Eastern Europa, im Netz unter : http://www.yivoencyclopedia.org/article.aspx/Czernowitz_Conference [ Letzter Zugriff: 03.11.2011 ] Frakes, Jerold C., 2007 : The Cultural Study of Yiddish in Early Modern Europe. New York : Palgrave Macmillan. Geller, Aleksandra, 2012 : » Die Auseinandersetzungen um die jiddische Orthographie in der Wochenschrift Literarishe bleter. « In : Marion Aptroot, Efrat Gal-Ed, Roland Gruschka und Simon Neuberg, Hg., Leket : Yidishe shtudyes haynt. Jiddistik heute. Yiddish Studies Today. Düsseldorf : Düsseldorf University Press, 641 –656. Geller, Ewa, 2001 : Warschauer Jiddisch. Tübingen : Niemeyer. – 2008 : » Spory o genezę jidysz. « In : Geller Ewa und Monika Polit, Hg., Jidyszland – polskie przestrzenie. Warschau : Wydawnictwo Uniwersytetu Warszawskiego, 17 – 43. – 2010 : » The Polonization of Yiddish : A Path towards Language-Shift ? « In : Jews and Slavs 22, Themenheft : » Yiddish – a Jewish National Language at 100. « [ Proceedings of Czernowitz Yiddish Language 2008 International Centenary Conference ], 95 – 108. – 2011 : » Zum Kampf gegen den › Dajtschmerismus ‹ « in der jiddischen Sprache « In : Geschichte des Deutschen als Wissenschaftssprache im Ostseeraum. Frankfurt a.M. : Peter Lang, 205 – 217. – 2012 : » Jidyszysta Ludwik Zamenhof” 2012. In : Agnieszka Jagodzińska, Hg., Ludwik Zamenhof wobec » kwestii żydowskiej «. Wybór źródeł, Krakau-Budapest [ im Druck ] Ewa Geller : Die Jiddische Grammatik des Ludwik Zamenhof 413 Gold, David, 1980 : » Towards a Study of Possible Yiddish and Hebrew Influence on Esperanto. « In : Istvan Szerdahelyi, Hg., Miscellanea Interlinguistica. Budapest : Tankönyvkiadó, 300-367. Harshav, Benjamin, 1990 : The Meaning of Yiddish. Berkeley – Los Angeles – Oxford : University of California Press. Harris, Isidore, 1907 : » Esperanto and Jewish Ideals. « [ Interview mit Dr. Zamenhof ] In : Jewish Chronicle, 6. September 1907. Holzhaus, Adolf, 1982 : Provo de gramatiko de novjuda lingvo ( de jargono ), kompilis L. Z., L. Gamzefon. Helsinki. Jacobs, Neil G., 1990 : Economy in Yiddish Vocalism. A Study in the Interplay of Hebrew and Non-Hebrew Components. Wiesbaden : Harrassowitz. – 2005 : Yiddish. A Linguistic Introduction. Cambridge : Cambridge University Press Jagodzińska, Agnieszka, Hg., 2012 : Ludwik Zamenhof wobec » kwestii żydowskiej «. Wybór źródeł, Krakau – Budapest : Austeria [ im Druck ]. Katz, ( Hirshe- ) Dovid, 1986 : » On Yiddish, in Yiddish and for Yiddish : 500 Years of Yiddish Scholarship. « In : Mark Gelber, Hg., Identity and Ethos. A Festschrift for Sol Liptzin on the Occasion of His 85th Birthday. New York – Berne – Frankfurt a. M. : Peter Lang, 23 – 36. – 1987 : Grammar of the Yiddish Language. London : Duckworth. – 1994 a : » Yidish un esperanto : di yidishe gramatik fun dr. Ludvik ( Leyzer ) Zamenhof « In : Forverts, 28. Januar : 13, 23. – 1994 b : » Yidish un esperanto : di yidishe gramatik fun dr. Ludvik ( Leyzer ) Zamenhof « In : Forverts, 11. Februar : 13, 20. – 2009 : » 7 kingdoms of Litvaks. « In : http://www.dovidkatz.net/dovid/Lithuania/7_KingdomsLitvaks.pdf Kerler, Dov-Ber, Hg., 1998 : The Politics of Yiddish. Studies in Language, Literature & Society. Walnut Creek, ca : AltaMira Press. Künzli, Andreas. 2010 : L. L. Zamenhof ( 1859-1917 ). Esperanto, Hillelismus ( Homaranismus ) und die › jüdische Frage ‹ in Ost- und Westeuropa. Wiesbaden : Harrassowitz. Mark, Yudl, 1978 : Gramatik fun der yidisher klal-shprakh. New York : Alveltlekher yidisher kultur-kongres. Peltz, Rakhmiel, 1997 : » The undoing of language planning from the vantage of cultural history : two twentieth century examples. « In : Michael Clyne, Hg., Undoing and Redoing Corpus Planning. Contributions to the Sociology of Language. Berlin / New York : de Gruyter, 327 – 355. Prilutski [Pryłucki], Noyekh, 1909 a : [ Brief zur Redaktion ]. In : Lebn un visnshaft, 4 ( August ) : 147 – 148. – 1909 a : » Materialen far yidisher gramatik un ortografye ( notitsn ). « In : Lebn un visnshaft 5 ( September ) : 61 – 68. Reyzen, Zalmen, 1908 : Yudishe gramatik. Warschau : Progres. 414 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ – 1920 : Gramatik fun der yidisher shprakh. Ershter teyl. 2. Aufl. Wilna : Farlag Sh. Shreberk. – 1927. » Ludvik Zamenhof als yidishist. « In : Literarishe bleter, 23 : 431 – 433. Steffen, Katrin, 2004 : Jüdische Polonität. Ethnizität und Nation im Spiegel der polnischsprachigen jüdischen Presse 1918 – 1939. Göttingen : Vandenhoeck & Ruprecht. Weinreich, Max, [ 1923 ] 1993 : Geschichte der jiddischen Sprachforschung. [ U. d. T. » Studien zur Geschichte und dialektischen Gliederung der jiddischen Sprache. Erster Teil. Geschichte und gegenwärtiger Stand der jiddischen Sprachforschung. « zugl. Dissertation, Universität Marburg 1923. ] hg. von Jerold C. Frakes. Atlanta : Scholars Press. – 1938 : » Daytshmerish toyg nit. « In : Yidish far ale 3 : 97 – 106. – [ 1973 ] 2008: History of the Yiddish Language. Hg. von Paul Glasser, übers. von Shlomo Noble with the assistance of Joshua A. Fishman. 2 Bde. New Haven: Yale University Press. Zamenhof, Ludwik [ als Homo Sum ], 1901 : Gilelizm : proekt rešenija evrejskogo voprosa. Warschau – Sankt Petersburg. – [ als Dr. x ], 1909 : » Vegn a yidisher gramatik un reform in der yidisher shprakh «. In : Leben un visenshaft 1 ( Mai ) : 50 – 56. – [ als Dr. x ], 1910 a : » Proben fun a yidisher gramatik. « In : Leben un visenshaft 7 ( Januar ) : 89 – 96. – [ als Dr. x ], 1910 b : » Di proben fun a yidisher gramatik. ( A brif in der redaktsye ) « In : Leben un visenshaft 9 ( März ) : 97 – 104. Zamenhof, Ludwik, [ 1880 ] 2012 : Zarys gramatyki języka nowożydowskiego ( żargonu ), [ aus dem Russ. übersetzt von Aleksandra Kazuń, mit Kommentaren von Ewa Geller ]. In : Agnieszka Jagodzińska, Hg., Ludwik Zamenhof wobec » kwestii żydowskiej «. Wybór źródeł. Krakau-Budapest : Austeria [ im Druck ]. Zamenhof, Markus Fabian, 1875 [ 1871 ] : Lehrbuch der deutschen Sprache für die russische Jugend. Nach zweckmäßigster Methode bearbeitet von M.F. Samenhof ; 2-te veränderte und vielfach vermerkte Auflage, nebst einem russisch-deutschen Wörterbuch. Empfohlen vom Ministerium der Volksaufklärung. Warschau : J. Goldman. Jürg Fleischer und Lea Schäfer Der Kasus nach Präposition in westjiddischen Quellen des ( langen ) 19. Jahrhunderts 1. Einleitung Ein auffälliger Unterschied zwischen der ostjiddischen Standardsprache ( klal-shprakh ) und dem Standard-Deutschen zeigt sich bei den Kasus, die nach Präpositionen Verwendung ĳinden. Die Grammatiken und Sprachskizzen des Ostjiddischen sind sich einig, dass nach Präpositionen mit ganz wenigen Ausnahmen ausschließlich der Dativ auftritt.1 Dagegen können im Deutschen nach Präposition auch andere Kasus verwendet werden. Besonders auffällig ist der Unterschied zum Ostjiddischen bei den sogenannten › Wechselpräpositionen ‹. Bei dieser Gruppe von Präpositionen ( zu denen im Standarddeutschen an, auf, hinter, in, neben, über, unter, vor und zwischen gehören ) 2 tritt bei der prototypischen lokalen Verwendung je nach Funktion der Akkusativ oder der Dativ auf. Mit dem Akkusativ wird dabei die Richtung ( bzw. die Ortsveränderung ) bezeichnet, mit dem Dativ dagegen die Lage ( bzw. die Ortsruhe ). Ortsruhe ( Dativ ) : er wohnt in der Stadt Richtung ( Akkusativ ) : er geht in die Stadt Diese Unterscheidung von Ortsruhe und Richtung, die sich in ähnlicher Weise in zahlreichen indogermanischen Sprachen ĳindet ( beispielsweise auch in den west- und ostslavischen Sprachen, mit denen das Ostjiddische koterritorial ist ), wurde im Ostjiddischen aufgegeben. In den folgenden Beispielen tritt in der Präpositionalphrase in der shtot die gleiche Kasusform, nämlich der Dativ, auf, obwohl damit im einen Fall die Ortsruhe, im anderen Fall die Richtung bezeichnet wird. Ortsruhe ( Dativ ) : Richtung ( Dativ ) : er voynt in der shtot › er wohnt in der Stadt ‹ er geyt in der shtot › er geht in die Stadt ‹ 1 Vgl. z. B. Birnbaum 1918 : 59, Zaretski 1929 : 196, 197, Mark 1978 : 251, Fal ’ kovič 1967 : 621, Fal ’ kovič 1984 : 708, Katz 1987 : 76, Jacobs et al. 1994 : 402. 2 Vgl. Duden Grammatik 2009 : 608 f. 416 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Dass sich das System des Ostjiddischen vom System des Deutschen ( und anderer indogermanischer Sprachen ) unterscheidet, wird bei gewisssen jiddischen Grammatikern explizit thematisiert. Zaretski geht darauf ein, dass aufgrund des einheitlichen Dativs nach Präposition im Jiddischen anders als im Russischen und Deutschen anhand des Kasus keine Unterscheidung zwischen den Antworten auf die Fragen » vu ?« und » vuhin ?« getroffen werden kann, was er unter anderem anhand der Beispielsätze er zitst oyfn boym › er sitzt auf dem Baum ‹ und er krikht oyfn boym › er klettert auf den Baum ‹ illustriert.3 Zwischen Ostjiddisch und Deutsch besteht also ein klarer Kontrast. Interessant ist in diesem Zusammenhang die Beobachtung, dass sich bei südwestjiddischen Informanten, die Ende des 19. Jahrhunderts geboren wurden, Belege für den Dativ nach Präposition zur Angabe der Richtung ĳinden.4 In den vorhandenen Materialien des Surbtaler Jiddischen ĳindet sich dies allerdings nicht konsequent : Bereits Guggenheim-Grünberg weist darauf hin, dass dieses Merkmal nur » im älteren Sprachgebrauch« beobachtet werden kann.5 Es sind vor allem die noch über eine besonders archaische Form des Westjiddischen verfügenden Informanten, die den Dativ nach Präposition auch zur Richtungsangabe relativ konsequent verwenden. Die folgenden Beispiele aus dem Surbtaler bzw. Hegauer Jiddischen, der westjiddischen Varietät der Schweiz bzw. des südbadischen Hegau, zeigen diese Struktur : ʋu iɕ im hauz ãĩəkʰoː bin ( Endingen ) 6 › als ich ins ( wörtlich : im ) Haus hineingekommen bin ‹ ər heŋt s nid an dər ɡros ɡlok ( Randegg ) 7 › er hängt es nicht an die ( wörtlich : an der ) große Glocke ‹ Diese Verwendung des Dativs entspricht weder dem Standarddeutschen, noch den zu diesen südwestjiddischen Varietäten koterritorialen hochalemannischen Dialekten. Dass sich hier ein Merkmal zeigt, das sich in gleicher Weise auch im Ostjiddischen ĳindet, ist deshalb umso auffälliger und lässt es lohnend erscheinen, dieses grammatische Merkmal in Bezug auf das Westjiddische eingehender zu untersuchen. 3 4 5 6 7 Zaretski 1929 : 197 f. Vgl. Fleischer 2004 : 131. Guggenheim-Grünberg 1966 : 24. Fleischer 2005 : 142. Ibid. : 290. Jürg Fleischer und Lea Schäfer : Der Kasus nach Präposition 417 2. Kasus Die von uns im Folgenden verwendeten Kasusbezeichnungen sind diachron zu verstehen. Ein › historischer ‹ Dativ setzt eine alte Dativ-Form fort, doch heißt dies nicht, dass sie auch synchron als Dativ ( der im System z. B. einem Akkusativ gegenübergestellt wäre ) funktioniert. Bekanntermaßen unterscheidet das Standard-Ostjiddische in bestimmten Formen grundsätzlich nicht zwischen Akkusativ und Dativ ( so lautet etwa beim maskulinen deĳiniten Artikel sowohl der Akkusativ als auch der Dativ dem ). Eine Unterscheidung zwischen den beiden Kasus ergibt in einem solchen Fall mit Blick auf das synchrone System keinen Sinn, obwohl die Form historisch, d. h. in einer diachronen Perspektive, unter Umständen durchaus einem bestimmten Kasus zugeordnet werden kann ( so geht etwa die Form dem des maskulinen Artikels auf den Dativ zurück, es handelt sich um eine › historische Dativform ‹ ). Wenn wir deshalb im Folgenden von einem › historischen ‹ Dativ oder Akkusativ sprechen, so bedeutet dies, dass die entsprechenden Formen diachron als Dativ bzw. Akkusativ anzusprechen sind ; mit diesen Begriffen wird keine Aussage darüber gemacht, ob diese Formen auch synchron die entsprechenden Funktionen aufweisen. Es ist wichtig zu unterscheiden, ob ein bestimmtes grammatisches System generell nicht zwischen Akkusativ und Dativ unterscheidet, oder ob dies nur nach Präposition der Fall ist. In bestimmten ostjiddischen Dialekten ist die Distinktion zwischen Akkusativ und Dativ vollständig ( also nicht nur nach Präposition ) abgebaut : 8 ‫י‬ ‫נישטא‬ ָ ‫אין געוויסע ליטווישע רעדענישן איז‬ .‫קוזאטיוו‬ ַ ‫דאטיוו און ַא‬ ַ ‫קיין אונטערשייד צווישן‬ .‫בויגאל‬ ַ ‫נאר איין ָאביעקט ־‬ ָ ‫ראן‬ ַ ‫א‬ ַ ‫דארטן איז‬ ָ In gewissen litauischen Mundarten gibt es keinen Unterschied zwischen Dativ und Akkusativ. Dort gibt es nur einen Objekt-Kasus. Für das Nordostjiddische ergibt eine terminologische Unterscheidung zwischen Akkusativ und Dativ aufgrund der synchronen Morphologie also keinen Sinn. Zaretski fasst diesen Tatbestand terminologisch als » obyekt-boygfal « ; 9 eine übliche Bezeichnung für einen derartigen Kasus ist › ( casus ) obliquus ‹ bzw. › oblique ( case ) ‹. Auch bestimmte deutsche Dialekte, nämlich ein Großteil des Niederdeutschen, sind durch einen vollständigen Zusammenfall von Akkusativ und Dativ, d. h. einen Obliquus, gekennzeichnet.10 Obwohl nun aber im Nordostjiddischen 8 Zaretski 1929 : 160. 9 Ibid. : 160. 10 Vgl. Shrier 1965 : 431 418 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ ( und Niederdeutschen ) Akkusativ und Dativ vollständig zusammengefallen sind, können viele Formen historisch dem Akkusativ oder dem Dativ zugeordnet werden. Für die untersuchten westjiddischen Quellen ist es in der Regel nicht möglich gewesen, das gesamte Kasussystem zu analysieren. Unsere Aussagen beziehen sich im Folgenden ausschließlich auf das Auftreten von Kasusformen nach Präposition, wobei wir unterscheiden, ob in historischer Hinsicht eine Akkusativ- oder eine Dativform vorliegt. Dabei beschränken wir uns auf solche Fälle, in denen der historische Dativ in Kontexten vorkommt, in denen man den Akkusativ erwartet ( im Folgenden wird dies gelegentlich auch als » akkusativischer Kontext« bezeichnet ), und umgekehrt. Dabei gehen wir einerseits auf die prototypische lokale Verendung ein, doch werden auch andere Verwendungen – z. B. bei Präpositionen, denen ursprünglich nur ein Kasus zukommt, bei denen aber in bestimmten Quellen der andere Kasus auftritt – berücksichtigt. Mit der Aussage, dass in einer bestimmten Quelle ein historischer Dativ nach Präposition auftritt, sind keine synchronen Aussagen zum Kasussystem verbunden. 3. Westjiddische Quellen Das Westjiddische wurde bekanntermaßen seit dem Ende des 18. Jahrhunderts in einem fortschreitenden Prozess zugunsten deutscher Varietäten aufgegeben. Der genaue Ablauf ist bisher kaum erforscht, was auch an der Tatsache liegt, dass dazu nicht besonders viele ( und gut aufbereitete ) Quellen vorhanden sind. Während man für die Zeit vor dem Ende des 18. Jahrhunderts von einem sich über ganz Mittel- und Osteuropa erstreckenden jiddischen Sprachgebiet ausgehen kann,11 ist die Situation im 20. Jahrhundert demgegenüber eine gänzlich andere : 12 On the eve of the Second World War, the status of Yiddish in most of Western Europe was hardly comparable to that of Yiddish in Eastern Europe. Eastern Yiddish was the living idiom of nearly 7 million Jews in Eastern Europe alone, and of over 10.5 million world wide. It had, moreover, become a vehicle for intense literary creativity. Western Yiddish, on the other hand, had been almost extinguished in the face of the penetration of both regional and Standard German into the Ashkenazic communities, and remained an everyday idiom only in a few areas on the western and eastern fringes of the German language area. 11 Vgl. z. B. die Karte in Katz 1983 : 1023. 12 lcaaj 1 : 10. Jürg Fleischer und Lea Schäfer : Der Kasus nach Präposition 419 So wurden beispielsweise im Rahmen des lcaaj für den Westen des Untersuchungsgebiets nur Befragungen in einem sehr reduzierten Umfang vorgenommen, weil sich zeigte, dass die Informanten kaum noch Westjiddisch sprachen ; 13 eine Ausnahme dazu stellt nur der Südwesten des westjiddischen Gebiets da, wo – dank der Aktivitäten von Florence Guggenheim-Grünberg – auch im 20. Jahrhundert noch vergleichsweise viele Informanten befragt und Tonaufnahmen eingespielt werden konnten.14 Um die Strukturen des Westjiddischen als gesprochener Sprache zu beschreiben, ist man in den übrigen Gebieten auf schriftliche Quellen angewiesen. Allerdings sind die schriftlichen Zeugnisse bis etwa zur Mitte des 18. Jahrhunderts von der gesprochenen Sprache möglicherweise ziemlich weit entfernt. Katz ( vgl. Anm. 15 ) beispielsweise geht davon aus, dass altjiddische Zeugnisse für die dialektale Zusammensetzung des Westjiddischen keine geeignete Quelle darstellen.15 Von Steven Lowenstein ( vgl. Anm. 16 ) stammt ein erster Überblick zu Texten, in denen gesprochenes Westjiddisch im 19. Jahrhundert schriftlich festgehalten wurde.16 Die Motivationen, dies zu tun, sind sehr unterschiedlich, beispielsweise bedienten sich verschiedene Maskilim des gesprochenen Westjiddischen, um ungebildete Figuren zu charakterisieren, ebenso ist aber auch rein antiquarisches Interesse oder eine karikierende, nicht selten auch diffamierend-antisemitische Verwendung des Westjiddischen ( bzw. seiner Imitationen ) zu beobachten. Dabei versteht sich von selbst, dass der Grad der Authentizität des Westjiddischen nicht immer gleich ist. Im Rahmen des an der PhilippsUniversität Marburg angesiedelten, von der Deutschen Forschungsgemeinschaft ĳinanzierten Forschungsprojekts » Westjiddisch im ( langen ) 19. Jahrhundert : Quellenlage, soziolinguistische Situation und grammatische Phänomene«17 versuchen wir, systematisch Quellen zum Westjiddischen in der Zeit von 1789 bis 1914 zu lokalisieren, zu erschließen und schließlich in linguistischer und soziolinguistischer Hinsicht auszuwerten. Die im Folgenden analysierten Texte wurden im Rahmen der Projektarbeit ( bzw. der Vorarbeiten dazu ) erschlossen, wobei uns die in Weinreich genannten Quellen als erster Ausgangspunkt dienten.18 Wir bieten in Bezug auf das hier behandelte linguistische Phänomen nun eine erste Analyse. 13 Vgl. Lowenstein 1969 : 17. 14 Vgl. Fleischer 2005. 15 Katz 1983 : 1025. 16 Lowenstein 1979. 17 Mitarbeiterinnen : Ute Müller und Lea Schäfer, Leitung : Jürg Fleischer ; Projektbeginn : 01.09.2011, Laufzeit : 36 Monate. 18 Weinreich [ 1953 ] 1958. Für die Erschließung der Quellen erweisen sich der Spürsinn und die Expertise von Ute Müller als unabdingbar ; wir danken ihr an dieser Stelle herzlich dafür. 420 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Die Frage, inwieweit eine bestimmte Quelle authentisches Westjiddisch repräsentiert, ist nicht einfach zu beantworten und verdiente für jeden einzelnen Fall eine eingehendere Behandlung, als wir sie im Folgenden geben können. Mehrere der ausgewerteten Quellen sind mit Sicherheit nicht in jeder Beziehung als authentisch anzusprechen, doch da für das Westjiddische kaum Quellen zur Verfügung stehen, kann man auch auf die Analyse von nur beschränkt geeigneten Quellen nicht verzichten.19 Um zu entscheiden, inwieweit sich in einer bestimmten Quelle das Westjiddische manifestiert, beschränken wir uns im Folgenden jeweils auf einige charakteristische lautliche und lexikalische Merkmale, und zwar auf die Entwicklung der Vokale E4 ( = mhd. ei ) und O4 ( = mhd. ou ), die im Westjiddischen zu /aː/ monophthongiert wurden, sowie auf die Vokale E2 ( = mhd. ê, œ ) und O2 ( = mhd. ô ), die im Ost- wie im Westjiddischen häuĳig diphthongische Reflexe zeigen. Außerdem gehen wir darauf ein, ob sich in einer bestimmten Quelle für das Westjiddische typische Lexeme ĳinden ; dabei beziehen wir uns auf die Gegenüberstellungen von Katz und Aptroot und Gruschka.20 Wenn in einem Text in Bezug auf die von uns untersuchten Merkmale westjiddische Formen auftreten, bedeutet dies natürlich noch nicht automatisch, dass der Text generell, d. h. auch in Bezug auf andere Merkmale, als für das Westjiddische authentisch angesehen werden kann. 4. Westjiddische Quellen : Einzelanalysen In den folgenden Abschnitten gehen wir auf westjiddische Quellen ein, in denen sich Hinweise auf die Verwendung eines einheitlichen Kasus nach Präposition ĳinden. Dabei beziehen wir uns auf die Einteilung der jiddischen Dialekte nach Katz, der für das Westjiddische ( abgesehen von Übergangsgebieten ) die Dialektgebiete Südwestjiddisch, Zentralwestjiddisch und Nordwestjiddisch ansetzt.21 Wir gehen allerdings nicht auf Quellen aus dem südwestjiddischen Gebiet ein, da dazu schon Informationen vorliegen ( vgl. Abschnitt 1 ), und wir haben auf die Analyse zentralwestjiddischer Quellen ( vgl. 4 . 1 – 4 . 5 ) besonderes Gewicht gelegt, da das Nordwestjiddische ( vgl. 4 . 6 – 4 . 8 ) in einem großen Teil seines Verbreitungsgebietes mit dem Niederdeutschen, welches durch vollständigen Synkretismus von Akkusativ und Dativ gekennzeichnet ist, koterritorial ist ; dadurch wird die Interpretation der Daten, wo sie mit dem örtlichen Deutschen übereinstimmen, wesentlich schwieriger. 19 Vgl. Weinreich [ 1953 ] 1958 : 185 f. 20 Katz 1983 : 1025, Aptroot und Gruschka 2010 : 51. 21 Katz 1983. Jürg Fleischer und Lea Schäfer : Der Kasus nach Präposition 421 4 . 1 Aaron ( Halle- )Wolfssohn : Leichtsinn und Frömmelei Das Theaterstück ‫ איין אמיליען געמעלדע אין‬/ ‫לייכטזין אונד רעממעלייא‬ ‫ דרייא אויציגן‬erschien erstmals 1795 / 1796 in Breslau.22 Der 1765 in Halle ( oder in Niederehnheim / Elsass ) geborene und in Fürth aufgewachsene Aaron Wolfssohn war zum Erscheinungsjahr Lehrer an der Königlichen Wilhelmsschule in Breslau.23 Diese Schule war dem Geist der jüdischen Aufklärung verpflichtet, und in diesem Kontext steht auch das vorliegende Purimspiel. Wir ĳinden im Stück eine sprachliche Differenzierung der Figuren je nach Bildungsgrad : Der unaufgeklärte Jude spricht eine als Westjiddisch zu erkennende Sprache, die aufgeklärten Figuren sprechen dagegen Hochdeutsch. Der Ort der Handlung ist aller Wahrscheinlichkeit nach Berlin.24 Dort verbrachte Wolfssohn von 1785 bis 1791 und von 1807 bis 1813 einige Jahre als Privatlehrer.25 Unklar bleibt jedoch, ob Wolfssohn das Berliner, Fürther oder Breslauer Jiddisch wiedergibt ( insofern ist auch die Zuordnung zum Zentralwestjiddischen unsicher ). Wolfssohns Westjiddisch zeigt mehrere zu erwartende Charakteristika : Der Vokal E4 erscheint in Schreibungen, die vermuten lassen, dass /aː/ vorliegt, z. B. ‫גמאהנט‬ ַ › gemeint ‹ ( Leichtsinn 38 ), ‫דרהאהם‬ ַ › daheim ‹ ( Leichtsinn 38 ), ‫קאהן‬ ַ › kein ‹ ( Leichtsinn 43 ). Auch O4 zeigt die gleichen Graphien, etwa ‫ › ַאהגען‬Augen ‹ ( Leichtsinn 44 ), ‫ › ַאהך‬auch ‹ ( Leichtsinn 40 ). Der Vokal E2 wird orthographisch als <‫ > ַאי‬wiedergegeben, z. B. ‫גאיט‬ ַ › geht ‹ ( Leichtsinn 39 ) oder ‫שטאין‬ ַ › stehen ‹ ( Leichtsinn 44 ), was auf eine diphthongische Realisierung schließen lässt. Der Vokal O2 zeigt ebenfalls diphthongische Realisierungen als <‫>וי‬, etwa in ‫ › שוין‬schon ‹ oder ‫ › זויא‬so ‹ ( beide Leichtsinn 40 ). Westjiddische Kennwörter treten jedoch nicht auf. Anstelle der im westlichen Westjiddisch verbreiteten Form Ette › Vater ‹ steht ‫טאטטען‬ ַ ( Leichtsinn 69 ). Dies könnte ein mögliches Indiz für das Breslauer Jiddisch als Zielsprache Wolfssohns sein. Allerdings ĳindet sich auch im Berliner Jiddisch bereits diese dem Ostjiddischen entsprechende Form ( vgl. Abschnitt 4 . 8 zu A. H. Heymann ). In Bezug auf den Kasus nach Präpositionen ĳinden sich ausschließlich Belege für das Femininum. An zwei Stellen tritt der historische Dativ zur Bezeichnung der Richtung auf : ‫האבן אין דער קיך צו קוממען‬ ָ ‫נארר ער מעכט גערן ען אויסרייד‬ ָ ( Leichtsinn 49 ) 22 Wir zitieren nach der Erstausgabe Breslau 5596 [ 1795 / 96 ], und zwar nach einem Digitalisat der Universitätsbibliothek der Goethe-Universität Frankfurt a. M. ( Signatur : Jud. Germ. 646 ). 23 Och und Strauss 1995: 53 f. 24 Ibid. : 59. 25 Ibid. : 53 – 57. 422 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ › nur möchte er eine Ausrede haben, um in die ( wörtlich : in der ) Küche zu kommen ‹ ‫ ( גאיט נארר נונטער אין דער שטוב‬Leichtsinn 74 ) › geht nur hinunter in die ( wörtlich : in der ) Stube ‹ Allerdings zeigt das Stück bei Feminina auch Belege für den historischen Akkusativ zur Bezeichnung der Ortsruhe : ‫קלאווירס אין דיא וועלט‬ ַ ‫ ( ׳ ס געבט נאך מעהר‬Leichtsinn 75 ) › Es gibt noch mehr Klaviere in der ( wörtlich : in die ) Welt ‹ ‫בלאהבן‬ ַ ‫ ( ע ָשאה אין דיא קיך צו‬Leichtsinn 84 ) › eine Stunde in der ( wörtlich : in die ) Küche zu bleiben ‹ 4 . 2 A. L. Rosenthal : Die Hochzeit zu Grobsdorf Bei diesem aus dem zentralhessischen Raum stammenden Theaterstück handelt es sich um eine der interessantesten Quellen des Westjiddischen. Es ist uns überliefert in einer auf das Jahr 1822 datierten Handschrift und wird in der Max Weinreich Collection des yivo 26 aufbewahrt. Der erste Akt wurde von Lowenstein zusammen mit einer Übersetzung ins Ostjiddische zugänglich gemacht.27 Die Autorschaft ist noch nicht gänzlich geklärt. Als potentieller Autor kommt der Gießener Lehrer Arje Löb Rosenthal ( geboren 1786 vermutlich in Büdingen, gestorben am 06. Juli 1841 in Gießen ) 28 in Frage, da dieser der einzig nachweisbare Namensträger dieser Zeit im Großherzogtum Hessen ist. Von eben diesem Lehrer A. L. Rosenthal sind drei weitere Texte bekannt, die religiöse Moralschriften mit einer gewissen Afĳinität zur jüdischen Aufklärung darstellen.29 Die Texte sind 1821, 1823 und 1824 in Marburg und Büdingen erschienen, also in einer kurzen schreibproduktiven Phase, in die auch die Entstehung des Theaterstücks fallen würde.30 Vor diesem Hintergrund wäre das Theaterstück mehr als Sittengemälde denn als Lokalposse zu verstehen, was problemlos mit seinem Inhalt vereinbar ist. In der Sprache der jüdischen Figuren des Theaterstücks zeigen sich viele für das Westjiddische zu erwartende Formen. So erscheint 26 Max Weinreich Collection RG 584, folder 10. Die Seiten 129 f u. 135 f fehlen im Original. Wir zitieren nach den Manuskriptseiten. 27 Lowenstein 1975. 28 Nach den genealogischen Recherchen Mark Rosenthals ( Los Angeles ) in Gießener Archiven, deren Ergebnisse er uns schriftlich zukommen ließ, wofür wir ihm an dieser Stelle herzlich danken. 29 Fürst 1863 : 170. 30 Vgl. Lowenstein 1975 : 57. Jürg Fleischer und Lea Schäfer : Der Kasus nach Präposition 423 Vokal E4 regelmäßig in den Graphien <‫ > ַאה‬und <‫> ַא‬, die eindeutig auf /aː/ schließen lassen, etwa ‫ › ַאהן‬ein ‹ ( Grobsdorf u. a. 42, 45, 46 ), ‫האסט‬ ַ › heißt ‹ ( Grobsdorf u. a. 71, 84, 90 ), ‫קאה‬ ַ › kein ‹ ( Grobsdorf u. a. 40, 41, 42 ). Für den Vokal O4 ĳinden sich dieselben Graphien etwa in ‫ › ַאהך‬auch ‹ ( Grobsdorf u. a. 37, 39, 41 ), ‫ראה‬ ַ › Frau ‹ ( Grobsdorf u. a. 41, 43, 48 ), ‫קאע‬ ַ › kaufen ‹ ( Grobsdorf 103, 111 ). Bei Vokal E2 lassen die verwendeten Graphien <‫ > ֵ י‬auf eine diphthongische Realisierung schließen, etwa in ‫ֵרידע‬ › reden ‹ ( Grobsdorf 99, 121 ), ‫ › ֵגיהן‬gehen ‹ ( Grobsdorf u. a. 66, 71, 72 ) oder ‫ › ֵשיא‬schön ‹ ( Grobsdorf 49 ). Für Vokal O2 tritt meist die Graphie <‫>וי‬ auf, die ebenfalls auf eine diphthongische Realisierung deutet, etwa in ‫ › גרויזע‬große ‹ ( Grobsdorf u. a. 37, 51, 52 ), ‫ › רויטע‬rote ‹ ( Grobsdorf u. a. 100, 109, 114 ) oder ‫ › ברויט‬Brot ‹ ( Grobsdorf u. a. 40, 114, 118 ). In Bezug auf den Kasus nach Präposition tritt in der Sprache der jüdischen Figuren der Dativ zur Bezeichnung der Richtung im Maskulinum und Femininum auf : ‫געמארשירט‬ ַ ‫דאנץ‬ ַ ‫ווארד אועם‬ ַ ‫ ( איץ‬Grobsdorf 53 ) › Jetzt wird auf den ( wörtl. : auf dem ) Tanz marschiert ‹ ‫ ( איך ווילל ַאווייל ַאנויס ֵגיא אין דער קיך‬Grobsdorf 37 ) › ich will eine Weile hinaus gehen in die ( wörtl. : in der ) Küche ‹ ‫ מער ֵגיהן ליעבער אהנונטער אין דער ווערטסשטוב‬,‫ווארט‬ ַ i( 72 Grobsdorf ) › warte, wir gehen lieber hinunter in die ( wörtl. in der ) Wirtsstube ‹ Im Plural ĳindet sich dagegen der historische Akkusativ in dativischen Kontexten, wie der folgende Beleg zeigt : ‫האלט מער זיך ַאלל ַאן דיע הענד‬ ַ ‫ ( דער נויך‬Grobsdorf 75 ) › danach hält man sich alle an den ( wörtl. an die ) Händen ‹ 4 . 3 Joseph Herz : Esther. Oder die belohnte Tugend Joseph Herz ’ Purimspiel reiht sich in eine lange Tradition von Estherdichtungen ein und bezeichnet nach Baum-Sheridan zugleich deren Ende.31 Das Stück erschien in Fürth 1828, im Todesjahr Joseph Herz ’ .32 Es erlebte bis 1871 immer wieder Neuauflagen, zuletzt dann auch in lateinischer Schrift.33 In Fürth war dieser Text allgemein unter dem Namen » Fürther Megille« bekannt. Der Autor wurde 1776 in Fürth 31 Baum-Sheridan 1996 : 82. 32 Süß 1984 : 13. 33 Ibid. 17. Wir zitieren nach der Zweitausgabe von 1854, wie sie als Faksimile in der Edition von Copeland & Süsskind ( 1976 ) vorliegt. 424 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ geboren und arbeitete dort als Zeichen- und Schönschreiblehrer sowie als Kupferstecher.34 Westjiddisch dient in diesem Drama, ähnlich wie im Stück Aaron Wolfssohns, zur Darstellung des Bildes vom rückständigen, nicht-aufgeklärten Juden, dem gegenüber steht der weltlich gewandte, Hochdeutsch sprechende Jude als ideale Verkörperung der Aufklärung. Das Stück ist überwiegend in Reimen verfasst und wird durch Lieder und Gedichte ergänzt. Das Westjiddisch dieser Quelle zeigt einige charakteristische Entwicklungen. Der Vokal E4 ĳindet sich als Langvokal /aː/, z. B. in ‫קלאהן‬ ַ › klein ‹ ( Esther u. a. 17, 22, 55 ), ‫קלא ַאדער‬ ַ › Kleider ‹ ( Esther u. a. 28, 34, 35 ), ‫לא ַאד‬ ַ › leid ‹ ( Esther 32 ). Ebenso verhält sich O4, z. B. ‫פראה‬ ַ › Frau ‹ ( Esther u. a. 11, 12, 16 ), ‫ › ַאהג‬Auge( n ) ‹ ( Esther 14, 30, 66 ), ‫גלא ַאב‬ ַ › glaube ‹ ( Esther 27, 29, 82 ). Der Vokal E2 verhält sich sehr variabel : er tritt zum einen als <‫ >יה‬in Erscheinung in ‫ › גיהן‬gehen ‹ ( Esther u. a. 15, 19 ), ‫ › שטיהט‬steht ‹ ( Esther 19 ), daneben erscheint er aber auch als <‫ >עה‬bzw. <‫>ע‬, z. B. in ‫ › שטעהן‬stehen ‹ ( Esther 19 ), ‫ › שעננער‬schöner ‹ ( Esther 21 ), ‫ › שעהן‬schön ‹ ( Esther 21, 22 ), außerdem auch als <‫>וי‬, z. B. ‫ › שוין‬schön ‹ ( Esther 21 ). Die lautliche Realität hinter den verschiedenen Graphien bleibt deshalb unklar. O2 zeigt sich in der Graphie dagegen regelmäßig als <‫>וי‬, z. B. ‫ › הוילט‬holt ‹ ( Esther 76 ), ‫ › רויטען‬roten ‹ ( Esther 15 ), ‫גרויז‬ › groß ‹ ( Esther 7 ), was auf /au/ oder /ou/ deutet.35 Im Bereich der Lexik ĳinden sich einige westjiddische Kennwörter, so ‫ › ָאהרט‬betet ‹ ( Esther 32 ), ‫ › ָאהרען‬beten ‹ ( Esther 39 ) oder ‫ › מעממע‬Mutter ‹ ( Esther 58 ) ; doch tritt mit ‫טא ַאטע‬ ַ /‫טאטע‬ ַ › Vater ‹ ( Esther 49, 61 ) auch eine Form auf, die als charakteristisch für das östliche Sprachgebiet gilt. Auf den Dativ nach Präposition zur Bezeichnung der Richtung trifft man in nur wenigen Belegen bei Feminina : ‫גיהט אין דער קוך‬i( Esther 39 ) › geht in die ( wörtlich : in der ) Küche ‹ ‫נאר ניט ריין אין דער שטוב‬ ָ ‫דוי גיהט‬i( Esther 56 ) › da geht nur nicht herein in die ( wörtlich : in der ) Stube ‹ Unsicher ist der folgende Beleg zu einem Neutrum : Hier tritt eine Form auf, die historisch wohl als Akkusativ zu werten ist, doch wäre im Akkusativ Singular Neutrum nicht die Endung -en ( die nur dem Maskulinum zukommt ) zu erwarten, sondern eine Null-Endung : 34 Löwenstein 1911 : 111 f ; Süß 1984 : 17. 35 Entgegen der Transkription von Copeland & Süsskind ( 1976 ), die <‫ >וי‬dem Ostjiddischen entsprechend als <oi> transkribieren. Jürg Fleischer und Lea Schäfer : Der Kasus nach Präposition 425 ‫אין מיינען רייך‬i( 4 Esther ) › in meinem ( wörtlich : in meinen ) Reich ‹ Die folgenden Belege zeigen schließlich für zwei Plurale den historischen Akkusativ in dativischen Kontexten : ‫מיט די קינדער‬i( Esther 19 ) › mit den ( wörtlich : mit die ) Kindern ‹ ‫גזיצצען זען זיא אוף דיא דעכטער דרויבען‬i( Esther 75 ) › gesessen sind sie auf den ( wörtlich : auf die ) Dächern droben ‹ 4 . 4 Chr. H. Gilardone : Parodiee, Gedichtches unn prousaische Uffsätz ’ Die in Speyer gedruckten Parodiee, Gedichtches unn prousaische Uffsätz ’ , vun kaan Jüd – vun e Goj ’ fallen eindeutig unter den Quelltypus der christlichen Persiflage.36 Im Vorwort wird explizit Bezug genommen auf den fränkischen Autor Itzig Veitel Stern ( Pseudonym ), der mit einem bäuerlichen Antisemitismus und durch seine mit Hebraismen gespickten Texte ab den 1830er Jahren einer breiten Bevölkerungsschicht bekannt wurde und viele Nachahmer fand.37 Selbst Gustav Freytag bedient sich in seinem antisemitischen Finanzroman Soll und Haben ( 1855 ) dieser Mode, indem er die jüdische Hauptĳigur » Veitel Itzig « nennt. In eben diese Tradition ist auch diese Sammlung von Anekdoten zu stellen, auch wenn sich der antisemitische Unterton ein wenig subtiler gestaltet als bei ihrem Vorbild. Persiflagen dieser Art haben meist sehr wenig mit der tatsächlichen Sprachrealität gemeinsam. In Bezug auf die von uns untersuchten Merkmale stellen wir jedoch bei dieser Quelle eine gewisse Nähe zum Westjiddischen fest ; weitere Untersuchungen müssen erweisen, ob sich dieser Befund anhand anderer Merkmale erhärten lässt. Die Sprache zeigt unter phonologischen Gesichtspunkten typisch westjiddische Formen. Der Vokal E4 wird konsequent als /aː/ realisiert, wie z. B. in klahne / klaane › kleine ‹ ( Uffsätz ’ pass. ), Ahner › einer ‹ ( Uffsätz ’ u. a. 1 ), Raas › Reise ‹ ( Uffsätz ’ 1 ), haaß ( e ) t › heißt ‹ ( Uffsätz ’ pass. ). Auch der Vokal O4 ĳindet sich als Monophthong /aː/, z. B. aach › auch ‹ ( Uffsätz ’ pass. ), Fraa › Frau ‹ ( Uffsätz ’ 7 ), laafe › laufen ‹ ( Uffsätz ’ 14 ). Für den Vokal E2 ĳinden sich Schreibungen, die auf diphthongische Realisierung deuten, z. B. steihen › stehen ‹ ( Uffsätz ’ u. a. 7, 8, 10 ), geihn › gehen ‹ ( Uffsätz ’ u. a. 8, 12, 16 ), und das gilt auch für O2, z. B. grouße 36 Wir beziehen uns auf den zweiten Band von 1835 aus der Bayerischen Staatsbibliothek München ( Signatur : P. O. germ. 1047 m). 37 Vgl. Klepsch 2008. 426 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ › große ‹ ( Uffsätz ’ u. a. 1, 3, 7 ), sou › so ‹ ( Uffsätz ’ u. a. 3, 4 ). Die westjiddischen Kennwörter Memme › Mutter ‹ ( Uffsätz ’ u. a. 13, 15 ) und Aette › Vater ‹ ( Uffsätz ’ u. a. 15, 40, 43 ) sind sehr häuĳig anzutreffen ; dagegen werden Hebraismen nur sehr beschränkt verwendet. Der Text zeigt sehr viele Belege für den historischen Dativ nach Präposition zur Angabe der Richtung, von denen wir nur eine Auswahl wiedergeben können. Der Dativ ĳindet sich in allen drei Genera : Werdt, [ ... ] E Karfunkelgesicht, sich in em verliebe ? ( Uffsätz ’ 22 ) › wird [ ... ] ein Karfunkelgesicht sich in ihn ( wörtlich : in ihm ) verlieben ? ‹ Drum worft er sich hortigk énein in dem Wage ( Uffsätz ’ 69 ) › Darum wirft er sich hurtig hinein in den ( wörtlich : in dem ) Wagen ‹ ’ S kimmt Kaaner meih im Land ’érein ( Uffsätz ’ 50 ) › Es kommt keiner mehr in das ( wörtlich : im, in dem ) Land herein ‹ den mer uff der Schlachtbank führt ( Uffsätz ’ 11 ) › den man auf die ( wörtlich : auf der ) Schlachtbank führt ‹ Unn aß die Andre reite in der Schlacht ( Uffsätz ’ 20 ) › und wenn die anderen reiten in die ( wörtlich : in der ) Schlacht ‹ Im Plural tritt jedoch immer der historische Akkusativ auf : Sein Kindche lieb vor die Gefahre bewacht ( Uffsätz ’ 59 ) › Sein lieb Kindchen vor den ( wörtlich : vor die ) Gefahren bewacht ‹ vun die Fisch neihmlikg ( Uffsätz ’ 3 ) › von den ( wörtlich : von die ) Fischen nämlich ‹ Aß es sich hält uff die Baan ( Uffsätz ’ 42 ) › wenn es sich auf den ( wörtlich : auf die ) Beinen hält ‹ 4 . 5 G. Emmerich : Der Judenball im Wäldchen Die » Lokalposse« Der Judenball im Wäldchen von G. Emmerich erschien in mindestens fünf Auflagen ; die erste von uns nachgewiesene ist die dritte Auflage von 1865, die fünfte, uns vorliegende, stammt aus dem Jahr 1926. Über den Autor konnten wir wenig in Erfahrung bringen ; gedruckt wurde das Stück in Friedberg ( Hessen ). Friedberg selbst taucht als Bezugsort im Text auf ( Judenball 13 ), damit ist das Stück im mittelhessischen Kontext anzusiedeln. Jürg Fleischer und Lea Schäfer : Der Kasus nach Präposition 427 Der Judenball im Wäldchen zeigt in Bezug auf die Phonologie westjiddische Merkmale : E4 erscheint in vielen Fällen, wie man dies für das Westjiddische erwartet, als /aː/, etwa in Bahner › Beine ‹ ( Judenball 7 ), und auch O4 ĳindet sich konsequent als /aː/ umgesetzt, z. B. aach › auch ‹ ( 18 ). Bei Vokal E2 treten Graphien auf, die auf eine Diphthongierung deuten, etwa gaih › gehe ‹ ( Judenball 3 ), gäihts › geht ’ s ‹ ( Judenball 17 ), schäine › schöne ‹ ( Judenball 6 ). Ebenso verhält es sich mit Vokal O2, welcher häuĳig diphthongische Realisierungen aufweist, z. B. in aube › oben ‹ ( Judenball 6, 8 ), unwauhle › unwohl ‹ ( Judenball 9 ). Lexikalisch ist das Stück als westjiddisch gekennzeichnet durch die Kennwörter Ette › Vater ‹ ( Judenball 3, 27, 29 ) und Memme › Mutter ‹ ( Judenball 5 ). In Der Judenball im Wäldchen ĳinden sich mehrere Beispiele für Dativ nach Präposition in akkusativischen Kontexten. Die folgenden Belege zeigen dies für das Maskulinum, Neutrum und Femininum : Verloß Dich net auf dem Gewinne ( Judenball 14 ) › verlass dich nicht auf den ( wörtlich : auf dem ) Gewinn ‹ ich gaih nit wieder in dem Gebusch ( Judenball 3 ) › ich gehe nicht wieder ins ( wörtl. : in dem ) Gebüsch ‹ ich danke vor der Ehr ( Judenball 16 ) › ich danke für die ( wörtlich : für der ) Ehre ‹ Nu, aß De gaihst auf Sunntag über der Straß ( Judenball 26 ) › nun, wenn du am Sonntag über die ( wörtlich : über der ) Straße gehst ‹ Im Plural tritt dagegen der historische Akkusativ auf : und pample mit die Bahner ( Judenball 7 ) › und baumeln mit den Beinen ‹ Von die Geschäfte ( Judenball 29 ) › von den Geschäften ‹ 4 . 6 Carl Wilhelm Friedrich : Unterricht in der Judensprache und Schrift Carl Willhelm Friedrichs Lehrbuch der » Judensprache und Schrift zum Gebrauch für Gelehrte und Ungelehrte« wurde 1784 in Prenzlau veröffentlicht.38 Der Autor selbst war ( laut Titelblatt ) » öffentlicher Lehrer der französischen Sprache beym Prenßlowischen Lyceo«. Die Inten38 Der Text ist u. a. zugänglich über die digitale Freimann-Sammlung der Universitätsbibliothek der Goethe-Universität Frankfurt a. M. ( Signatur : Jud. 7449 ). 428 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ tion seiner Arbeit liegt darin, die Sprache der jüdischen Bevölkerung für ein christliches Publikum verständlich zu machen ( vgl. Vorrede ). Obwohl er kein Muttersprachler war, können der Einschätzung von Katz zufolge seine Jiddischkenntnisse als gut eingeschätzt werden.39 Für Max Weinreich ist Friedrich » der erste jiddische Mundartenforscher«.40 Wir ĳinden westjiddische neben standarddeutschen Formen : Für E4 tritt meist dem Standarddeutschen entsprechendes <ei> auf : eigentlich ( Friedrich 334 ), weiß ( Friedrich 334 ) oder geheißen ( Friedrich 335 ). Für O4 deuten die Graphien dagegen auf das westjiddische /aː/, z. B. Frah › Frau ‹ ( Friedrich 336, 349 ), aach › auch ‹ ( Friedrich 338, 339, 348 ). Vokal E2 zeigt diphthongische Realisierungen, z. B. in gein › gehen ‹ ( Friedrich 337, 338, 343 ). Vokal O2 weist bei Friedrich diphthongische Schreibungen auf, z. B. waul › wohl ‹ ( Friedrich 334, 340, 341 ), schaun › schon ‹ ( Friedrich 333, 336, 339 ), graussen › großen ‹ ( 334, 336, 342 ). Im grammatischen Teil von Friedrichs Werk ĳinden sich wenige Hinweise zur Kasusverwendung : » Hauptsächlich wird der Akkusativ für den Dativ gesetzet, z. B. Gib dieses Geld dem Vater, Geb does Gelt den Tâte « ( Friedrich 53 – 54 ).41 Es scheint also, als ob hier ( zumindest im Maskulinum, auf das sich Friedrichs Beispiele beschränken ) Dativ und Akkusativ generell zusammengefallen sind, wobei sich die Akkusativ-Form durchgesetzt hat. Friedrich bietet neben dem ( umfassenden ) lexikalischen Teil und den grammatischen Bemerkungen auch » einige Gespräche zur Uebung in der Judensprache« ( Friedrich 333 – 354 ), aus denen manche der im Folgenden zitierten Beispiele stammen. Im Maskulinum ĳindet sich nach Präposition in dativischen Kontexten, wie es auch Friedrichs Angabe entspricht, der historische Akkusativ. Dies zeigen die folgenden Belege : Der Vetter vun der kale bey welchen sie in Haus is ( Friedrich 335 ) › Der Vetter von der Braut, bei welchem ( wörtlich : bei welchen ) sie im Haus ist ‹ das me uf den Marek e Groschen boer Gelt in die Händ kriegen soll ( Friedrich 342 ) › daß man auf dem ( wörtlich : auf den ) Markt einen Groschen bares Geld in die Hände kriegen soll ‹ Bei Feminina tritt in dativischen Kontexten ebenfalls der historische Akkusativ auf, wie etwa der folgende Beleg veranschaulicht ( dass daneben auch der historische Dativ auftreten kann, zeigt das bereits im ersten Beleg angeführte vun der kale › von der Braut ‹ ) : 39 Katz 1983 : 1028, ausführlicher in 1988 : 43 – 52. 40 Weinreich 1923 : 188 = ed. Frakes 1993 : 195. Vgl. Katz 1988 : 43. 41 Hervorhebung im Original durch Fettsatz. Jürg Fleischer und Lea Schäfer : Der Kasus nach Präposition 429 Ich hob does vun die Mame ( Meme ) gekriegen. ( Friedrich 54 ) › Ich habe das von der ( wörtlich : von die ) Mutter bekommen ‹ 4 . 7 Mausche Worscht : Koppelche und Liebetche Koppelche und Liebetche, Schauspiel in 5 Akten. Nooch Schillerche sein Kabale und Liebe verarbeitet von Mausche Worscht, Verfasser des Lied ’ s vum Lockschen erschien 1854 bei Berendsohn in Hamburg.42 Wie der Titel schon zu erkennen gibt, reiht es sich ein in die ab der Mitte des 19. Jahrhunderts in Mode gekommenen Schiller-Parodien.43 Der Autor, dessen Name unzweifelhaft ein Pseudonym darstellt, veröffentlichte bereits 1853 ( ebenfalls bei Berendsohn in Hamburg ) eine Parodie » in jüdisch-deitschem Dialekt« auf Schillers » Lied von der Glocke «.44 Im Theaterstück treten Jiddisch sprechende Figuren neben sich der deutschen Standardsprache bedienenden auf. Es sind die Eltern der Schillerschen Luise Miller ( bei Worscht Liebetche Möller ) sowie die Nebenĳigur Oren Worm, die Jiddisch sprechen. Liebetche selbst wechselt je nach Gegenüber die Varietät. Wir ĳinden E4 als /aː/, z. B. in aaner › einer ‹ ( Koppelche 3 ), waaß › ich weiß ‹ ( Koppelche 4, 27 ), und auch O4 tritt als /aː/ auf, z. B. geglaabt › geglaubt ‹ ( Koppelche 6, 19 ), laaft › läuft ‹ ( Koppelche 6 ), aach › auch ‹ ( Koppelche 27 ). E2 zeigt Schreibungen, die auf eine diphthongische Realisierung deuten, z. B. geiht › geht ‹ ( Koppelche 6, 19, 23 ), aweih › oh weh ‹ ( Koppelche 28, 30 ), und dies gilt auch für O2, z. B. grauß( en ) › groß( en ) ‹ ( Koppelche 3, 7, 29 ), schaun › schon ‹ ( Koppelche 27 ), sau › so ‹ ( Koppelche 28 ). Lexikalisch ĳinden wir die westjiddischen Formen oren › beten ‹ ( 5, 7 ), Ette › Vater ‹ ( Koppelche 6, 17, 18, 21, 31 ) und Memme › Mutter ‹ ( Koppelche 18, 21 ). In der Figurenrede des Oren Worm tritt jedoch auch die östliche Form Tateleben › Vaterleben ‹ ( Koppelche 20 ) auf. Der Dativ zur Angabe der Richtung ist nicht belegt. Dagegen ĳindet sich der Akkusativ in dativischen Kontexten, wie die folgenden Belege für das Maskulinum und Neutrum veranschaulichen : Das is de Schuld von den Schaute vun Ferdinand ( Koppelche 22 ) › Das ist die Schuld von dem ( wörtlich : von den ) Narren ( von ) Ferdinand ‹ Was steh ich mit das Kind aus ( Koppelche 27 ) › Was steh ich mit dem ( wörtlich : mit das ) Kind aus ‹ 42 Wir zitieren die Erstausgabe nach einem Exemplar der Library of Princeton University ( Signatur : ReCAP 3499.024.35 ). 43 Vgl. Horch 2006 zur Schiller-Mode im jüdischen Bürgertum des 19. Jahrhunderts. 44 Freimark 1983 : 193 – 208. 430 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ 4 . 8 Aron Hirsch Heymann : Lebenserinnerungen Die Autobiographie des 1803 in Strausberg ( 40 km östlich von Berlin-Mitte ) geborenen und 1880 in Berlin gestorbenen Kaufmanns Aron Hirsch Heymann ist von besonderem linguistischen Wert auf Grund der direkten Figurenrede, die darin vorkommt.45 In dieser Figurenrede sprechen v.a. die Personen aus den Kindheitserinnerungen Heymanns in ihrer eigenen Varietät, abhängig von ihrer Herkunft.46 So ĳinden wir in dem Text jiddische Varietäten aus Westpolen, Norddeutschland, Schlesien und sogar aus der Mitte und dem Süden Deutschlands. Ein Großteil der Figuren stammt jedoch aus dem Ort Strausberg und seiner näheren Umgebung. Die Figuren des Nordwestjiddischen, wie auch die des nördlichen und südlichen Übergangsjiddisch, zeigen die Monophthongierung von E4 zu /aː/, z. B. waaß › ich weiß ‹ ( Heymann 6, 15, 22, 23 ), Saaf › Seife ‹ ( Heymann 44, 232 ), kaan( e ) › kein( e ) ‹ ( Heymann u. a. 14, 19, 22 ). Auch für O4 tritt /aː/ auf, z. B. aach › auch ‹ ( Heymann u. a. 6, 22, 23 ), Frah › Frau ‹ ( Heymann u. a. 5, 15, 35 ), glaab › glaube ‹ ( Heymann u. a. 15, 23, 28 ). Die Entwicklung von E2 zu einem Diphthong zeigen Schreibungen wie z. B. weih › weh ‹ ( Heymann 92, 324 ), Reid › Rede ‹ ( Heymann 24, 35 ) oder geit › geht ‹ ( Heymann 28, 248 ). Auch bei O2 treten diphthongische Schreibungen auf, z. B. schaun › schon ‹ ( Heymann u. a. 6, 14, 15 ), waul › wohl ‹ ( 27, 52 ). Figuren, deren Muttersprache aufgrund der im Text gemachten Angaben zu ihrer Herkunft eine ostjiddische Varietät sein müsste, zeigen im Gegensatz dazu keine westjiddischen Charakteristika.47 Westjiddische Kennwörter treten nicht auf ; an ihrer Stelle ĳindet sich immer das östliche Äquivalent.48 Im Bereich des Kasus nach Präposition konnten Daten zu den Varietäten Nordwestjiddisch und nördliches Übergangsjiddisch gewonnen werden. Für beide Varietäten lässt sich kein Beleg für den Dativ in lokal-direktionaler Semantik ĳinden. Stattdessen steht konsequent der historische Akkusativ. Allerdings sind für das Nordwestjiddische nur Feminina belegt : er sitzt obben uf die Lein ( Heymann 19 ) › er sitzt oben auf der ( wörtlich : auf die ) Leine ‹ gekaaft in Berlin uf die Meß ( Heymann 57 ) › gekauft in Berlin auf der ( wörtlich : auf die ) Messe ‹ 45 Die Biographie ist online zugänglich über die Freimann-Sammlung der Universitätsbibliothek der Goethe-Universität Frankfurt a. M. ( Signatur : Jud. 1644 ). 46 Vgl. Schäfer im Ersch. 47 Ibid. 48 Ibid. Jürg Fleischer und Lea Schäfer : Der Kasus nach Präposition 431 denn es steiht in die Tauroh geschribben ( Heymann 14 ) › denn es steht in der ( wörtlich : in die ) Thora geschrieben ‹ Im nördlichen Übergangsjiddisch hingegen ĳindet sich der Akkusativ sowohl bei Maskulina als auch bei Feminina : un is gestanden for den Jüd ( Heymann 64 ) › und ist gestanden vor dem ( wörtlich : vor den ) Juden ‹ alleweil sitzen mer obber unter den Torweg ! ( Heymann 35 ) › alleweil sitzen wir aber unter dem ( wörtlich : unter den ) Torweg ! ‹ 5. Zusammenfassung und Diskussion Die folgende Tabelle fasst die Befunde zu den einzelnen Textauswertungen zusammen. Dabei steht » Dat.« für » historischer Dativ in akkusativischen Kontexten«, » Akk.« dagegen für » historischer Akkusativ in dativischen Kontexten« ; ist eine Zelle mit » – « gefüllt, bedeutet dies, dass keine Belege vorhanden sind. Maskulinum Neutrum Femininum Plural Leichtsinn – – Dat. ; Akk. – Grobsdorf Dat. – Dat. Akk. Esther – ( Akk. ) Dat. Akk. Uffsätz ’ Dat. Dat. Dat. Akk. Judenball Dat. Dat. Dat. Akk. Friedrich Akk. – Akk. – Koppelche Akk. Akk. – – Heymann Akk. – Akk. – Im Maskulinum ĳinden sich Belege für das Auftreten des Dativs in akkusativischen Kontexten in den zentralwestjiddischen Quellen Grobsdorf, Uffsätz ’ , Judenball, dort allerdings mit nur einem Beleg, gegenüber welchem der Akkusativ bedeutend häuĳiger ist ; Belege für den Akkusativ in dativischen Kontexten treten dagegen in den nordwestjiddischen Quellen Friedrich, Koppelche und Heymann auf. Für das Neutrum, das insgesamt seltener belegt ist, ĳinden sich Belege für den Dativ in den 432 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ zentralwestjiddischen Quellen Uffsätz ’ und Judenball, Belege für den Akkusativ – vom unsicheren Beleg in Esther abgesehen – nur im nordwestjiddischen Koppelche. Im Femininum treten Belege für den Dativ in akkusativischen Kontexten in allen Quellen für das Zentralwestjiddische auf, Belege für den Akkusativ in dativischen Kontexten ĳinden sich in Leichtsinn und Frömmelei, Friedrich und Heymann. Im Plural schließlich tritt, wo dieser überhaupt belegt ist, nur der historische Akkusativ auf. Damit kann zunächst einmal festgehalten werden, dass im Plural generell der Akkusativ verallgemeinert wurde ; ansonsten gehen die Quellen für das Zentralwestjiddische eher in die Richtung, den historischen Dativ auch in akkusativischen Kontexten zu verwenden, wogegen die Quellen für das Nordwestjiddische eher den Akkusativ auch in dativischen Kontexten aufweisen. Dass sich in Leichtsinn und Frömmelei im Femininum beide Muster ĳinden, passt zur Tatsache, dass diese Quelle sowohl im zentralwestjiddischen als auch im nordwestjiddischen Gebiet lokalisiert werden könnte. Dass sich der historische Akkusativ im Nordwestjiddischen und nördlichen Übergangsjiddischen noch weiter nach Osten bis ins ostjiddische Gebiet hinein fortsetzt, belegt die Untersuchung von Herzog zum Jiddischen in Nordpolen,49 aus der hervorgeht, dass im Westen seines Untersuchungsgebietes im Femininum nach Präposition die historische Akkusativform auftritt : es heißt dort mit di alte bobe( n ),50 wogegen weiter östlich ( und im Standard ) mit historischem Dativ die Form mit der alter bobe( n ) auftritt. Das Zentralwestjiddische und das Nordwestjiddische zeigen zwar unterschiedliche Muster in Bezug auf die Verallgemeinerung eines bestimmten Kasus nach Präposition, doch ĳinden sich in allen ausgewerteten Quellen Belege, die darauf hindeuten, dass die Distinktion zwischen akkusativischen und dativischen Kontexten nach Präposition aufgegeben worden ist. Dies verhält sich offensichtlich im Westjiddischen ähnlich wie im Ostjiddischen. Bei der fehlenden Kasusdistinktion nach Präposition scheint es sich also um ein panjiddisches morphosyntaktisch-semantisches Merkmal zu handeln. Dabei scheint eine Eigenschaft vorzuliegen, die das Jiddische insgesamt vom Hochdeutschen trennt und somit für eine genuin jiddische Eigenentwicklung spricht ( die Ähnlichkeit mit dem Niederdeutschen ist insofern nur oberflächlich, als dort ein genereller Abbau der Distinktion von Akkusativ und Dativ vorliegt, wovon zumindest im Zentralwestjiddischen nicht die Rede sein kann ). Vorerst offen bleiben müssen allerdings die Fragen nach dem konkreten Alter und der Entstehung der hier untersuchten morphosyntaktisch-semantischen Eigenschaft des Jiddischen. 49 Herzog 1965. 50 Vgl. Herzog 1965 : 132, mit 130 [ Karte 4:42 ]. Jürg Fleischer und Lea Schäfer : Der Kasus nach Präposition 433 Primärtexte Esther : Joseph Herz : ‫פאזזע אין יער‬ ָ ‫ איינע‬/ ‫בעלאהנטע טוגענד‬ ָ ‫ ָאדער דיע‬.‫אסתר‬ ‫נאך ני&ט געדרוקקטען געדי&טען‬ ָ ‫ [ ַאבשניטטען נעבזט אייניגען‬Esther. Oder die belohnte Tugend – Eine Posse in vier Abschnitten nebst einigen noch nicht gedruckten Gedichten. Zweite unveränderte Ausgabe ]. Fürth 1854 : S. B. Gusdorfer. Faksimile in : Copeland & Süsskind ( 1976 ). [ Die Erstausgabe von 1828 ist in einem Faksimile verfügbar in : Süß, Hermann ( 1984, 1985, 1986 ) : » Die Fürther Megille«. In : Israelitische Kultusgemeinde Fürth, Hg. : Nachrichten für den jüdischen Bürger Fürths, September 1984, 13 – 17 / September 1985, 9 – 12 / September 1986, 16 – 19 ]. Friedrich : Carl Wilhelm Friedrich : Unterricht in der Judensprache und Schrift. Zum Gebrauch für Gelehrte und Ungelehrte. Prenzlau 1784 : Chr. Gottf. Ragoczy. [ Digitalisiert durch die Universitätsbibliothek Frankfurt a. M. http ://sammlungen.ub.uni-frankfurt.de/freimann/content/ titleinfo/324, letzter Zugriff 28. 02. 2012 ]. ָ ‫גרא‬ ָ ‫האכצייט צו‬ ָ ‫דיע‬ Grobsdorf : A. L. Rosenthal : ‫ איין לוסטשפיעל אין‬/ ‫בסדארף‬ ‫ [ פיער אויציגען‬Die Hochzeit zu Grobsdorf – Ein Lustspiel in vier Aufzügen ]. Manuskript o. O. 1822. yivo, M. Weinreich Collection, rg584, folder 10. Heymann : Aron Hirsch Heymann : Lebenserinnerungen. Nach seiner Niederschrift im Auftrage seiner Kinder herausgegeben von Heinrich Loewe. Berlin 1909 : Poppelauer. [ Digitalisiert durch die Universitätsbibliothek Frankfurt a. M. http ://sammlungen.ub.uni-frankfurt.de/ freimann/content/titleinfo/1145596, letzter Zugriff 28. 02. 2012 ]. Judenball : G. Emmerich : Der Judenball im Wäldchen. Kleine Lokalposse in vier Abteilungen. Fünfte Auflage. Friedberg ( Hessen ) 1926 : C. Scriba ’ s Buchhandlung. [ Dritte Auflage von 1865 im Eigenverlag erschienen ]. Koppelche : Mausche Worscht ( Pseud. ) : Koppelche und Liebetche, Schauspiel in 5 Akten. Nooch Schillerche sein Kabale und Liebe verarbeitet von Mausche Worscht, Verfasser des Lied ’ s vum Lockschen. Hamburg 1854 : Berendsohn [ Digitalisat der Library of Princeton University http:// books.google.de/books/about/Koppelche_und_Liebetche_Schauspiel_ in_5.html?id=OpguAAAAYAAJ&redir_esc=y, letzter Zugriff 28.02.2012 ]. Leichtsinn : Aaron (Halle-)Wolfssohn : ‫ איין אמיליען‬/ ‫לייכטזין אונד רעממעלייא‬ ‫ [ געמעלדע אין דרייא אויציגן‬Leichtsinn und Frömmelei – Ein Familiengemälde in drei Aufzügen ]. Breslau 1795 / 1796. [ Digitalisiert durch die Universitätsbibliothek Frankfurt a. M. http ://sammlungen.ub.unifrankfurt.de/jd/content/titleinfo/1755077, letzter Zugriff 28. 02. 2012 ] Uffsätz ’ : Chr. H. Gilardone : Parodiee, Gedichtches unn prousaische Uffsätz ’, vun kaan Jüd – vun e Goj ’ . Speyer 1835 : F. C. Neidhard. [ Digitalisat der 434 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Bayerischen Staatsbibliothek Sig. P.O.germ. 1047m, http ://books.google.de/books ?id=E-E6AAAAcAAJ&printsec=frontcover&dq=gilardone &hl=de&sa=X&ei=ILRMT4f-K5O7hAfBv4UB&ved=0CEIQ6AEwAg#v =onepage&q&f=false, letzter Zugriff 28. 02. 2012 ] Wissenschaftliche Literatur Aptroot, Marion und Gruschka, Roland, 2010 : Jiddisch. Geschichte und Kultur einer Weltsprache. München : C. H. Beck. Baum-Sheridan, Jutta, 1996 : Studien zu den westjiddischen Estherdichtungen. ( jidische schtudies 5. ) Hamburg : Buske. Birnbaum, Salomo A., 1918 : Praktische Grammatik der Jiddischen Sprache für den Selbstunterricht. Wien – Leipzig : Hartleben. Copeland, Robert M. und Süsskind, Nathan, 1976 : The Language of Herz ’ s Esther : A Study in Judeo-German Dialectology. Alabama : University of Alabama Press. Duden Grammatik, 2009 : Die Grammatik, 8. neu bearbeitete und erweiterte Auflage. Mannheim – Leipzig – Wien – Zürich : Dudenverlag. Fal ’ kovič, Ė. M., 1966 : » Evrejskij jazyk ( idiš ).« In : Viktor V. Vinogradov, Hg., Jazyki narodov SSSR. 5 Bde. Bd. 1 : Indoevropejskie jazyki. Moskau : Nauka, 599 – 629. – 1984 : » O jazyke idiš«. In : M. A. Šapiro, I. G. Spivak und M. Ja. Šul ’ man, Hg. : Russko-evrejskij ( idiš ) slovar ’ : 666 – 720. Moskau : Russkij jazyk. Fleischer, Jürg, 2004 : » Wie alemannisch ist Surbtaler Jiddisch ? Hochalemannische Züge in einem westjiddischen Dialekt«. In : Elvira Glaser, Peter Ott und Rudolf Schwarzenbach, Hg. : Alemannisch im Sprachvergleich ( Zeitschrift für Dialektologie und Linguistik Beihefte 129 ). Stuttgart – Wiesbaden : Steiner, 123 – 140. – 2005 : Surbtaler und Hegauer Jiddisch. Tonaufnahmen und Texte zum Westjiddischen in der Schweiz und Südwestdeutschland. ( Beihefte zum Language and Culture Atlas of Ashkenazic Jewry 4. ) Tübingen : Niemeyer. Freimark, Peter, 1983 : » Kuggel und Lockschen in Hamburg. Ein Beitrag zur jüdischen Schiller-Rezeption im 19. Jahrhundert.« In : Peter Freimark, Ina Lorenz und Günter Marwedel, Hg. : Judentore, Kuggel, Steuerkonten. Untersuchungen zur Geschichte der deutschen Juden, vornehmlich im Hamburger Raum. Hamburg : Hans Christian Verlag, 169 – 220. Fürst, Julius, 1863 : Bibliotheca Judaica. Bibliographisches Handbuch, umfassend die Druckwerke der jüdischen Literatur einschliesslich der über Juden und Judenthum veröffentlichten Schriften ; nach alphabetischer Ordnung der Verfasser bearbeitet ; mit einer Geschichte der jüdischen Bibliographie sowie mit Indices, Bd. 8. ( N – Z ). Leipzig : Engelmann. Jürg Fleischer und Lea Schäfer : Der Kasus nach Präposition 435 Guggenheim-Grünberg, Florence, 1966 : Surbtaler Jiddisch. ( Schweizer Dialekte in Text und Ton I, Deutsche Schweiz 4. ) Frauenfeld : Huber. Horch, Hans Otto, 2006 : » Friedrich Schiller, die Juden und das Judentum«. In : Aschkenas 16 : 17 – 36. Jacobs, Neil G., Prince, Ellen F. und Auwera, Johan van der, 1994 : » Yiddish. « In : Ekkehard König und Johan van der Auwera, Hg. : The Germanic Languages. London – New York : Routledge, 388 – 419. Katz, Dovid, 1983 : » Zur Dialektologie des Jiddischen «. In : Werner Besch, Ulrich Knoop, Wolfgang Putschke und Herbert Ernst Wiegand, Hg. : Dialektologie. Ein Handbuch zur deutschen und allgemeinen Dialektforschung. ( Handbücher zur Sprach- und Kommunikationswissenschaft 1.2. ) Berlin : de Gruyter, 1018 – 1041. – 1988 : » Origins of Yiddish dialectology «. In : Dovid Katz, Hg. : Dialects of the Yiddish language. ( Winter studies in Yiddish, 2 / Language & Communication 8. ) Oxford : Pergamon Press, 39 – 55. Klepsch, Alfred, 2008 : » Jüdische Mundartdichtung von Nichtjuden in Franken. Das Rätsel des Itzig Feitel Stern.« In : Jahrbuch für fränkische Landesforschung 68 : 169 – 202. lcaaj : The Language and Culture Atlas of Ashkenazic Jewry. Prepared and published under the aegis of an editorial collegium : Marvin Herzog ( editor-in-chief ), Vera Baviskar, Ulrike Kiefer, Robert Neumann, Wolfgang Putschke, Andrew Sunshine and Uriel Weinreich. New York – Tübingen 1992 – : yivo / Niemeyer. Lowenstein, Steven, 1969 : » Results of Atlas Investigations Among Jews of Germany « In : Marvin I. Herzog, Wita Ravid und Uriel Weinreich, Hg. : The Field of Yiddis, Bd. 3. Bloomington – Den Haag, 16 – 35. – 1975 : » A mayrev-yidishe pyese fun onheyb 19tn y ” h. « In : yivo-bleter 45 : 57 – 84. – 1979 : » The Yiddish Written Word in Nineteenth Century Germany «. In : Leo Baeck Institute Yearbook 24 : 179 – 192. Mark, Yudl, 1978 : Gramatik fun der yidisher klal-shprakh. New York : Alveltlekher yidisher kultur-kongres. Och, Gunnar und Strauss, Jutta, 1995 : Aaron Halle-Wolfssohn. Leichtsinn und Frömmelei. Ein Familiengemälde in drei Aufzügen. Transkribierter Neudruck der in hebräischen Lettern gesetzten Ausgabe von Breslau 1796. Mit einem Nachwort herausgegeben von Gunnar Och und Jutta Strauss. St. Ingbert : Röhrig. Schäfer, Lea, im Ersch. : » Jiddische Varietäten im Berlin des 19. Jahrhunderts : Die › Lebenserinnerungen ‹ Aron Hirsch Heymanns.« Erscheint in : Aschkenas. Shrier, Martha, 1965 : » Case systems in German dialects. « In : Language 41 : 420 – 438. 436 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Süss, Hermann, 1984 : » Die Fürther Megille.« In : Nachrichten für den jüdischen Bürger Fürths, September 1984 : 13 – 17. Weinreich, Max ( 1923 ) : Geschichte und gegenwärtiger Stand der jiddischen Sprachforschung. Dissertation Universität Marburg. [ Unter dem Titel » Geschichte der jiddischen Sprachforschung« herausgegeben von Jerold C. Frakes ( 1993 ), ( South Florida Studies in the History of Judaism 27. ) Atlanta : Scholars Press ] Weinreich, Max, [ 1953 ] 1958 : » Roshe-prokim vegn mayrevdikn yidish. « In : Mark, Yudl, Hg. : Yuda A. Yofe-bukh. New York : yivo, 158 – 194 [ Ursprünglich publiziert 1953 in : Yidishe shprakh 13 : 35 – 69, 1958 mit Appendix versehen. ] Zaretski, Ayzik, 1929 : Yidishe gramatik. Nay-ibergearbete oysgabe. Wilna : Kletskin. Alexander Beider Eastern Yiddish Toponyms of German Origin 1. Introduction Little is known about the earliest stages of the development of Yiddish in Eastern Europe. Early sources written by local Jews in their vernacular German-based language are rare. Prior to the sixteenth century, only one short text is available. It comes from Silesia and dates from 1436.1 A few documents have survived from the sixteenth century. In this situation, an analysis based on indirect information can be of great help. Onomastics provides one of the most powerful tools in this domain. The historical and philological analysis of given names used by Jews of Eastern Europe can be found in Beider 2001. It is also not surprising that several linguists addressed Yiddish toponyms in order to shed more light on the development of Eastern Yiddish ( ey ). The article by Beranek ( 1951 ) represents the ĳirst serious attempt to study Jewish place names in Slavic countries. It provides an appropriate analysis of various processes internal to Jewish communities. Beranek also states2 that if several languages were used by the Christian majority and German was one of them, Yiddish mainly took toponyms from German. Among his examples are : Pru :k ‘ Prague ’ < Prag, Oüvm < Ofen, Dants ( k ) < Danzig, Lemberik < Lemberg, compare Czech Praha, Hungarian Buda, Polish Gdańsk, and Lwów ( Ukrainian L ’viv, Russian L ’vov ), respectively. For several unusual Yiddish toponyms from western Galicia, Beranek reconstructs hypothetical German forms that, according to him, may represent the etymons for these toponyms : Brigl < *Briegel ( Polish Brzesko ), Rayshe < *Reschau ( Polish Rzeszów ).3 The most detailed study on ey toponyms was written by Stankiewicz ( 1965 ). His work deals only with the territory that during the interwar period belonged to Poland. The author collected a comprehensive list of Yiddish toponyms and proceeded to make the ĳirst systematic analysis of their phonology, with special chapters dealing with their stress patterns, vocalism, and consonantism. Stankiewicz addresses the 1 2 3 See Frakes 2004 : 64 – 67. Beranek 1951 : 91. Ibid. : 99. 438 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ question of the possibility of the German etymons. Among names that, according to him,4 are clearly of German origin are : Lise < Lissa, Zamter < Samter, Lesle < Junges Leslau, Altlesle < Leslau, Pa :zer < Peisern, Zaybish < Saibusch, Apt < Abt, Lemberik < Lemberg, Rayshe < Reichshof ( Polish equivalents are Leszno, Szamotuły, Inowrocław, Włocławek, Pyzdry, Żywiec, Opatów, Lwów, and Rzeszów, respectively ; note that for the last toponym in this list his etymology is different from that suggested by Beranek ). Stankiewicz also notes 5 that the city names Poyzn and Varshe may represent the Yiddish development of ( more likely ) German Posen and Warschau, or ( less likely ) of Polish Poznań and Warszawa. He correctly emphasizes that to suggest the most adequate etymological analysis, ideally one should trace the history of each Yiddish place name and of its Slavic and German equivalents. However, he is rather skeptical about this possibility because of the paucity of the historical studies of toponyms in all these cultures. Many pages of Weinreich ’s posthumous opus magnum ( 1973 ) deal with Yiddish toponyms. Basically, he agrees with Stankiewicz. Weinreich tries to complement the analysis of his predecessor by adding more details concerning certain particular toponyms from Poland and covering the place names from the Ukrainian and Belarusian territories that during the interwar period were part of the USSR. He also addresses the question of the possibility for Yiddish toponyms to have German rather than Slavic etymons. Here his approach is opposite to that of Beranek. Weinreich is more than skeptical about the idea that the Yiddish toponyms are patterned after the German ones, and more generally about the theory that ey is closely linked to the medieval German colonial language in Poland.6 To counter these ideas, Weinreich stresses that, contrary to Jews, Germans in Poland do not have the shifts / a / > / u / ( as in Yiddish Kruke, compare German Krakau ) and / u / >/ i / ( as in Kitne < Kutno ),7 or reduced syllables as in Varshe ( compare German Warschau ). Conversely, Yiddish has no analogue to a number of German names, such as Salzberg for Bochnia and Großsalz for Wieliczka. Weinreich criticizes Stankiewicz ’s hypothesis about the provenance of Apt, the Yiddish name for Opatów, from German Abt.8 He says that no German document is found that would demonstrate the existence 4 Stankiewicz 1965 : 179. 5 Ibid. : 159. 6 Weinreich 1973 ( iv ) : 260. 7 This argument is anachronistic. The fronting / u / > / i / took place in Central Yiddish well after the end of the Middle Ages. 8 Weinreich 1973 ( iv ) : 292. Alexander Beider : Eastern Yiddish Toponyms of German Origin 439 of this German toponym. He suggests an alternative hypothesis : Jews coming from Western Europe to Poland created the name by making a calque from Polish opat ‘ Abbot ’ to their vernacular language, compare Middle High German ( mhd ) apt / abt, New High German ( nhg ) Abt. Weinreich ĳinds “ absolutely untenable ” the idea expressed by the historian R. Mahler, who considers that if a Yiddish toponym is similar to the German one, this means that Jews lived in the place at least from the sixteenth century, because at that time there was still the German stamp on Polish cities.9 Weinreich stresses that among the hundreds of Jewish settlements in Poland there are many for which there is no evidence that there had ever been German colonists. He mentions a German map for Eastern Europe compiled in 1907, where numerous town names have no German cognates among those for which Yiddish names are special. According to Weinreich, “ in some places where Germans lived together with Jews for a time, the Jews could have been the ĳirst arrivals ; since it was easier for recently arrived Germans to communicate with Jews than with Poles, it would have been natural that in some instances they adopted the name of a new settlement from the Jews. ” Globally speaking, Weinreich ’s approach puts particular emphasis on linguistic innovations internal to Jewish communities. As a result, he often suggests similarities between German and Yiddish to be due to parallel independent developments. As can be seen from the sentence quoted above, sometimes he even comes to a totally unusual hypothesis that reverses the direction of influences in comparison to the most common point of view. An adequate critical evaluation of the above opinions is impossible without an analysis of oldest available documents dealing with the presence of Germans in Poland. The aim of this paper is to use these sources in order to see how they can shed light on the history of the early development of ey.10 2. Germans in Medieval Poland In Kraków and Sandomierz, the main cities of medieval Lesser Poland, the ĳirst known German colonists arrived during the ĳirst part of the thirteenth century, mainly from Silesia. In Kraków, the capital city and 9 Ibid. : 282. 10 In this paper, contemporary Yiddish toponyms are mainly taken from Stankiewicz 1965 and Weinreich 1973. In ambiguous cases and for places for which no information was found in the two sources in question, the lists of Yiddish toponyms compiled by the yivo Institute for Jewish Research ( New York ; www.yivo.org/uploads/ĳiles/topo.htm ) were consulted. 440 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ the most populous locality of the country, their proportion grew particularly rapidly.11 For the whole ĳifteenth century, persons having typical German given names and / or surnames represented a large majority in the city. During the fourteenth to ĳifteenth centuries, the role of Germans was also important in many other towns of Lesser Poland. This was true for the largest places, such as Nowy Sącz, Stary Sącz, Bochnia, Wieliczka, Tarnów, Biecz, Opatów, Olkusz, and Lublin. A German presence was also quite visible in numerous smaller localities, some of which were even founded by them and received names based on the German language.12 Starting from the second half of the fourteenth century and for a period that lasted about two centuries, German colonists became predominant in many localities of Red Ruthenia ( also called Red Russia ), that is, the territory of several old Russian principalities that were incorporated into the Polish state during the 1340s. These families mainly originated from Silesia, Lesser Poland, Saxony, and Bohemia. During that period, often in direct relationship with the influx of German immigrants, numerous regional towns were granted the Magdeburg rights, the set of urban laws known in Poland as “ German law ” ( in Polish : prawo niemieckie ). In the largest cities of the area, Lwów and Przemyśl, in the ĳifteenth century Germans accounted for about 70 – 80 percent of the total population. Their number was also signiĳicant in Przeworsk, Mościska, Tyczyn, Krosno, Jarosław, and Busk. Certain towns in Red Ruthenia ( including Łańcut < German Landshut ) were founded by Germans.13 11 Among geographic nicknames appearing in the oldest Kraków books written in German ( 1300 – 1305 ), sixty are derived from places in Silesia, nine from Czech localities, and six from towns in Thuringia. Another group of nicknames of German colonists living in Kraków at that time are based on toponyms from Poland. The German origin of numerous other individuals mentioned in these books is revealed by their given names, see Kawczyński 1883 : 17. 12 See details in Lück 1934 : 36 – 45, 73 – 75. This book is often ignored by contemporary scholars. The main reason is likely to be the personality of the author. An activist of the German minority cultural organizations in Poland during the 1930s, he became an active member of the Nazi party after the beginning of World War ii. An ss ofĳicer, Lück was killed in 1942 on the Russian front. These personal facts should not prevent using his writings for scientiĳic studies in the domain of history and linguistics. Lück ’s book provides the most detailed description available of the early German settlement in Eastern Europe. No particular apology of the role of Germans is visible. The reader can often adhere to his conclusions simply because the author supplies numerous details obtained by him during his meticulous ĳieldwork in the Polish archives. Generally speaking, the factual information presented in the book in question appears to be reliable. 13 See details in Lück 1934 : 76 – 87 ( with numerous tables ). Alexander Beider : Eastern Yiddish Toponyms of German Origin 441 Another influx of German colonists concerned medieval northern Polish territories. During the thirteenth to fourteenth centuries, an important number of German-speaking migrants came to Greater Poland, where numerous places received the Magdeburg rights at that time. The presence of Germans is particularly visible in the largest cities, including Poznań, Pyzdry, Kalisz, and Gniezno. In Kuyavia, they also became particularly numerous in the largest cities : Brześć-Kujawski, Włocławek, and Inowrocław. In 1346, in the immediate vicinity of Bydgoszcz, a new important German settlement, Brahenburg ( future Bromberg ), was founded, which gradually merged with Bydgoszcz. The German presence was particularly important in Pomerelia and the neighboring Chełmno Land, where Teutonic knights, German clergy, and numerous other colonists had been established. As a result, during the fourteenth century, Germans represented a large majority in the biggest cities of the area ( Gdańsk, Chełmno, and Toruń ) and were commonly present in many other localities. In Mazovia, their role was signiĳicantly more limited. Germans were important in Płock during the fourteenth century. During the same period they are very visible in Warsaw.14 3. Yiddish Toponyms of Medieval German Origin Taking into account the facts presented in the previous section, it is not surprising that until the beginning of the sixteenth century, for the urban population in many places of Lesser Poland, Red Ruthenia, and northern Polish territories, as well as in certain cities of Greater Poland, the German language was of paramount importance. In Kraków, German remained the administrative language for several centuries. The oldest municipal documents from Poznań ( from the end of the fourteenth century and the ĳirst third of the ĳifteenth century ) are written in German or ( rarely ) in Latin ( w 1 ). Both languages are also used in other sources from the same city, dating from the ĳifteenth and the start of the sixteenth century ( w 1, k 1 ). The oldest municipal books of Lwów from the end of the fourteenth century ( cz 1 ) are written in Latin. Those from the ĳirst quarter of the following century ( cz 2, cz 3 ) already include certain German texts. The totality of materials from the 1440s dealing with the local jurisdiction in relationship to the Magdeburg rights ( cz 4 ) appear in German. All these texts were published in their original spell14 See details in Lück 1934 : 27 – 36. For a general discussion of medieval German settlements in Poland, see also Kaczmarczyk 1945, with a map on p. 133. 442 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ing. The large majority of persons mentioned ( local citizens, as well as merchants coming to Lwów from other places ) are unambiguous Germans. Poles and Armenians are signiĳicantly less numerous. The number of references to Jews and Ruthenians ( ancestors of modern western Ukrainians ) is even smaller. This distribution is valid for all the aforementioned Lwów documents, that is, both Latin and German. On the other hand, sources of a similar kind from Przemyśl from the ĳirst half of the ĳifteenth century ( st 1 ) are mainly written in Latin. Only a few documents are in German. Numerous references to toponyms appear in the sources in question. Generally, the language of the document is determinant for the spelling used. In Latin documents, place names often appear in their Latin or Latinized forms. For example, in cz3 we mainly ĳind : Cracovia for Kraków, Leopolis for Lwów, Primislia for Przemyśl, Sandomiria for Sandomierz, Nova Civitas for Nowe Miasto ( literally : ‘ new town ’ ), Poznania for Poznań, and Wratislavia for Wrocław ( Silesia ). It is clear that such forms are purely bookish : they were not used in everyday conversations. However, Latin names existed only for the most important places. For smaller towns, toponyms in Latin documents do not have any special Latin sufĳix. They correspond to either Polish or ( rarely ) German names.15 Yet no ambiguity exists for toponyms present in German documents. They clearly reflect the way the same places were called by persons who used German as their vernacular language. Most likely, the names for small localities were known only to Germans who lived in the area. On the other hand, the names for cities were also known to Germans well outside the region in question. For example, we ĳind similar forms in the Prussian ofĳicial documents from the times of the Teutonic Order ( t 1, t 2, t 5, and kdl ). Table 1 presents information concerning Yiddish toponyms that are of medieval German origin. The ĳirst column provides variants from Central Yiddish ( cy), in their modern forms valid at least since the eighteenth century and the forms ( given in square brackets ) that were valid several centuries ago, before the cy shifts / u : / > / i : /, / o : / > / u : /, / aj / > / a : /, and / ej / > / aj / took place. If the town in question is cited in acp, the Hebrew spelling in question is also present in the ĳirst column.16 15 Among collections of sources used for this paper, it is only in st 1 that German or Germanized forms are common in Latin documents ; compare Warso for Warszawa ( p. 2 ), Drobicz for Drohobycz ( p. 2 ), Rubeschaw for Hrubieszów ( p. 67 ), Tharnow for Tarnów ( p. 72 ), Landishuth for Łańcut ( p. 102 ), and Schedlisk for Siedliska ( p. 298 ). See also in footnote 50 examples of doubtless German forms for Lublin ( namely Lubleyn and Löblyn ). 16 For all quotes from acp, the corresponding page numbers are indicated. When using that book as a source for Yiddish toponyms from the period between 1580 and 1764, one Alexander Beider : Eastern Yiddish Toponyms of German Origin 443 The second column indicates the region and uses the following abbreviations : gp = Greater Poland, kuy = Kuyavia, lp = Lesser Poland, maz = Mazovia, pom = Pomerelia, rr = Red Ruthenia, vol = Volhynia. ( The same abbreviations appear in square brackets [ ] in the text below. ) The third column gives Polish names and, in curly brackets, transliterated Ukrainian names, both according to their modern spelling. Note that the Polish names do not differ substantially from those used in the Polish language at the end of the Middle Ages. To illustrate this statement, the toponyms that appear in Latin documents from the ĳifteenth century are given in square brackets.17 They generally show the Polish forms. The last column presents medieval German names for the same places that were mainly extracted from the German sources of the ĳifteenth century discussed in the two previous paragraphs. For those places for which German names phonetically different from the Polish ones were used in the nineteenth to twentieth centuries, these names are given in square brackets. All toponyms concern towns except for the region of Kie ‘ Kuyavia.’ should bear several factors in mind. First, the editor of acp standardized a number of spellings in the index. As a result, the actual spellings on the pages to which the references are made in the index can be different. Second, the fact that the original documents were written in Hebrew ( and, moreover, by learned Jewish scribes who were perfectly aware of the Christian toponyms ) influenced in certain cases not only the spelling used, but also the choice of the exact form among the variants known to Jews. Sometimes, the choice was made in favor of a form that corresponds to the ofĳicial name used by Christians that could be different from the vernacular Yiddish form. For example, the town of Lubartów is called Levertev in contemporary Yiddish. This name is derived from Lewertów, the form used in Polish until 1743, when the town name was changed to Lubartów. As a result, the Yiddish name reflects an archaic Polish form. Yet in acp ( pp. 404, 513 ) during the 1750s, this town is referred to as ‫לוברטוב‬, that is, according to the newly changed ofĳicial Polish name. This issue is particularly acute for several cities mentioned in Table 1. One can see that for Poznań/ Posen, Hebrew documents whose text appears in acp vary between the traditional Jewish form ‫ פוזנא‬and the forms reflecting either the German or Polish names. The fact that for the city of Lwów / Lemberg acp presents almost exclusively the form ‫ לבוב‬can, in theory, be interpreted in two ways. First, it can result from the desire of the scribes to conform to the ofĳicial Polish name. Second, it can imply that the contemporary Yiddish Lemberik ( based on German Lemberg ) is only a few centuries old. However, other Jewish sources preclude the second possibility. A Yiddish document written in the city in question between 1616 and 1618 calls it *Lemberig ( Dubnov 1909 : 21 ). 17 For all references appearing in the second and third columns, the name of the source is followed by the page number. Latinized forms are given in the second column in brackets only if the non-Latinized ones were not found. A representative list of Polish toponyms found in medieval ( principally Latin ) sources appears in Malec 2003. 444 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Table 1 : Oldest ey toponyms borrowed from German Modern cy [ early cy ] Region Polish [ ĳifteenth-century Latin ( source ) ]{ Ukrainian } Fifteenth-century German ( source ) [ nineteenth-century German ] Altlesle kuy Włocławek [ Antiqua Wladislavia ( ws 1 336 ) ] Leszlow ( t 5 17 ), Leszlouw ( t 5 68 ) [ Leslau ] Apt( e ) ‫ ( אפטא‬acp 69 ) lp Opatów [ Opatowia ( cz 3 52 ) ] Abtau ( Lück 1934 : 41 ),1 Gross Opathow ( w 1 302 ) Brisk kuy Brześć Kujawski [ Brzescze ( w 1 336 ) ] Briszke ( t 1 663, t 5 21, 68 ), Bryskie ( w 1 313 ), Briske ( t 1 609, kdl 72 ), Briszk ( t 5 78 ), Bryszk ( t 5 173 ), Brisk ( w 1 60 ) [ Brest ] Dantsk ‫ ( דאנציק‬acp 101 ), ‫ ( דאנצק‬acp 297 ) pom Gdańsk [ Gdanzyg ( t 5 137 ) ] Danczke ( w 1 299, T5 63 ), Dantzke ( cz 4 33 ), Danczk ( t 5 68 ) [ Danzig ] Graydi( n )k [ greydik ] rr Gródek Jagielloński [ Grodek Grödik ( cz 4 45, 206, 261 ), Grödig ( cz 4 ( cz 3 18 ) ] { Horodok } 180 ), Grödek ( cz 4 249 ) Kie [ Ku( y )e ] ‫ ( קויא‬acp 474 ) kuy Kujawy [ Cuyawa ( w 1 335 ) ] Cuya ( T2 409 ), Koye ( T2 213 ), Coye ( T5 73 ), Coya ( T5 102 ) [ Kujawen ] Kolomay [ Kolomey ] ‫ ( קאלימי‬acp 54 ) rr Kołomyja [ Colomia ( cz 3 8 ) ] { Kolomyja } Kolomei ( cz 4 43 ), Colomey ( cz 4 304 ) [ Kolomea ] Kros lp Krosno [ Crosna ( cz 3 71 ) ] { Korosno } Crosse ( cz 4 12, 108 ), Crossen ( cz 4 14 ) [ Krossen ] Kru :ke [ Kro :ke ] lp Kraków [ Cracov ( cz 3 95 ) ] Croke ( cz 4 36, 288, 308 ), Crocaw ( cz 4 65 ), Crocav ( cz 4 223 ), Crokow ( st 1 45, t 5 21, kdl 375 ) [ Krakau ] Lwów{ L ’viv} Lemberg ( st 1 242, t 5 109 ), Lemburg ( cz 4 65 ), Lemborg ( t 5 18 ) [ Lemberg ] kuy Inowrocław [ Junowladislavia ( w 1 336 ) ] Jungeleslaw ( t 5 17 ), Junge Leszlaw ( t 5 91 ) [ Inowrazlaw, Hohensalza ] vol Łuck [ Luczsko ( cz 3 12, 16 ), Luczko ( cz 3 32 ), Luczco ( cz 3 100 ) ]{ Luts ’k } Lauczke ( cz 4 10, 76, 85 ), Lawczke ( cz 3 61, cz 4 105, kdl 111 ), Lawtzk ( t 5 15 ) ‫ ( קראקא‬acp 1 ) Lemberik ‫ ( לבוב‬acp 7, rr 9, 52 ), ‫ ( לעמבורג‬acp 12 ) Lesle ‫ ( לעסלא‬acp 101 ) Loutsk, Loytsk ‫ ( לויצק‬acp 139 ) 1 The form Abtau appears in German-language medieval documents of the Bishopric of Lebus, to which Opatów belonged during that period. The existence of this form makes implausible Weinreich ’s hypothesis about the Yiddish form resulting from an innovation internal to Polish Jews. However, I was unable to ĳind in any available source the German form Abt mentioned by Stankiewicz. Alexander Beider : Eastern Yiddish Toponyms of German Origin 445 Lintshits [ Luntshits ] ‫ ( לונטשיץ‬acp 14, 101 ) gp Łęczyca [ Lancicia cz 2 48, Lunczicz cz 2 22 ] Lunczicz ( kdl 385 ), Luntzitcz, Luntczicz, Luntschitcz ( T5 68, 72, 109 ) [ Lentschütz ] Mezrits gp Międzyrzecz [ Medzirzecz ( w 1 333, 361 ), Myedzyrzecz ( w 1 344 ) ] Mezericz ( w 1 64 ) [ Meseritz ] lp Oświęcim [ Uswynczin ( st 1 5)] Awswenczyn ( cz 3 71 ) [ Auschwitz ] Pa :zer [ Payzer ] gp Pyzdry [ Pizdri ( cz 3 14 ), Pyszdri ( w 1 364 ) ] Peyser ( cz 4 214 ) [ Peisern ] Poyzn( e ) gp Poznań [ Poznania ( w 1 334 ) ] Pozenow ( t 5 73 ), Poznaw ( t 5 78 ), Posenow ( t 5 : 187 ), Posenaw ( kdl 385 ), Pozenaw ( w 1 60 ), Poznaw ( k 1 15 ) [ Posen ] Rayshe [ Reyshe ] ‫ ( רישא‬acp 97, 275 ) rr Rzeszów [ Rzeschow ( st 1 103 ) ] { Ryashiv } Resche ( cz 4 197, w 1 328 ), Resze ( cz 4 223 ) 2 Ropshits ‫ ( ראפשיץ‬acp 391 ) lp Ropczyce [ Ropczicz ( st 1 62, 66, 72 ), Robczice ( st 1 137 ), Robszicze ( st 1 79 ) ] Robszicz ( cz 4 46 ), Ropschicz ( cz 4 60, st 1 252 ), Ropszicz ( st 1 248 ), Roppczitcz ( cz 4 53 ) [ Ropschitze ] Tsants, Tsans, Tsandz lp ( Nowy/Stary ) Sącz [ Sandecz Czanse ( cz 3 127, t 2 99, t 5 179 ), Czancze ( st 1 251 ) [ ( Neu / Alt ) San( cz 3 71 ) ] 3 dez ] Tsouzmer, Tso( y) zmer ‫ ( צויזמר‬acp 126 ), ‫ ( צוזמיר‬acp 270 ) lp Sandomierz [ Sandomiria ( st 1 94 ) ] Czaudmer ( cz 4 48, 76 ), Czawdmer ( cz 4 125 ), Czawdemer ( t 5 78, 81 ), Czudemer ( kdl 385 ), Czudimir ( t 5 115 ) [ Sandomir ] Va :slits [ Vayslits ] 4 lp Wiślica [ Wislicia ( st 1 120 ) ] Weyslicz ( cz 4 5, 75 ) Zamter gp Szamotuły [ Schamothuli ( w 1 356, 395 ) ] Sampter ( w 1 290 ), Szampter ( w 1 288 ) [ Samter ] ‫ ( מעזריטש‬acp 512 ) Oshpitsin ‫ ( אוישפיצין‬acp 52 ) ‫ ( פוזנא‬acp 1, 6, 7 ), ‫ ( פוזין‬acp 55, 313 ), ‫ ( פוזנן‬acp 4, 12, 52 ) 2 These references corroborate Beranek ’s idea about the origin of the Yiddish Rayshe ( see section 1 ). On the other hand, the form Reichshof suggested by Stankiewicz does not appear in any available source compiled before the twentieth century. Moreover, its root ( compare mhg rîch ) would give /a : / in modern cy, instead of the observed /aj /. Actually, Reichshof was used for Rzeszów by Nazis in 1939 – 1945. As can be seen in Table 1, this designation was made without any connection to the medieval German name of the city. 3 The form Sandecz was used in Polish until the eighteenth century ( Malec 2003 : 170 ). 4 Weinreich ( 1973 ( ii ) : 357 ) gives only the standardized form Vayslits. The vernacular cy form *Va :slits is reconstructed here, based on the link of the root vowel in this toponym to the proto-vowel whose reflex in cy is /a : /. 446 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ The comparison of forms in the different columns of Table 1 shows the existence of several phonetic shifts that occurred in German in comparison to the original Slavic toponyms. All these phenomena are found in Yiddish toponyms too : ( 1 ) Diphthongization / u : / > / au / and / i : / > / aj /. Examples : / tsaud ( e ) mer / from earlier / tsu :dimir / ‘ Sandomierz,’ /lautske/ for Łuck, ‫ אוישפיצין‬for Oświęcim, /vayslits/ for Wiślica, and /payzer/ for Pyzdry. These processes occurred during the fourteenth century in the Silesian dialect of German ( basic for the colonial language in Poland )18 for mhg û and î, respectively.19 Yiddish-speakers who came to Eastern Europe mainly from Central Europe borrowed from German colonists forms that were already diphthongized. This idea is corroborated by the fact that we do not ĳind in ey diphthongized forms for Slavic /i :/ or /u :/ outside of toponyms for which Germans had diphthongized forms.20 18 For medieval Poznań, see Anders 1938 ( especially pp. 327 – 330 ). For an analysis of the German language in Kraków ( 1300 – 1305 ), see Kawczyński 1883 ( especially pp. 18 f ). cz 4 complements these two sources dealing with westernmost Polish cities, allowing for the analysis of the German dialect used in Lwów, that is, in the southeasternmost part of Poland. That collection reveals the following features whose combination is purely Silesian ( every reference is followed by the corresponding page number ) : ( 1 ) diminutive sufĳix -el ( Jekil 7, Nickil 29, Stenczel 134, Hanczel 200 ) ; ( 2 ) /e :/ for mhg ei ( clede ‘ clothes ’ 30, czwe ‘ two ’ 173 ) ; ( 3 ) /e/ for mhg i ( regular smet ‘ smith ’ 15, occurrences of czweschen ‘ between, among ’ 32 ) ; ( 4 ) /o/ for mhg u ( regular zon ‘ son ’ 22, occurrences of scholdig ‘ guilty ’ 34 and kopper ‘ copper ’ 34 ) ; ( 5 ) internal /pp/ for mhg pf ( kopper ‘ copper ’ 34, topper ‘ potter ’ 160 ) ; ( 6 ) initial /f/ for mhg pf ( phfaffe ‘ cleric ’ 33, phande ‘ pledge ’ 201 ) ; ( 7 ) ‘ eu ’ for mhg ou ( vorkeuffen ‘ to sell ’ , heupt ‘ head ’ ) ; and ( 8 ) unrounding ( bemesche ‘ Bohemian ’ 40, mechtig ‘ mighty ’ 187 ). 19 Moser 1929 : 159. 20 Zaybish – derived from the German Saibusch that in turn comes from the Polish Żywiec [ lp ] ( Stankiewicz 1965 : 167 ) – represents another Yiddish example. All examples “ from the Slavic component of Yiddish ” suggested by Weinreich ( 1973 ( ii ) : 357, 359 ) are unconvincing. The Vistula river ( Polish Wisła ) is called Weichsel in German, that is, with the same diphthong as Yiddish Vaysl. The Yiddish name seems to be a compromise between the German and Polish forms. The information about the Yiddish name for the town of Wiślica appears in Table 1. This Yiddish toponym can either be taken directly from German, or appear by analogy to the name of the Vistula river. Yiddish tayster ‘ purse ’ is out of context : compare tajstra ‘ bag, purse,’ known in Ukrainian, Belarusian, and Polish. No diphthongization took place in Yiddish : this word was borrowed from Slavic languages already with / aj /. Weinreich says himself that the Yiddish troyb ‘ tube ’ ( compare Ukrainian truba ) is unknown in cy. Consequently, its diphthong is unlikely to be old. Most likely, it arose because of the contamination of the Eastern Slavic etymon by the Yiddish word troyb ‘ grape.’ For the Yiddish toponym Loytsk, as well as for tsoyg ‘ bitch,’ shoyb ‘ fur-lined coat,’ and yoykh ‘ broth,’ Weinreich mentions a hypothetical intermediary role of German that should be either accepted or rejected. Taking into account the information from Table 1 for Loytsk, as well as the presence of the words Zauke, Schaube, and Jauche in German dictionaries ( with exactly the same meanings as the respective Yiddish words ), one should accept this hypothesis without hesitation. Alexander Beider : Eastern Yiddish Toponyms of German Origin 447 Note that /ou/ and /a :/, found in the Yiddish toponyms in question, represent the ey equivalents for mhg û and î, respectively.21 ( 2 ) Change / s / > / ts / in the initial prevocalic position. Examples : /tsan( t )se/ for Sąncz and the German name for Sandomierz.22 This process is known in cy in certain words of Hebrew and Slavic origin.23 However, it is far from being general,24 and for this reason borrowing of ready-made German forms appears more plausible. ( 3 ) Rounding / a : / > / o : /.25 Example : /kro :ke/ for Kraków. In principle, this process could occur internally in Yiddish, compare cy ru :dem for the city called Radom [ lp ] ( ‫ ראדום‬acp 135 ) not only in Polish, but also in medieval German ( cz 4 84 ). However, the regular use of the letter “ o ” in the ĳirst syllable of the old German name for Kraków, and the importance of the German-speaking community of this city in the Middle Ages, both make more plausible the idea that Jews already borrowed from German the form with the rounded vowel. ( 4 ) Umlaut / o / > / ö /. Example : Grödik for Gródek. This process is unusual : at that period, German dialects do not use umlaut without some particular reasons that do not seem to be applicable here.26 Yiddish Greydik clearly results from early Gre :dik / Gre :dek that has the 21 The case of Oświęcim/Auschwitz is of particular interest from a methodological point of view. Indeed, the contemporary Yiddish Oshpitsin looks much closer to the Polish form : the two forms share the initial /o/ and the same number of syllables ( three ), while the disyllabic German Auschwitz has the initial diphthong /au/. However, this similarity is purely superĳicial and partly fortuitous. From Table 1 one can see that a few centuries ago the Yiddish form was Oyshpitsin, with the initial diphthong ( exactly as the German form ), while the ĳifteenth-century German form was three-syllabic. The dissimilation /šv/ > /šp/ appears to be internal to Jews. The forms in all three languages underwent different developments : ( 1 ) in Polish, the variant with /u/ in the initial position disappeared, ceding its place to the form with the initial /o/ ( actually, the latter form is older, compare Malec 2003 : 184 ) ; ( 2 ) in German, the internal /n/ and, later, the ending /in/ have been dropped ; ( 3 ) in Yiddish, the stress was displaced from the ĳirst to the last syllable and later the initial /oj/ was monophthongized to /o/ in the syllable that became unstressed. 22 In German texts in question, the digraph “ cz ” represents the standard spelling for the affricate / ts /. For example, one regularly ĳinds there the preposition “ czu ” ( compare nhg zu ‘ to ’ ). The letter “ z ” mainly corresponds to / z /, while “ tz ” for / ts / is rarely used. 23 Beranek 1965 : map 31. 24 Numerous toponyms that have initial /s/ in Slavic languages – such as Sanok, Sarnaki, Sejny, Serock, Sokółka, Sokołów, Sosnowiec, and Suwałki – also have /s/ in ey. The fact that their Jewish communities were established more recently than those from Sandomierz and Nowy Sącz is unlikely to be fortuitous. 25 This process was common in German dialects for mhg â. On the other hand, “ o ” for mhg a is mainly known in medieval sources corresponding to Bavarian and Hessian ( Moser 1929 : 116 f, 142 – 147 ). 26 All phonetic contexts in which one ĳinds umlaut in German dialects at the end of the mhg period ( see Moser 1929 : 93 – 100 ) are irrelevant here. Morphologic umlaut appears in diminutive and plural forms constructed following German patterns. 448 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ change / o / > / e /, that is, the unrounded equivalent of the process observed in the German form.27 ( 5 ) Simpliĳication of the initial consonantal cluster ( if it is non-existent in German ) by dropping the ĳirst sound. Examples : /vl/ > / l / and / gd / > / d / in German names for Włocławek and Gdańsk, respectively.28 We also observe this process in Ludmir/Lodmir, the Yiddish name for the city in Volhynia today called Volodymyr in Ukrainian, Vladimir in Russian, and Włodzimierz in Polish ( 1611 ‫) לאדמר‬29 and acp 95, ‫לאדמיר‬ acp 83 ). For this reason, the Yiddish toponym in question is also likely to reflect the influence of German.30 27 Umlaut-forms are rare among ey toponyms. Among the examples : ( 1 ) cy yerisle for Jarosław [ rr ] ; ( 2 ) cy reydim ( earlier re :dim ) for Radymno [ rr ] ; and ( 3 ) cy heylitsh ( earlier he :litsh ; ‫ האליטש‬in 1654, acp 86 ; ‫ העליץ‬in 1729, acp 310 ) for Halicz [ rr ] ( Ukrainian Halych ). In all cases, the umlaut is unlikely to be of medieval German origin. Variants of Jarosław with the initial Je- are known in both Polish ( Jerezlauus in 1271 ; Stieber 1973 : 51 ) and Ukrainian ( Jeroslav 1549, Eroslavu 1577 ; Shevelov 1979 : 545 ) sources. In the ĳifteenth century, this town appears in Latin documents as Ieruslavia or Iaroslaw ( st 1 12, 23 ), while German texts make references to it as Iarosla( w ) ( cz 4 42 ), Ioroslaw, or Iaroslaff ( st 1 91, 147 ), all without an umlaut. The ĳinal reduced -e in the modern Yiddish name ĳits well to the ending of the form Jaroslau used in German documents of Galicia during the nineteenth century. Yet Jewish references from the seventeenth to eighteenth centuries call this town ‫ ( יערסלב‬acp 14, 83, 512 ) or ‫ ( יערוסלב‬acp 15 ), invariably with the ĳinal / v /. Radymno appears in Latin sources as Radimna ( st 1 40, 80, 83 ), Radymna ( st 1 43 ), Radimpna ( st 1 95, 282 ), Radim ( st 1 4 ), or Radime ( st 1 22 ). The only found reference in a German text is Radymne ( st 1 52 ). Not one of them has an umlaut, but in the general history of Polish phonetics the change of initial Rainto Re- is well known ( Stieber 1973 : 46 f ). Halicz occurs in German documents in a form that in no case could be the etymon for the Yiddish name : the German form has the initial / g / and the ĳinal / ke / ( see Table 3 at the end of section 3 ). Polish and Ukrainian names are much closer to the Yiddish form. However, no umlaut-form is found in any of these three languages. It is unclear whether the umlaut was internal to Yiddish or, after all, results from some non-identiĳied process in Ukrainian or Polish. Bin-Nun ( 1973 : 310 ) conjectured that the Yiddish umlaut-forms for Gródek, Radymno, and Halicz were borrowed by Jews from German colonists. As can be seen from the information above, this statement is valid for the ĳirst of these towns and invalid for the last one. The German origin of the Yiddish name for Radymno is more attractive than the Polish one, not because of the umlaut, but because of the absence in Reydim/Raydim of the Slavic ending -no. Indeed, a similar effect can be observed in German and Yiddish forms for Krosno ( see Table 1 ) and Yiddish Lise derived from German Lissa ( Polish Leszno ) [ GP ] ( ‫ ליסא‬acp 313 ). Also note that the Lithuanian city of Vilna ( Polish Wilno ) ( ‫ ווילנא‬acp 176 ) appears in German documents as Wyll/Will ( W1 284 ). Both Radim and Radime appear in the collection of documents in which German forms are particularly common in Latin texts ( see footnote 15 ), and, therefore, it is plausible that these forms are German after all. 28 As can be seen from Table 1, during the Middle Ages the Polish name for Inowrocław ( Yiddish Lesle ) included the cluster “ wl ” and not “ wr ”. 29 Dubnov 1909 : 19. 30 In medieval Latin documents it is mainly called Lodomeria or Ladimiria ( compare also Ladimir in cz 3 31 ). However, Yiddish could not take the toponym directly from Latin. Alternatively to dropping the initial / v / in the unusual cluster / vl /, both German and Yiddish also had a possibility to change this cluster into / bl /, common in these two languages. This phonetic shift can be observed in Yiddish Blodeve for Włodawa. According to Weinreich Alexander Beider : Eastern Yiddish Toponyms of German Origin 449 ( 6 ) Change of the Polish ending with “ w ” and one or several vowels ( examples : -ów, -aw, -awa, and -awy ) into a reduced vowel. Examples : / kroke / for Kraków, / reshe / for Rzeszów, / kuye / and / koye / for Kujawy. This change is rather exceptional in Yiddish. Indeed, among many dozens of Yiddish toponyms in Poland and Ukraine derived from towns with one of these endings, a large majority end in -ev ( e ), -av ( e ), -ov ( e ), or -oyv. The list of forms on -e is small. To those present in Table 1, one can add only cy Bresle for Wrocław [ Silesia ] ( ‫ ברסלא‬acp 33, ‫ ברעסלי‬acp 297 ), Varshe for Warszawa [ maz ] ( ‫ וורשא‬acp 52, 139 ; ‫ וורשי‬acp 41 ), Yerisle for Jarosław [ rr ],31 Tu : ( r ) ne for Tarnów [ lp ] ( ‫ טארני‬acp 275, 394 ; ‫ טרנא‬acp 299 ), and Tarle for Tarłów [ lp ] ( ‫ טרלא‬acp 303 ). The last locality represents a particular case : this town was founded in the midsixteenth century. All others are either large cities or a region ( Kuyavia ) known since the Middle Ages in both Latin and German sources. In standardized German ( nhg ), the names for the cities in question end in -au. Yet in early sources we often ĳind German names with monophthongs ( exactly as in Yiddish ) in the ĳinal position, compare Croke, Resche ( both listed in Table 1 ), Warscha ( cz 4 54 ) and Warsche ( w 1 299 ; nhg Warschau ‘ Warsaw ’ ), and Bresle ( cz 4 20 ; nhg Breslau ‘ Wrocław ’ ).32 Also note Coye/Cuya for Kuyavia. We ĳind a similar reduced ĳinal vowel in the names of two areas that in the Middle Ages were countries : Yiddish *Maze ( ‫ מאזי‬acp 1 ) ‘ Mazovia ’ ( Polish Mazowsze ), exactly as in the old German name for the same area,33 and Lite ( ‫ ליטא‬acp 4 ) ‘ Grand Duchy of Lithuania ’ ( Polish Litwa, Belarusian Litva, German Litauen ).34 ( 7 ) German “ r ” for Polish “ rz ” . Examples : German names for Brześć, Międzyrzec, Rzeszów, and Sandomierz. The change of the palatalized ( 1973 ( iv ) : 281, without any reference ), the form Blodau is occasionally found in German. However, for several reasons the German influence here is unlikely. Note the typically Slavic ending of the Yiddish form, the fact that this town was inside of the Grand Duchy of Lithuania where German presence was marginal, and the relatively young age of the locality : until the second half of the seventeenth century, references to this small town in historical sources are rare. Moreover, in a Jewish document of 1713, the toponym appears with the initial / v / : ‫ ( וולאדאווי‬acp 265 ). 31 See footnote 27. 32 For Tarnów, we do not ĳind forms with the reduced ĳinal vowel in available German sources from the ĳifteenth century, compare Tharnaw ( t 5 176 ) and Tarnow ( cz 3 118 ). During the last centuries, this city was called Tarnau in German. 33 We ĳind a reference to Maze in a German document from the ĳirst quarter of the ĳifteenth century ( cz 3 105 ). In other German sources of the same period the country name appears as Mazow ( t 1 150, 181 ) or Mazaw ( t 1 620 ). During the twentieth century, the nhg form was already Masowien, while Yiddish used Mazovye. 34 In German documents from the ĳifteenth century, Lithuania is called Littowen ( t 1 108, 194 ), Littouwen ( t 2 595 ), or Littawen ( t 2 598 ). However, the ethnonym ‘ Lithuanian ’ appears as Lytt ( w 1 282 ), while the nhg word is Litauer. 450 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Polish /r ’/ into the affricate /rž/ is known since the thirteenth century.35 Since both / rž / and the palatalized / r ’ / are foreign to German phonology, Germans choose the closest phoneme, / r /, available in their consonantal chart. In theory, the same scenario could be applicable – independently of German – for the speakers of Yiddish migrating from the west.36 However, we can observe that the list of Yiddish toponyms having / r / ( and not / rž / or / ž / ) for Polish “ rz ” and covering places situated in ethnically Polish ( and not Ukrainian or Belarusian ) territories is rather short. In addition to toponyms mentioned in Table 1, it also includes : Brigl for Brzesko [ lp ], Brishtshe for Brzeście [ lp ], Dobrin for Dobrzyn nad Wisłą [ maz ], Kuzmir for Kazimierz Dolny [ lp ], Kuzmark for Kazimierz ( suburb of Kraków ) [ lp ], Laskarev for Łaskarzew [ lp ], Prushnits for Przasnysz [ maz ], and Vreshne for Września [ gp ].37 For many of them, the German intermediary between Yiddish and Polish is plausible.38 Note that the only toponym for which “ rz ” is regularly present in German sources of the ĳifteenth century is Przeworsk [ rr ]. It appears as Przeworsko ( cz 4 82, 84, 175 ), Prziworske ( cz 4 182 ), and Przeworsken ( cz 4 209, 215, 236 ). In Latin texts, its most common spelling ( by far ) is Przeworsko ( cz 1 42, st 1 passim ). In the Jewish sources from the seventeenth to eighteenth centuries it appears as ,‫פריווארסק‬ ‫פרשעווארסק‬, and ‫ ( פשעווארסק‬acp 134, 360, 441 ). Several phonetic phenomena in German forms mentioned in Table 1 ( also present in their Yiddish equivalents ) are isolated rather than general : a diphthong at the end of the German name for Kołomyja, a special processing of the nasal vowel in / luntšits / for Łęczyca,39 the 35 Stieber 1973 : 49. 36 Stankiewicz 1965 : 176. 37 Ibid. : 176 f ; Weinreich 1973 ( ii ) : 210. 38 Even during the last centuries, Dobrin, Kasimir ( suburb of Kraków ), and Wreschen were standard German names for Dobrzyn, Kazimierz, and Wreśnia, respectively. These places are known since the Middle Ages, cf. references in old German sources to Dobryn ( t 5 16 ) and Kazmir ( cz 4 125 ), but Polish-influenced Wrzeschna in a Latin text ( w 1 337 ). The Polish Brze- is rendered Bri- in medieval German names of several cities. The ĳirst example appears in Table 1 ( see the line for Brześć-Kujawsk ). Brzeg, a city in Silesia, appears as Brige ( cz 4 288 ). During the last centuries it was known in German as Brieg. Brzesko was also originally called Brzeg in medieval Polish. Diminutive forms Brzezek and Brzesko appeared during the ĳifteenth century ( Malec 2003 : 49 ). Yiddish name for Brzesko, Brigl, corresponds to a diminutive of / brig /. It is unclear who created this diminutive : Germans ( from whom Jews took a ready-made form ) or Jews. The former possibility is more plausible, especially if we take into account the fact that Brzesko appears as Briegel in some German sources. ( As discussed in section 1, Beranek reconstructs the form *Briegel. However, Weinreich ( 1973 ( iv ) : 259 ) states that such a form appears in German, though he does not explicitly give his source of information. ) The toponym Przasnysz has a by-form with Pra- even in Polish, and, for example, during the ĳifteenth century it appears in Polish sources as Prassznysz and Prasznisz ( Malec 2003 : 200 ; see also the discussion of Prushnits in section 4 ). 39 The form Lunciz appears in the famous Latin-language bull issued by Pope Innocent iii for the Archbishopric of Gniezno ( 1136 ), whose numerous toponyms represent one of the Alexander Beider : Eastern Yiddish Toponyms of German Origin 451 change / l / > / r / in / zamter / from Szamotuły, and the change / tš / > / š / in the German name for Ropczyce. The simultaneous presence of the largest number of changes characterizes German / mezerits / for Polish Międzyrzecz. In addition to / r / for “ rz ” mentioned above, one also ĳinds : / ts / for ĳinal / tš /, / e / for nasal “ ę ” in the ĳirst syllable, / e / for / i / in the last syllable, and / z / for / dz /. From Table 1, it can also be seen that several medieval German toponyms have special forms in which the difference in comparison to Polish forms is not purely phonetic : / brisk ( e )/40 for Brześć, / krose / for Krosno, one / n / instead of two in the name for Poznań, Lemberg for Lwów, and the calque Abtau for Opatów. In all these cases, the corresponding Yiddish toponyms clearly had German etymons. The ĳirst of them is of particular interest. In Yiddish, the same name, Brisk, is applicable to two cities called Brześć in Polish : one in Kuyavia, and another in the Grand Duchy of Lithuania ( now Brest in Belarus, also known during the last centuries as Brest-Litovsk ; ‫ בריסק‬acp 23, 37, ‫ בריסקא‬acp 62 ). Weinreich41 suggested that Polish Jews, when settling in Lithuania, carried over the name of the place from Kuyavia to the local city, since both of them were pronounced similarly by local Slavs. However, we can observe that Brisk – as the name for Brest-Litovsk – is found in the German document of 1379 ( kdl 53 ). As a result, the scenario proposed by Weinreich for Jews is actually likely to be valid for Germans. We have no evidence that a single Yiddish-speaker was present in Lithuania at that early period. As a result, Jews likely borrowed from Germans the same name for both cities.42 most important sources for studies of Old Polish phonetics. A variant spelling Lunczicz is found in certain other old documents from Poland that are not German. Most likely, Germans borrowed this form from Poles and kept it for several centuries, while for Poles the pronunciation of the toponym changed. 40 In the German texts in question the digraph “ sz ” corresponds to the sound / s /, nhg ß. 41 Weinreich 1973 ( ii ) : 213. 42 Formally speaking, we cannot exclude the possibility that both cultures independently applied the name of the city in Kuyavia to that in Lithuania. Several etymologies were suggested for this Yiddish toponym. Weinreich ( 1973 ( ii ) : 212 f ) proposes a series of implausible phonetic shifts, but admits that the problem remains unsolved. Beranek ( 1951 : 95 ) considers that the ĳinal -sk might appear by analogy with numerous other Polish toponyms ending in -sk ( o ). Stankiewicz ( 1965 : 180 ) suggests the idea about the back formation from the original adjectival derivative brisker based on Polish brzeski ‘ from Brześć ’ . This theory appears the most attractive, though it deserves several amendments. One is fundamental : Stankiewicz actually suggested a plausible etymology for the name used by Germans. As for Jews, they borrowed from Germans a ready-made form. Another amendment is of less importance. Data in the third column of Table 1 show that the original German form was pronounced / briske /. Consequently, there is no need to make an additional hypothesis about the back formation : / briske / can directly represent the Germanized form of the Polish adjective brzeski. The same idea can also explain / galtske /, the German name for Halicz ( see Table 3 at the end of section 3 ), compare the Russian adjective galitskij. Note that in 452 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ We ĳind in Table 1 several examples for the apocope of the ĳinal vowel, compare German names for Pyzdry, Szamotuły, Ropczyce, and Wiślica. Numerous other cases are found in the German documents of the ĳifteenth century : Bel( e )hoscz for Biłohorszcze ( cz 4 257, 284 ), Glinan/Glynan for Gliniany ( cz 3 67, 89, 106, 109 ), Stawczan for Stawczany ( cz 224 ), Targowisch for Targowiszcze ( cz 3 91 ), Schedlisk for Siedliska ( st 1 298 ), and Wynik for Winniki ( cz 4 226 ). Several rules appear to be general : ( 1 ) if a Polish toponym ends in -ice / yce, -icy / ycy, or -ica / ycy, its German equivalent ends in -itz ; ( 2 ) German toponyms end in -n if the Polish end in -ny. The same rules are applicable for Yiddish, compare cy ( 1 ) Dembits ( ‫ דמביץ‬acp 508 ) for Dębica [ lp ], Zaleshits for Działoszyce [ lp ], and Gorlits for Gorlice [ lp ] ; ( 2 ) Berzhan ( ‫ברעזאן‬ acp 238 ) for Brzeżany ( Ukrainian Berezhany ) [ rr ], Berzhin for Brzeziny [ gp ], and Zdin for Zduny [ gp ].43 Dropping of the ĳinal vowel of the Slavic toponym is not general in medieval German toponyms. Numerous forms end in a vowel ( mainly -e ). In addition to German spellings cited in Table 1 for Brześć, Gdańsk, Krosno, Łuck, and ( Nowy/Stary ) Sącz, compare Busko, Skole, Camyonka, Canczugy, and Belze ( cz 4 12, 14, 41, 72, and 75 ), whose Polish cognates are Busk( o ), Skole, Kamionka, Kańczuga, and Bełz [ all rr ], respectively. Moreover, in words from the general lexicon, an apocope is unknown for various East Central German dialects, including Silesian. As a result, here we are dealing with a rule that is not purely phonetic. In Yiddish, apocope is general in words from the general lexicon, but not in toponyms.44 From the above information, the influence of German on Yiddish in this context is plausible. the Middle Ages both Brześć-Kujawski and Halicz were important political and economical centers, principal cities of a duchy in Kuyavia and an Old Russian principality, respectively. For this reason, Slavic adjectives derived from their names could enter in German rather easily. ( It is precisely the existence of a similar ending in the German name for Halicz, for which the possibility of a creation by analogy is non-applicable, as well as the status of both cities, that make the above theory by Beranek less plausible than the general idea by Stankiewicz. ) 43 cy Gline for Gliniany may be a secondary form derived from early *Glin ( y ) an. Here, one of the two / n / disappeared exactly as in the Yiddish and German forms for Poznań. 44 Examples : Lentshne ( ‫ לענטשני‬acp 110 ) ‘ Łęczna ’ [ lp ], Shinyeve ( ‫ שיניאווי‬acp 258 ) ‘ Sieniawa ’ [ rr ], and Strel ( i ) sk ( ‫ סטרעליסק‬acp 276 ) ‘ Strzeliska ’ [ rr ]. Moreover, in Yiddish toponyms, cases of additional ĳinal vowel absent from the Slavic form ( as can be veriĳied in Malec 2003 ) are present. Among them : P ( e ) remishle ( Polish Przemyśl, Ukrainian Peremyshl ’ ) and Shidlovtse ( ‫ שידלובצי‬acp 289 ) ‘ Szydlowiec ’ [ lp ]. These Yiddish names could either be influenced by the presence of a vowel in forms corresponding to oblique cases of the Slavic names for these places, or created by analogy to numerous toponyms ending in a vowel in the Slavic nominative ( Beranek 1951 : 95 – 96 ). In certain cases, a form with a ĳinal vowel is surely only a few centuries old. For example, Yiddish Ostreftse ( ‫ אסטראווצי‬acp 404 ) corresponds to Ostrowiec Świętokrzyski [ lp ]. Yet at the end of the sixteenth century this locality was still a village called Ostrów, without the sufĳix -ec ( Malec 2003 : 182 ). Alexander Beider : Eastern Yiddish Toponyms of German Origin 453 For certain Yiddish toponyms, it is difĳicult to establish whether their direct etymons were German or Slavic. This is evidently the case when German and Slavic names are phonetically identical or quite close. Several examples of another kind are given in Table 2. Table 2 : Yiddish toponyms with uncertain source language Modern cy [ early cy ] Region Polish [ ĳifteenth-century Latin Fifteenth-century German ( source ) ] { Ukrainian } ( source ) [ German nineteenth century ] Baytsh [ Beytsh ] rp Biecz [ Byecz ( cz 3 40 ), Byetcz ( w 1 342 ) ] Beecz ( cz 4 167 ), Becz ( cz 3 91 ) [ Beitsch ] Dru :bitsh [ Dro :bitsh ] rr ‫ ( דראהאביטש‬acp 502 ) Drohobycz [ Drohobicz ( cz 3 100 ) ] { Drohobych } Drobitsch ( cz 4 21 ), Drohobicz ( cz 3 105 ) Rotin Rohatyn [ Rohatin ( st 1 120, 126 ), Rogatin ( 105, 107 ) ] { Rohatyn } Rohatin ( cz 4 36, 57, 68, 73 ), Roatin ( cz 4 214 ) rr From Table 2, we can observe the presence of diphthongs in both Yiddish and German Yiddish names for Biecz. However, both of them could develop independently from Polish / e : /. The absence of / h / in the two other examples characterizes both Yiddish and certain German variants. Here again the development could be parallel. Intervocalic / h / of Ukrainian origin is foreign to both Germanic languages in question. The ĳinal stress in the cy toponyms ending in /-i :n / ( Lublin ‘ Lublin,’ Garvolin ‘ Garwolin,’ Knin ‘ Konin,’ Bendin ‘ Będzin,’ Dobrin ‘ Dobrzyn,’ etc. ) represents one of the striking idiosyncrasies of this ey dialect. Stankiewicz suggested that before the sixteenth century Polish toponyms generally had vocalic endings.45 Consequently, the corresponding Polish toponyms were ending not in -in, but in -ino, with the penultimate accent. Once the ĳinal vowel was dropped, Polish shifted the stress to the new penultimate syllable, while in Yiddish it remained posited on the same vowel that now became the ĳinal one. Stankiewicz also spoke about the fact that for the Polish forms ending in -in in the nominative case, in the oblique cases the / i / appears already in the penultimate syllable. These oblique case forms could also influence the creation of the Yiddish pattern. As indicated by Weinreich, this theory contradicts the history of Polish phonetics.46 The penultimate stress became stabilized in Polish only at the beginning of the seventeenth century ; between the 45 Stankiewicz 1965 : 165 f. 46 Weinreich 1973 ( ii ) : 235. 454 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ĳifteenth and seventeenth centuries it was initial after being freely posited during the previous centuries.47 Weinreich himself paid attention to the fact that a similar pattern is found in German toponyms of Berlin, Schwerin, Küstrin, Köslin, and Stettin, all situated in a compact area covering formerly Slavic territories of Brandenburg and Pomerania.48 He suggested that Jewish migrants from the area in question brought the pattern “ place names ending in -in have the stress on the ultima ” to medieval Poland. This theory is also unsatisfactory. It is unclear how a pattern for which one can ĳind only a few examples in German could become so widely used by Jews in Poland. Moreover, we have no evidence about massive eastern migrations of Jews from that area. Most importantly, we ĳind direct proof of the presence of the pattern in question in medieval Polish. The treatise on Polish spelling written circa 1440 by Jakub Parkoszowic, the rector of the Kraków Academy, provides a number of examples of Polish words with long vowels. Among them, in the list of words with a long vowel in ĳinal closed syllables before a nasal consonant, the author mentions such toponyms as Bozaczyn, Prodoczyn, Coczyn.49 No information is available that could allow us to decide whether Polish Jews took this pattern directly from Poles or from Germans who lived in Poland in the Middle Ages. Actually, we have no formal evidence that the latter ever applied the ĳinal stress in toponyms from Poland ending in -in, although, taking into account the existence of names following this pattern in Brandenburg and Pomerania, this is quite plausible.50 Numerous Yiddish toponyms in Eastern Europe clearly had Slavic and not German etymons. This is the case for a large majority of towns where a German community was not present. However, it is also the case for places where the presence of an important German population is known from historical sources and/or whose names often appear in medieval German documents. A sample appears in Table 3. 47 Stieber 1973 : 73, 101. 48 Today the last three cities are situated in Poland ; their Polish names are Kostrzyn, Koszalin, and Szczecin, respectively. 49 Stieber 1973 : 56. This medieval Slavic pattern is likely to be responsible for the German toponyms in Brandenburg and Pomerania too. Also note that the Polish toponyms from the mid-15th century do not end in a vowel ( contrary to the idea by Stankiewicz that he actually took from a non-critical reading of a paper by Polish linguist Aleksander Brückner ). Actually, an important number of Polish toponyms end in a consonant even in the oldest documents such as, for example, the famous Gniezno bull issued in 1136 ( see footnote 39 ) ; see also Malec 2003. 50 In the form Lubleyn ‘ Lublin ’ ( cz 2 89, Latin source ) we observe the diphthongization / i : / > / aj / typical for German. However, this spelling is exceptional and its ĳinal element could be due to a contamination by the German diminutive sufĳix spelled -lein in nhg ( -lîn in mhg ). Other variants present in German sources are Lublin ( cz 4 98, 200 ), Loblin ( cz 4 16 ), and Lobelyn ( Lück 1934 : 44 ) ; one Latin source mentions Löblyn ( cz 4 22 ). Alexander Beider : Eastern Yiddish Toponyms of German Origin 455 Table 3 : Yiddish toponyms with Slavic etymons Modern cy [ early cy ] Region Polish [ ĳifteenth-century Latin Fifteenth-century German ( source ) ] { Ukrainian } ( source ) [ German nineteenth century ] Bokhnye lp Bochnia [ Bochna ( cz 2 113, cz 3 Boche ( cz 3 71, st 1 204 ) [ Sal20, 41, st 1 5, 84 ) ] zberg ] 1 Heylitsh [ He :litsh ] ‫ ( האליטש‬acp 86 ), ‫ ( העליץ‬acp 310 ) rr Halicz [ Halicz ( cz 3 21 ) ] { Halycz } Galczke ( cz 3 89, 95, 96, cz 4 35, 54 ), Galczg ( cz 3 106 ), Galcz ( cz 3 83 ) Komenits ( Southeastern Yiddish ) [ Kamenits ] ‫ ( קאמיניץ‬acp 89 ) rr Kamieniec Podolski [ Camenecz ( st 1 233, 262, cz 3 51 ), Camnicz ( cz 3 14 ) ] { Kam ”yanets ’-Podil ’s ’kyj } Camencz ( cz 3 4, cz 4 2 ), Kamencz ( cz 4 54 ) Libetshoyv [ Lubetshoyv ] rr Lubaczów [ Lubaczow ( st 1 78, 220 ) ]{ Lyubachiv } Lubetschaw ( cz 4 280 ), Lubeczaw ( cz 4 308 ) Moshtshisk ‫ ( מושציסק‬acp 269 ), ‫ ( מאשטשינסק‬acp 394 ) rr Mościska [ Moscziska st 1 40 ] { Mostys ’ka } Mosticz ( cz 4 140 ), Mosczicz ( cz 4 134 ) Petrikev gp Piotrków Trybunalski [ Pyotrkow ( w 1 426 ), Pyothrkov ( t 5 98 ) ] Peterkaw ( t 2 570 ), Petirkaw ( t 2 232 ), Peterkow ( t 2 174, 207 ), Peterkau ( t 5 6, 13, 25 ) [ Petrikau ] Pilzne lp Pilzno [ Pilszno ( cz 3 14 ), PilPilzen ( cz 4 160, 199, 273, st 1 szna ( cz 3 13 ), Pilsno ( st 1 217 ) ] 72 ) [ Pilsen ] Premishle rr Przemyśl [ Przemisl ( st 1 120 ) ] { Peremyshl ’ } ‫ ( פיוטרקוב‬acp 103 ), ‫ ( פיעטרקוב‬acp 503 ) ‫ ( פרעמשלא‬acp 35, 126 ), ‫ ( פרעמםלא‬acp 32, 139 ) Primsel ( cz 3 60 ), Prymsel ( cz 4 86 ), Primzel ( cz 4 33 ), Primpsel ( cz 4 7 ), Primisl ( cz 3 123 ) Ribishoyv [ Rubishoyv ] rr ‫ ( רובשוב‬Dubnov 1909 : 17, acp 156 ), ‫הרובשוב‬ ( acp 156 ) Hrubieszów [ Rubeschow ( cz 2 Rubischaw ( cz 4 181 ), Rube130 ) ] { Hrubeshiv } schow ( cz 4 84 ), Robeschow ( cz 3 127, st 1 127 ), Rubyeschewo ( w 1 307 ) Trebevle rr Trembowla [ Trebowla ( cz 2 93, 108, 134 ) ] { Terebovlja } Treble ( cz 4 293 ), Trebil ( cz 2 119 ), Treblow ( cz 3 106 ) Zhidetshoyv, Zidetshoyv rr Żydaczów [ Zudaczow ( st 1 102 ) ] { Zhydachiv } Zaudeczaw ( cz 4 129 ), Zawdeczaw ( cz 4 80 ), Zawdaczaw ( cz 4 109 ), Zawdiczaw ( cz 4 113 ) 1 German sources from the ĳifteenth century do not mention the form Salzberg. Similarly, Wieliczka [ lp ] ( Yiddish Velitshke ) often called Groß Salze in German sources of the last centuries, appears as Weliczke in German medieval texts ( cz 4 230 ). This shows that the opinion of Weinreich about the names of these two towns ( cited in section 1 ) can be anachronistic. 456 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ As can be seen from Table 3, in Yiddish names for Bochnia, Halicz, Kamieniec Podolski, Mościska, Pilzno, and Piotrków, the ending is of doubtless Slavic origin, different from that found in the medieval German toponyms. Moreover, for Halicz, Yiddish and German have different initial consonants. The German form for Trembowla lacks internal / v /. German forms for Przemyśl all start with Pri- 51 that is not found in the Yiddish toponym. In the German form for Żydaczów, we can observe the diphthongization / u : / > / au / discussed above in this section.52 Because of its diphthong / oy / in the ( stressed ) ĳinal syllable, it is of Ukrainian origin. For the same reason, the Yiddish names for two other towns from the same general area ( formerly Red Ruthenia ), Lubaczów and Hrubieszów, are also of Ukrainian origin.53 The non-German forms of certain Yiddish toponyms listed in Table 3 ( namely, those different from the towns discussed in the previous paragraph, all of which reveal phonetic features many centuries old ) can in theory result from a Slavonizing during the last centuries of the former, German-based, Yiddish toponyms. 4. The Modern Era With the rise of the Polish urban middle class, gradual de-Germanizing took place. In a number of towns from Lesser Poland ( including Miechów and Wiślica ), this process was ĳinished by 1500. During the second half of the ĳifteenth century, many other formerly important centers of German colonization, such as Brześć Kujawski and Bydgoszcz in the North, and Lublin and Sandomierz in the South, were completely Polonized.54 At the same period, the urban population in Mazovia was predominantly Polish.55 During the ĳirst third of the sixteenth cen51 Apparently, in the Middle Ages, this was the general German way of rendering Polish Prze- ( see also footnote 38 about Brze- ). 52 Note that in this toponym – contrary to its modern name – the oldest Slavic/Latin sources have / u / in the ĳirst syllable. 53 It was Stankiewicz ( 1965 : 180 ) who, taking into account the ĳinal stress in Yiddish, suggested the Ukrainian origin of these three Yiddish toponyms. Note that – contrary to the three toponyms in question – Yiddish names never end in -oyv when the corresponding polysyllabic Polish toponyms from the ethnically Polish territories end in -ów ( Weinreich 1973 ( ii ) : 251 ). As can be seen from Table 3, the change of the initial Ukrainian / hr / into / r / characterizes Yiddish, German, and Polish names for Hrubieszów ( compare Polish alternate form Rubieszów ). The consonantal cluster /hr/ is foreign for all these three languages. 54 Lück 1934 : 178. 55 See details in Tymieniecki 1921 : 19. The author shows that in Mazovia and neighboring parts of Podlasia, Germans were found in the ĳifteenth century only in Warsaw, Goniądz, Alexander Beider : Eastern Yiddish Toponyms of German Origin 457 tury, the influence of German declined even in Poznań and Kraków : this language gradually ceases to be used in the administrative document and is replaced there by Latin, and later Polish.56 However, during the sixteenth to eighteenth centuries a new, second, wave brought to Poland an important number of German immigrants. Contrary to the medieval influx, this one primarily concerned only northern areas. Migrants from Germany and Silesia came to Greater Poland and from the Prussian provinces to the Toruń area and from it to Mazovia.57 During the second half of the sixteenth century, Protestant immigrants played a signiĳicant role in the growth of the towns of Leszno [ gp ] ( German Lissa ), Lewartów [ lp ] ( now Lubartów, Polonized by the mid-seventeenth century ), and Zamość [ rr ].58 However, the linguistic impact of these immigrations was limited and unlikely to have influence on ey. The third wave of German-speaking migrants corresponds to the period of partitions ( 1772 – 1815 ). It was directed into the northwestern region that received the name of West Prussia and to former Lesser Poland and Red Ruthenia, the area taken by Austrians that received the name of Galicia.59 During the period until World War I, the provinces that were taken by Prussians, that is, West Prussia and Posen ( Polish Poznań ), underwent Germanizing. Because of the existence of these several periods when German linguistic influence was important in various parts of Poland, it is sometimes difĳicult to establish the time when Jews borrowed certain Yiddish toponyms from Germans. Most likely, the German etymons of all Jewish toponyms mentioned in the previous section had already entered Yiddish in the Middle Ages. This is particularly true in cases where German medieval forms are distinctly different from those used in German during the last centuries. However, for certain places, German forms underwent no major change since the Middle Ages. For them, the age of the borrowing to Yiddish from German is difĳicult to establish. For instance, this is the case for Varshe ‘ Warsaw ’ and Poyzn ‘ Poznań.’ For the latter city, the Yiddish name followed the same changes as the German name. Indeed, one can easily see the correspondence between the respective older forms ( ‫* פוזנא‬Po ( y ) zne and Posenaw/Posenau ) and that between those used during the twentieth century ( Poyzn and Posen ). Nur, and Zakroczym, while his study of sources from numerous other towns of the area reveals that their population was overwhelmingly Polish. 56 See numerous details concerning the Polonizing of Greater Poland in Tymieniecki 1938. 57 See the map in Kaczmarczyk 1945 : 167. 58 Lück 1934 : 183. 59 See the map in Kaczmarczyk 1945 : 181. 458 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ We do not know the chronology of the development of cy Pru :shnits ‘ Przasnysz ’ [ maz ] that very likely had a German etymon.60 A similar problem exists for Ektsin, a compromise form between German Exin and Polish Kcynia [ gp ] and Sheps ‘ Sierpc ’ [ maz ].61 On the other hand, Yiddish Lise for Leszno/Lissa ( ‫ ליסא‬acp 313 ) surely developed after the medieval period. The same is true for a number of other Yiddish toponyms from Polish territories taken by Prussians during the partitions of Poland. Yiddish Stanisle for Stanisławów [ rr ] ( a city built only in 1662 ) is clearly among the most recent borrowings : Stanislau was the German name for this city in Galicia.62 5. Conclusion The information taken from historical sources and arguments provided in this paper show that a few dozen Yiddish toponyms in Eastern Europe are based on names used in medieval German that were different from the original Slavic names. This kind of situation can be decomposed into two separate phases : ( 1 ) creation by Germans of toponyms distinct from their Slavic etymons ; ( 2 ) borrowing of these toponyms from German to Yiddish. Considering the list of toponyms in question, one can suggest several factors that appear to be determinant for these two phases. For both phases, no massive presence of local German-speakers was mandatory. Just the awareness about the existence of these places, as well as various kinds of contacts, direct or indirect, between people from these areas and those living in different German-speaking provinces, were sufĳicient for the development of speciĳic German toponyms, with important differences in comparison to the correspond60 No old German reference to this town was found in available sources. However, during World War II, Germans called it Praschnitz, that is, with ĳinal /ts/ instead of Polish / š / and internal / š / instead of modern Polish / s / ( though old Polish forms with / š / are known as well, see footnote 38 ). Both these peculiarities are present in the Yiddish form. This name from the Nazi era is likely to be based on some earlier German name for the town. Note that in some cases, the newly assigned names for Polish towns had nothing to do with old German names ; see footnote 2 of Table 1 ( p. 439 ) about Reichshof used for Rzeszów. 61 This town appears as Scheps on a German map of Prussia by Gaspar Henneberg ( 1576 ), while in Polish sources from the fourteenth to sixteenth centuries it is called Seprcz ( e ), Syeprcz, and Sieprcz ( Malec 2003 : 218 ). Stankiewicz ( 1965 : 179 ) suggested that the Yiddish name for this town appeared within the Jewish community because of the folk etymology that related it to Yiddish sheps ‘ sheep.’ The existence of the identical German toponym makes this hypothesis more than doubtful. 62 The Hebrew sources from the eighteenth century invariably use forms ending in / v / : ‫ ( סטנסלאב‬acp 404 ) and ‫ ( סטאנסלווב‬acp 513 ). Alexander Beider : Eastern Yiddish Toponyms of German Origin 459 ing Slavic toponyms. Two independent factors were important for the volume of these contacts. The ĳirst of them concerns the size of the place. Big cities that in the Middle Ages played an important role in the economic and political life of the area had greater chances than smaller towns to appear in the category in question. The same is a fortiori true for names of countries and provinces. They were necessarily known outside of the area. The distance between the place and the area where a signiĳicant German-speaking population lived represents a second important factor. The smaller the distance, the tighter were contacts and the more plausible the possibility of the development of a speciĳic German toponym. Jews living in German-speaking provinces naturally borrowed the German toponyms in question from the Christian majority. As a result, during the formation of the Yiddish-speaking communities in Poland and the Grand Duchy of Lithuania, Jews could migrate eastward from western German-speaking areas, already having these German-based toponyms in their vernacular language as ready-made forms. Note that Poland ( Polska, in Polish ) and Red Ruthenia/Russia ( Polish Ruś, Russian and Ukrainian Rus ’ ) are called Poyln ( ‫ פולין‬acp 1 ) and Raysn ( ‫ רייסן‬acp 355 ) in ey, with an evident link to German Polen and Reußen, respectively.63 Other examples were discussed in previous sections. Yiddish uses German-based names for : ( a ) Mazovia, Kuyavia, and, likely, Lithuania too, as well as for ( b ) the largest Polish cities, including Warsaw, and ( c ) a few Polish towns – such as Sierpc and possibly Przasnysz – situated in the immediate vicinity to Prussian borders. There is no evidence of the existence of pre-Yiddish Jewish communities in various Polish provinces. Yet in Ukrainian territories ( Red Ruthenia ) incorporated during the fourteenth century into Poland and Lithuania, Slavic-speaking Jewish communities existed before the arrival of Ashkenazic migrants from the West. After the merger of the two Jewish groups, western migrants gradually established Yiddish as the new vernacular language of local Jewish communities. In certain cases, this switch to another language supplanted previous names used locally by Jews, replacing them by toponyms brought by Yiddish-speakers. Note that the most important cities of the Grand Duchy of Lithuania – such as Brest, Luts ’k / Lutsk, and maybe also Volodymyr / Vladimir ( all formerly within the principality of Volhynia ) – received Yiddish names based on German toponyms.64 63 Compare, for example, the following medieval German references in t 5 : Polan ( pp. 21, 38, 91 ), Polen ( pp. 63, 87 ), Reuszen ( p. 21 ), and Reussen ( p. 91 ). 64 Vladimir appears as ‫ וולדימיר‬in a document of the eleventh century ( Neubauer and Stern 1892 : 71 ). This spelling ĳits perfectly the Old Russian name of this city and is independent from its modern Yiddish name. The use of the name Brisk for Brest was not established 460 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ The presence of important local German-speaking communities was evidently also highly favorable for the creation and/or strengthening of particular German names in Slavic territories. For medieval Poland, this factor was partly correlated with those discussed above. Indeed, numerous Germans lived in the Middle Ages in the biggest Polish cities, many of which were situated not far from German or Germanized provinces. It is for smaller towns that this factor was of particular importance. The reason is simple : these toponyms were unknown outside their own geographic area. The information present in this paper shows that speciĳic German names were much more common in areas where the presence of a German Christian population was particularly visible during the Middle Ages, namely, in Lesser Poland, Red Ruthenia, Greater Poland, and Kuyavia. For some localities in question, numerous Germans continued to live along with Poles and Jews in the modern era too. Yet for towns of Mazovia, Ukraine, Belorussia, and Lithuania, where Germans were signiĳicantly less numerous or not present at all, speciĳic German toponyms are rare. Contrary to the names of provinces and large cities and some towns close to borders, Jews could borrow German names of small towns situated far from German-speaking provinces only locally. For this borrowing to take place, it was not necessary for Germans to constitute a majority in the towns in question. Since Yiddish was much closer to the dialect of German colonists than to the language( s ) spoken by local Slavs, the former was more influential on Yiddish than the latter. In any case, the existence of such borrowings of names of places other than large cities constitutes a cogent argument for the thesis about the important influence that the language of German colonists exerted on the early development of ey. The fact that a number of other modern Yiddish toponyms show features that make it impossible for their derivation from the medieval German names for the same place can be interpreted in two ways.65 First, we can deal with the situation in which a name borrowed from Germans at some moment in Jewish history was later Slavonized and, as a result, its modern form hides its German past. The smaller the local Jewish population, the bigger were the chances for Yiddish toponyms to become Slavonized in the Modern Era. Second, the Yiddish names of certain localities have always been related to Slavic names, even if Gereven during the ĳirst half of the seventeenth century. For this, we ĳind direct evidence in writings of Meir Katz, an Ashkenazic Jew who served at that time as rabbi in the Belarusian town of Mahilyow ( Russian Mogilev ). He wrote that Jews around him spoke mostly Russian and called the town Brest by its Russian name and not the Yiddish one, Brisk ( see the discussion in Dubnov 1909 : 23, Weinreich 1973 ( i ) : 92 ). 65 The choice between them could be made only via the analysis of the detailed historical sources that are, unfortunately, unavailable. Alexander Beider : Eastern Yiddish Toponyms of German Origin 461 man names, different from the Slavic ones, also existed. Such a scenario could be realized if at the moment when the local Jewish community became signiĳicant, the German one was already in decline. In other terms, it was the relative chronology of the establishment and development of German and Yiddish communities in the same towns and their surroundings that was a determinant factor. One can imagine two opposite theoretical scenarios to illustrate this rule. In Scenario 1, German-speakers are common in a town during a long period, but Jewish presence is marginal there during the same period. The odds are high that Yiddish toponyms will be based on the Slavic name. In Scenario 2, German-speakers cover an important part of the Gentile population of a town during a short period, but it is precisely during that period that the Jewish community becomes ĳirmly established there. In this situation, the German toponym can survive among Jews well after the total Polonizing of the local Christian population. Several concrete examples can also be proposed. In the list of Yiddish toponyms that are of Slavic rather than German origin ( Table 3 ), the biggest cities are Piotrków Trybunalski and Kamieniec-Podolski ( now Kam ”yanets-Podil ’s ’kyj, Ukraine ). The ĳirst of them acquired an important status relatively late : it became an important administrative center during the second half of the ĳifteenth century only and was the site of the Polish Crown Tribunal between 1578 and 1792. We have no information about the dwelling of Germans in this city. Moreover, during the ĳifteenth to eighteenth centuries, Piotrków was several times granted the privilege de non tolerandis Judaeis ( “ non-toleration of Jews ” ) that restricted the growth of its Jewish population. The story of Kamieniec-Podolski is different. It the Middle Ages, numerous Germans lived in this city, along with Ruthenians, Poles, and Armenians. On the other hand, its municipal authorities made numerous efforts to prevent Jews from settling there, with special laws promulgated in 1477 and 1598. It is no surprise that the German toponyms for both places, purely ofĳicial for the ĳirst and more vernacular but still not reaching Jews for the second, were not taken by Yiddish. The situation in other large cities, well known since the Middle Ages, with important German and Jewish population ( in the cities themselves or in their large suburbs ), such as Kraków, Poznań, Sandomierz, and Lwów/Lemberg was totally different, and we ĳind for them German-based names in Yiddish. Today, Horodok and Mostys ’ka are both small towns in western Ukraine. However, in the Middle Ages the ĳirst of them ( called Gródek Jagielloński in Polish ) was an important economical center, with numerous references in German and Latin documents. Despite the privilege de non tolerandis Judaeis that 462 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ was valid from 1550 until the second half of the seventeenth century, its German-based Yiddish name survived until recent times. The second one, called Mościska in Polish, was a much smaller locality and only a few documents mention people coming from it to the neighboring cities of Lwów and Przemyśl. We do not know details about its early Jewish community, but in any case, the source of its modern Yiddish name is Polish, despite the demographic dominance of Germans there during the ĳifteenth century. Many elements in the history of Krosno and Pilzno appear to be similar. During the nineteenth century, both of them were district centers in western Galicia and their population ĳigures were similar ( about 2,000 inhabitants circa 1880 ). In both of them, the medieval German population was important, as can be seen from the names of people coming from these towns to Lwów ( cz 3, cz 4 ) and Przemyśł ( st 1 ) during the ĳifteenth century. Both Krosno and Pilzno received the privilege de non tolerandis Judaeis during the second half of the sixteenth century. Yet Yiddish names developed differently : they are German- and Polish-based, respectively. The difference can be explained by several factors. During the ĳifteenth to sixteenth centuries, Krosno was one of the most populous towns of Lesser Poland. Its ĳirst Jewish residents are mentioned in the ĳifteenth century, that is, precisely during the period when it was a flourishing commercial center of the region. At the same time, the economic and demographic importance of Pilzno was signiĳicantly less. No mention of Jews appears in the town records until the mid-sixteenth century.66 Even if – as is shown in this paper – the influence exerted by medieval German colonists in Poland was important for the development of Yiddish, it should not be exaggerated. Numerous toponyms were taken directly by Jews from Slavs, without any intermediary of Germans. For many places in Central and Eastern Poland, as well as in the territories of modern Ukraine, Belarus, and Lithuania, the German presence was marginal. Moreover, we also ĳind a number of Yiddish toponyms of Slavic origin for towns with a signiĳicant proportion of Germans. On the other hand, once taken from Germans, certain toponyms underwent important modiĳications during the history of Yiddish : shifts of stressed vowels ( that were general for ey subdialects and concerned the toponyms as well ), apocope, and certain consonantal changes as well.67 66 The above rules also possess exceptions. For Przemyśl, with a considerable German community in the ĳifteenth century and a Jewish street known already since the middle of the same century, Yiddish has a name that is of Slavic origin ( that most likely replaced at some moment the older, German-based, name ). 67 Examples from Table 1 : / z / instead of / d / in Tsouzmer ‘ Sandomierz ’ ( most likely due to some kind of contamination rather than to a purely phonetic shift ) ; internal / n / in Graydink ‘ Gródek ’ and Moshtshinsk ‘ Mościska ’ ( other toponyms from the same group are Linsk ‘ Lesko ’ and Ninsk ‘ Nisko ’ ; note that all four places in question correspond to the same Alexander Beider : Eastern Yiddish Toponyms of German Origin 463 We know a lot about this internal history thanks to the studies by Weinreich and other major contributors to Yiddish historical linguistics. The aim of the present paper was to complement their results by showing certain features acquired by Yiddish during the earlier period, that of the initial development of this language in Slavic countries. That period is of particular interest for the history of Yiddish because it was crucial for the survival of this language. Indeed, in Jewish history we know very few instances of Jewish communities that spoke a vernacular idiom not based on the language of the Gentile majority. The two most striking examples are Spanish-based Judezmo in the Ottoman Empire and German-based Yiddish in Eastern Europe, which survived ( and in many respects were formed ) over the course of centuries in the linguistic environment in which the surrounding population used languages belonging to other language families. For the ĳirst example, the fact that the Sephardic communities in the eastern part of the Mediterranean region appeared after a mass migration that followed the forced expulsions from the Iberian Peninsula during the 1490s was certainly of paramount importance. Yet we do not ĳind any historical reference to mass migrations to Eastern Europe. Local Yiddish-speaking communities were formed much more gradually than the Sephardic ones in the Ottoman Empire. A non-interrupted influx of Jewish migrants ( primarily from Bohemia, Moravia, Silesia, and eastern German territories ), followed by internal Eastern European migrations, within the Polish Kingdom and from Poland to the Grand Duchy of Lithuania, lasted several centuries. From historical documents, the important growth of local Jewish communities can be posited in the fourteenth to sixteenth centuries. By 1500, the largest number of Jewish communities appeared in Lesser Poland, Greater Poland, and Red Ruthenia.68 In the same areas, precisely during the period of the formation of important Yiddishspeaking communities, new incoming Jewish families met large groups of urban Christians, who were using in their vernacular life an idiom close to their own. Tight contacts with Germans who lived in Polish and Red Ruthenian towns in large numbers had an important influence on the development of local dialects of Yiddish, and became a major factor that allowed Ashkenazic immigrants not to switch from their vernacugeographic area ). To a general ey innovation ( and not to a putative German influence suggested in Stankiewicz 1965 : 178 ) is due the affrication / s / > / t s/ after / n / or / l / found in Belts for Bełz [ rr ], Kintsk for Końskie [ lp ], Nasheltsk for Nasielsk [ maz ], Plintsk for Płońsk [ maz ], and Shrentsk for Szreńsk [ maz ], as well as in Mintsk and Pintsk used for the Belarusian cities of Minsk and Pinsk, respectively. 68 In the last area, western newcomers gradually merged with their local Slavic-speaking coreligionists, whose communities are known in the territories of modern Ukraine in the tenth to thirteenth centuries. 464 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ lar language to Polish or Ukrainian. When the local German-speaking Christian population disappeared after a gradual merging with Poles ( who shared with Germans the same Catholic religion ), a number of important Yiddish-speaking communities were already ĳirmly established in the area. The study of the oldest Yiddish toponyms of German origin reveals a page in the history of that period that in many aspects was determinant for the Jewish presence in Eastern Europe and for the development of Yiddish as the unique vernacular language of local Jews.69 Collections of original records used 70 acp = Halperin, Israel, ed., 1945 : Acta Congressus Generalis Judaeorum regni Poloniae, 1580 – 1764 [ in Hebrew ]. Jerusalem : Bialik Institute. cz 1 = Czołowski, Aleksander, ed., 1892 : Najstarsza księga miejska 1382 – 1389 // Pomniki Dziejowe Lwowa, 1. Lwów : Nakładem gminy król. stoł. miasta Lwowa. cz 2 = –, ed., 1896 : Księga przychodów i rozchodów miasta 1404 – 1414 // Pomniki Dziejowe Lwowa, 2. Lwów : Nakładem gminy król. stoł. miasta Lwowa. cz 3 = –, ed., 1905 : Księga przychodów i rozchodów miasta 1414 – 1426 // Pomniki Dziejowe Lwowa, 3. Lwów : Nakładem gminy król. stoł. miasta Lwowa. cz 4 = Czołowski, Aleksander and Jaworski, Franciszek, eds., 1921 : Księga ławnicza miejska. 1441 – 1448 // Pomniki Dziejowe Lwowa, 4. Lwów : Nakładem gminy król. stoł. miasta Lwowa. k 1 = Kaczmarczyk, Kazimierz, ed., 1925 : Akta radzieckie poznańskie, 1 ( 1434 – 1470 ). Poznań : Nakładem poznańskiego towarzystwa przyjaciół nauk. kdl = Raczyński, Edward, ed., 1845 : Kodex dyplomatyczny Litwy. Wrocław : Zygmunt Schletter. 69 This information should not be interpreted as a corroboration of the theory about ey being derived from the language of German colonists in Poland. This paper deals with a second stage of the development of ey during which the language of these colonists ( related to a Silesian subdialect of East Central German ) had an important influence on various aspects of ey ( including its phonetics, primarily in the domain of the consonantism, general lexicon, and toponyms ). The ĳirst stage of the development of ey ( during which the Proto-ey vocalism was formed ) took place earlier in territories situated southwest of Poland, namely in Bohemia-Moravia ( Beider 2010 ). 70 For quotations from all books listed below, the paper gives the page numbers, not the document numbers. Alexander Beider : Eastern Yiddish Toponyms of German Origin 465 st 1 = Smołka, Jan and Tymińska, Zoĳia, ed., 1936 : Księga ławnicza. 1402 – 1445 // Pomniki Dziejowe Przemyśla, 1. Przemyśl : Nakładem gminy miasta Przemyśla. t 1 = Toeppen, Max, ed., 1878 : Acten der Ständetage Preussens unter der Herrschaft des Deutschen Ordens. Vol. 1 ( 1233 – 1435 ). Leipzig : Duncker & Humblot. t 2 = Toeppen, Max, ed., 1880 : Acten der Ständetage Preussens unter der Herrschaft des Deutschen Ordens. Vol. 2 ( 1436 – 1446 ). Leipzig : Duncker & Humblot. t 5 = Toeppen, Max, ed., 1886 : Acten der Ständetage Preussens unter der Herrschaft des Deutschen Ordens. Vol. 5 ( 1458 – 1525 ). Leipzig : Duncker & Humblot. w 1 = Warschauer, Adolf, ed., 1892 : Stadtbuch von Posen. Vol. 1 : Die mittelalterliche Magistratsliste die ältesten Protokollbücher und Rechnungen. Poznań : Eigenthum der Gessellschaft. Other works cited Anders, Heinrich, 1938 : Das Posener Deutsch im Mittelalter, i. Phonetik. Vilna : Towarzystwo przyjaciół nauk w Wilnie. Beider, Alexander, 2001 : A Dictionary of Ashkenazic Given Names : Their Origins, Structure, Pronunciation and Migrations. Bergenĳield, nj : Avotaynu. – 2010 : “ Yiddish Proto-vowels and German Dialects. ” In : Journal of Germanic Linguistics 22 ( 1 ) : 23 – 92. Beranek, Franz J., 1951 : “ Jiddische Ortsnamen. ” In : Zeitschrift für Phonetik und allgemeine Sprachwissenschaft 5 : 88 – 100. – 1965 : Westjiddischer Sprachatlas. Marburg : N. G. Elwert. Bin-Nun, Jechiel, 1973 : Jiddisch und die deutschen Mundarten : unter besonderer Berücksichtigung des ostgalizischen Jiddisch. Tübingen : Niemeyer. Dubnov, Semen Mixajlovič, 1909 : “ Razgovornyj jazyk i narodnaja literatura pol ’sko-litovskix evreev v xvi i pervoj polovine xvii veka. ” In : Evrejskaja Starina 1 : 7 – 40. Frakes, Gerold C., 2004 : Early Yiddish Texts, 1100 – 1750. Oxford : Oxford University Press. Kaczmarczyk, Zdzisław, 1945 : Kolonizacja niemiecka na wschód od Odry. Poznań : Instytut Zachodni. 466 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Kawczyński, Maksymilijan, 1883 : Badania nad językiem zapisków niemieckich z czternastego wieku ogłoszonych w najstarszych księgach i rachunkach miasta Krakowa. Krakow : Uniwersytet Jagielloński. Lück, Kurt, 1934 : Deutsche Aufbaukräfte in der Entwicklung Polens. Plauen : Günther Wolff. Malec, Maria, 2003 : Słownik etymologiczny nazw geograĳicznych Polski. Warsaw : Wydawnictwo Naukowe pwn. Moser, Virgil, 1929 : Frühneuhochdeutschen Grammatik. Vol. 1 : Lautlehre. Part 1 : Orthographie, Betonung, Stammsilbenvokale. Heidelberg : Carl Winter. Neubauer, Adolf and Stern, Moritz, eds., 1892 : Hebräische Berichte über die Judenverfolgungen währen der Kreuzzüge // Quellen zur Geschichte der Juden in Deutschland, 2. Berlin : Leonhard Simion. Stankiewicz, Edward, 1965 : “ Yiddish Place Names in Poland. ” In : Uriel Weinreich, ed., The Field of Yiddish, Second Collection. The Hague : Mouton, 158 – 181. Stieber, Zdzisław, 1973 : A Historical Phonology of the Polish Language. Heidelberg : Winter. Tymieniecki, Kazimierz, 1921 : Procesy twórcze formowania się społeczeństwa polskiego w wiekach średnich. Warsaw : E. Wende. – 1938 : Polszczenie się niemców w miastach Wielkopolskich w xv wieku. Poznań : Fundusz naukowy Uniwersytetu Poznańskiego. Weinreich, Max, 1973 : Geshikhte fun der yidisher shprakh. 4 vols. New York : yivo. Moshe Taube On the Relative Marker Vos and Yiddish Postmodiĳiers Introduction The distribution of the interrogative pronoun vos ( ‘ what ’ ) in Yiddish has considerably expanded under the influence of the co-territorial Slavic languages, and the form has spread into several new environments and acquired a number of additional functions not attested in German. These include the use of vos as an invariant relative marker 1 and as a complementizer, or subordinating conjunction.2 Here I would like to present a few other functions of vos within the noun phrase which, to my knowledge, the grammars of Yiddish do not treat at all,3 although they are well attested in the literature of the 19th and 20th centuries as well as in the spoken language.4 Before going into the details of these innovations, let us start with a brief survey of the constituent structure of the Yiddish noun phrase. The Noun Phrase in Yiddish Like the constituent languages of two of its three major components, Germanic and Slavic, Yiddish is an an language, i.e., the default constituent structure of the noun phrase is : det Adj Noun, with the attributive adjective preceding its head, e. g., a geler hunt ‘ a yellow dog, ’ and der geler hunt ‘ the yellow dog. ’ Adjectives that follow their head noun, obligatorily preceded by the appropriate det, e. g. a hunt a geler vs. der hunt der geler,5 are considered “ separate nps in apposition. ” 6 Modiĳiers other than adjectives may appear after the head. In the postmodiĳier 1 This type is marginally attested in German with neuter nouns as heads ( see Behaghel 1928 : 726 ). 2 See Krogh 2001 : 46 – 50 ; Jacobs 2005 : 188, 232 – 238 and literature cited there. 3 Zaretski ( 1926 : 172 ) is the only one to mention one of these functions, vos + prepositional phrase, supported by a single example. 4 Here I draw upon my knowledge as a native speaker. 5 The Semitic determinant of Yiddish has the order na. Deĳiniteness is marked both on the head and the adjective. 6 Jacobs 2005 : 242. 468 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ position we encounter relative clauses with both ĳinite and non-ĳinite verb forms, adverbs, and prepositional phrases. Noun Phrases containing vos + postmodiĳier may occur in various syntactic positions in the clause, including subject, predicate and complement. The types of postmodiĳiers introduced by vos ( other than relative clauses ) are : A. vos + Past Participle Unlike full-fledged relative clauses introduced by vos, which will not be treated here since they are amply discussed in grammars and in special studies,7 the present type, in which vos introduces as modiĳier a reduced clause consisting of a past participle without a ĳinite verbform, is not mentioned anywhere in the linguistic literature. The introductory vos in this type is obligatory and cannot be deleted, just as it is indelible with a full-fledged relative clause.8 The ĳirst two examples come from the rather florid prose of the poet Avrom Sutzkever ( 1913 – 2010 ) : (1) yene parshoynen vos okersht nelem gevorn kon ikh those persons what just now vanished become-ppp know I nit. not ‘ Those persons who ’ ve just vanished I don ’ t know. ’ ( Sutzkever 1989 : 132 ) The past participle attested here derives from the periphrastic verb nelem vern, with Hebrew-origin invariant nelem ‘ vanished ’ and German-origin auxiliary vern ‘ become. ’ A full-fledged relative clause would require a 3pl form of the auxiliary zayn ‘ be ’ in the present tense : vos zaynen okersht nelem gevorn. (2) un tsvishn alte briv ( tsvishn zey a briv geshribn and among old letters among them a letter written oyf kore vos aropgeshundn fun a beryoze-boym… ) on bark what skinned-ppp from a birch-tree hot oyfgetsaplt a beygele papir mit gel-grin-fyoletove has startled a sheet-dim paper with yellow-green-violet 7 E. g. Lowenstamm 1977, Prince 1989, Diesing 1990. 8 Pace Jacobs 2005 : 238, quoting Lowenstamm 1977 : 214. The constructed examples given there, der man ø ikh ze ‘ the man ( whom ) I see ’ and der bokher ø ikh ze ‘ the lad that I see, ’ are nothing but plain anglicisms, not attested and unacceptable in Yiddish. Moshe Taube : Vos and Postmodiĳiers 469 ayngeziglte plyames in-sealed stains ‘ and among old letters ( among them a letter written on bark skinned from a birch-tree… ) startled a small sheet of paper with yellow-green-violet stains ’ ( Sutzkever 1989 : 126 ) The past participle here derives from the complex verb arop-shindn ‘ skin off ’ ( lit. ‘ skin down ’ ). A full-fledged relative clause would require a 3sg form of the auxiliary zayn ‘ be ’ in the present tense : vos iz aropgeshundn fun a beryoze-boym. The intimate afĳinity of this type with relative subordination is clearly visible in the following example from Sholem Aleichem ’ s ( Sholem Rabinovitsh, 1859 – 1916 ) Tevye the Milkman, where the np with vos is part of the predicate. (3) ikh bin, dakht mir, der eygener Tevye, zog ikh, vos geven, nisht I am thinks me-d the same Tevye say I what been not geminert a hor. reduced a hair ‘ I am, it seems to me, the same Tevye, I say, as before, not a hair missing. ’ ( Sholem Aleichem 1927 : 106 ) The next example comes from the autobiography of Sholem Aleichem titled Funem yarid ( From the Fair ). (4) du vest makhn a shtarb, veln kumen mentshn, vos meynen, az you will-sg make a die will-3pl come people what think as zey kenen dikh un veysn dikh, un veln oystrakhtn zakhn, they know thee and wit thee and will-pl invent things vos nit geshtoygn, nit gefloygn. what not risen-ppp not flown-ppp ‘ Should you die suddenly, there will come people who think they know you and will invent things that are completely untrue. ’ ( Sholem Aleichem 1937 c : 17 ) This sentence relates the argument raised by the author in trying to convince himself to write his autobiography. The two negated ppps ‘ neither risen nor flown ’ ( although the regular form of the ĳirst in Yiddish 470 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ is geshtign ), deriving respectively from the verbs shtaygn ‘ rise ’ and flien ‘ fly, ’ form a ĳixed collocation with the meaning ‘ completely untrue. ’ A similar example, with the same collocation truncated, is attested in Mendele Moykher-Sforim ’ s ( Sholem-Yankev Abramovitsh, 1835 – 1917 ) novel Fishke der Krumer, ĳirst published in 1868. (5) dort vert oykh zeyer oft geshlosn azelkhe miney, there becomes too very often concluded such-pl kinds-of shidukhim vos nisht geshtoygn. matches what not risen-ppp ‘ There, too, such kinds of unlikely marriages are very often arranged. ’ ( Mendele Moykher-Sforim 1953 : 37 ) B. vos + Adverb A second group of postmodiĳiers consists of adverbs. The introductory vos may sometimes, in noun phrases denoting ‘ the same n as adv, ’ alternate with the conjunction vi ‘ as ’ ( ex. 8 ). When the noun phrase denotes ‘ the n of adv, ’ vos may alternate with the preposition fun ‘ of ’ ( ex. 10 ). (6) vehasheynis, bin ikh dokh epes haynt, mit gots hilf, and secondly am I obviously somehow today with God ’ s help nit der Tevye, vos amol, kon ikh dokh shoyn greykhn tsum not the Tevye what once can I obviously already reach to+the shenstn shidekh aĳile in Yehupets, – ha, vi zogt ir ? nicest match even in Yehupets eh how say you ‘ And secondly, I ’m today, am I not, with God ’ s help, not the same Tevye as I once was, so I can attain the best match, even in Yehupets, right ? What do you think ? ’ ( Sholem Aleichem 1937 a : 67 ) (7) ikh hoyb oyf di oygn, ikh tu a kuk – Khave !… di eygene Khave, vos I lift up the eyes I do a look Khave the same Khave what frier, nisht geminert a hor, aĳile di malbushim nisht ibergebitn !… earlier not reduced a hair even the clothes not changed ‘ I lift my eyes up, I take a look – Khave !… the same Khave as before, not a hair missing, hasn ’ t even changed her clothes !… ’ ( Sholem Aleichem 1937a : 136 f ) Moshe Taube : Vos and Postmodiĳiers 471 (8) nishto di mentshn vos amol, gor nisht dos merkhets vi frier. not+here the people what once at all not the bathhouse as earlier ‘ Gone are the people of old, it is not at all the same bathhouse as before. ’ ( Mendele Moykher-Sforim 1953 : 34 ) (9) s ’ iz geven a gemlokhete “ in di hayzer arumgeyn, ” gor nisht der it ’ s been an artiĳicial in the houses going-around at all not the tam vos an andersh mol. taste what an other time ‘ It was a sham kind of “ going begging, ” not at all the same feeling as on other occasions. ’ ( Mendele Moykher-Sforim 1953 : 84 ) ( 10 ) un ikh dermon mikh on yener Beylke fun amol un ikh farglaykh zi and I recall me on that-f Beylke of once and I compare her mit der Beylke, vos atsind, un es tut mir hartsedik bang. with the Beylke what now and it does me heartily regret ‘ And I recall the Beylke of old and compare her with the Beylke of today, and I feel deep regret. ’ ( Sholem Aleichem 1937 a : 180 ) It is remarkable that vos here is interchangeable with the possessive carried by the preposition fun, both marking attribution.9 Demonstrative adverbs, such as do ‘ here ’ and dortn ‘ there, ’ when serving as postmodiĳiers, may appear without introductory vos. All examples come from Mendele ’ s ĳirst novel Dos kleyne mentshele ( 1864 ). ( 11 ) ale do in shtub hobn zikh lib gehat, hobn gehat gute all here in house have refl love had have had good hofenungen oyf shpeter, hopes on later un mit der hofenung gelebt dervayl zeyer gliklekh. and with this hope lived meanwhile very happily ‘ Everyone here at home loved each other, had good hopes for the future, and with that hope lived very happily meanwhile. ’ ( Mendele Moykher-Sforim 1913 : 148 ) 9 For the history of the term and its equivalents see Goldenberg 1998 : 46 f. 472 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ ( 12 ) di hakhnoses fun di kleytn dort un a teyl protsent funem the revenues from the shops there and a part percent from+the kapital, vos ikh loz iber oyf oylomes, zoln geyn oyf capital what I leave over on endowment shall go on to oystsuhaltn di beyde shuln. maintain the both synagogues ‘ The revenues of the shops there and some percentage of the capital that I leave as an endowment shall be used to sustain the two synagogues. ’ ( Mendele Moykher-Sforim 1913 : 129 ) ( 13 ) Leyzer iz geven farrekhnt in Bezlyudev far eynem fun di beste Leyzer is been considered in Bezludyev for one from the best shnayder, vos neyen nokh zhurnaln, un der arendar dort iz geven tailors what sew after journals and the lease holder there is been eyner fun di greste negidim, one from the greatest rich-pl ‘ In Bezludyev Leyzer was considered one of the best tailors, those who sew from magazine patterns, and the tenant farmer there was one of the wealthiest men. ’ ( Mendele Moykher-Sforim 1913 : 33 f ) ( 14 ) di vayber dort in der vaybersher shul hobn zikh shtark the women there in the womens ’ synagogue have refl strong dershrokn un in eyn otem geton a geshrey : oy, es brent !… scared and in one breath done a shout oy it burns ‘ The women there in the women ’ s section of the synagogue were very frightened and shouted in one voice : “ Oy, ĳire !… ” ’ ( Mendele Moykher-Sforim 1913 : 40 ) C. vos + Prepositional Phrase Prepositional phrases ( without vos ) regularly serve as postmodiĳiers in Yiddish, as they do in German ( as well as in Slavic languages and Hebrew ). For example, Der yid fun Bovl ‘ The Jew from Babylon ’ ( title of a story by Isaac Bashevis Singer ), A mentsh fun Buenos-ayres ‘ A Man from Buenos Aires ’ ( title of a story by Sholem Aleichem ), Di froy mitn ponim fun a tsveyter ‘ The Woman with the Face of Another ’ ( title of a story by Avrom Sutzkever ). Beside these, however, we also have equivalent pps preceded by vos, which raises two questions : 1. Is there a Moshe Taube : Vos and Postmodiĳiers 473 functional or semantic difference between the two ? and 2. What are the rules of distribution of the two patterns ? In order to examine these questions, let us look at the following pairs of examples : ( 15 ) – vifl, meynt ir, veln mir do khapn ? – fregt a vaybl a rabetine how much think you will we here catch asks a woman a freckly bay a [ sic ! ] andern vaybl mit a foygelsh ponim, un beyde by an other woman with a bird-adj face and both katshen geshmak. roll heartily – ikh rekhn tsu fertelekh, – entfert ir dos andere vaybl vos I reckon to quarters answers her the other woman what mit ’n foygelsh ponim. with+the bird-adj face – far vos nit tsu halbe kerblekh ? – zogt dos ershte vaybl, di rabetine. for what not to half-pl rubles says the ĳirst woman the freckly – meshuge vet zi vern ? tseteyln nayn kerblekh ? – zogt yene crazy will she become distribute nine rubles says that-f vos mit ’n foygelsh ponim. what with+the bird+adj face – far vos nit ? krank iz zi ? – zogt di rabetine. for what not sick is she says the freckly – loz zi zayn krank far mir un far ale yidn ! – zogt di vos let she be sick for me-d and for all Jews says this-f what mit ’n foygelsh ponim un tselakht zikh. with+the bird-adj face and laughs refl ‘ “ How much, d ’ you ĳigure, will we get ? ” a young freckly woman asks another woman with a birdlike face, and both go on rolling [ the dough ] with gusto. “ I reckon a quarter each, ” replies the other young woman with the birdlike face. “ Why not half a ruble each ? ” says the ĳirst woman, the freckly one. “ Do you think she ’ll go mad ? Mete out nine rubles ? ” says the one with the birdlike face. “ Why not ? Is she too sick to afford it ? ” says the freckly one. “ May she be sick for me and for all Jews ! ” says the one with the birdlike face and bursts out laughing. ’ ( Sholem Aleichem 1937 f : 78 ) ( 16 ) tsum ershtn mol oyf zayn lebn hot undzer held derzen azoy ĳil to+the ĳirst time on his life has our hero glimpsed so many 474 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ mentshn in shvartse frakn mit groyse portfeln. … ale loyfn mit people in black tail-coats with large briefcases all run with portfeln, der aher, der ahin, vi di meshugoim. eynem, a man briefcases this hither that thither as the madmen one-acc a man on a shvartsn frak, nor mit a groysn geln portfel un mit without a black tailcoat but with a large yellow briefcase and with zeyer a simpatish ponim, hot er gevagt optsushteln un a freg ton : very a pleasant face has he dared to-stop and an ask do “ vu iz do kupernik ? ” hot er bakumen funem man an entfer : where is here Kupernik ? has he received from+the man an answer “ tsu vos darft ir kupernikn ? ” to what need you Kupernik [ … ] er derzet dem man, vos mitn geln portfel. he spots the man what with+the yellow briefcase ‘ For the ĳirst time in his life did our hero see so many people in black tail coats with large briefcases. Everyone is running with a briefcase, one in this direction, one in the other, like madmen. One guy, without a black tailcoat, but with a large yellow briefcase, he did dare to stop and ask : “ Where is Kupernik here ? ” and got from the man the answer : “ What do you need Kupernik for ? ” [ … ] He spots the man with the yellow briefcase. ‘ ( Sholem Aleichem 1937 d : 247 ) ( 17 ) epes eyner a poritsl mit bloye briln krimt ir iber un zogt some one a dandy with blue glasses grimaces over her and says ir nokh mitn eygenem nign : Motl ! Motl !... her after with+the same melody Motl Motl er tsit zikh oys, vi lang er iz, un ruft zikh on tsum poritsl, he draws refl out as long he is and calls refl on to+the dandy vos mit di bloye briln what with+the blue glasses ‘ Some dandy with blue glasses mimics her and repeats after her with the same melody : „Motl, Motl !...“ He stretches to his full length and answers the dandy with the blue glasses ’ ( Sholem Aleichem 1937 b : 171 ) In all these pairs we encounter ĳirst a pp as postmodiĳier in an indeĳinite noun phrase, followed by a second occurrence of the same pp, this time in a deĳinite np. The rule to be derived from these examples is : The head noun and the pp agree in deĳiniteness : the head of the pp is indeĳinite when the head of the whole np is indeĳinite, and deĳinite when the head of the whole np is deĳinite. The possible variants are thus the following : Moshe Taube : Vos and Postmodiĳiers 475 a yid ( *vos ) mit a ( /*der ) bord ‘ a Jew with a beard ’ – ‘ a bearded Jew, ’ der yid vos / ø mit der ( /*a ) bord ‘ the Jew with the beard ’ – ‘ the bearded Jew. ’ The relativizing vos introducing the pp may thus appear only in a deĳinite np. We will, however, see further on that its appearance is optional. We observe an apparent deviation from the deĳiniteness alignment principle in cases where the head is an indeĳinite pronoun modiĳied by a deĳinite pp with the preposition fun ‘ from, ’ which in Yiddish has also assumed the partitive function previously carried by the obsolete genitive, e. g., eyner fun di negidim ‘ one of the rich. ’ This deviation is apparent only since the np as a whole is indeĳinite. In such cases, however, a further modifying pp, indeĳinite, in agreement with its head, may be introduced by vos. Thus in Mendele ’ s ĳirst novel we ĳind the two following examples : ( 18 ) – far vayber sforim ! – tut a shmeykhl eyner fun di negidim, vos for women books does a smile one from the rich-pl what mit a farkrimte esik-zoyere tsure. with a slanted vinegar-sour face ‘ “ Holy books for women ! ” smiles one of the rich, the one with a sour face like vinegar. ’ ( Mendele Moykher-Sforim 1910 : 76 ) ( 19 ) – nishkoshe, reb Fayvish, s ’iz far aykh, meyn ikh, nokh oykh genug not-hard R. Fayvish it is for you think I still also enough ibergeblibn – treyst im mit a biter shmeykhele eyner fun di remained comforts him with a bitter smile one from the negidim, vos mit a farkrimte, esik-zoyere tsure. rich-pl what with a slanted vinegar sour face ‘ “ Take it easy, R. Fayvish, there remains, I think, enough for you too, ” one of the rich, the one with a sour face like vinegar, comforts him. ’ ( Mendele Moykher-Sforim 1910 : 81 ) The presence of vos before a deĳinite pp, as has been said, is permissible, not obligatory. Thus, comparing the two great classics, Sholem Aleichem and Mendele, we observe that the former is consistent in preceding deĳinite pps with vos, whereas the latter is not. This could reflect dialectal differences. Compare the following examples : 476 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Sholem Aleichem : ( 20 ) “ ot-o yener, zogt zi, vos mitn hemdl, der iz gor a tatns a kind ; here that says she what with-the shirt this is all a dad ’ s a child er hot, zogt zi, avekgevorfn raykhe tate-mame in Yehupets, he has says she thrown-away rich-pl dad-mom in Yehupets vil nisht nemen bay zey keyn tsebrokhenem groshn. ” wants not take by them neg-art. broken-acc penny ‘ That one over there, she says, the one with the shirt, is, would you believe it, a child of a good family, has left his parents and does not want to take from them even a broken penny. ’ ( Sholem Aleichem 1937 a : 109 ) As against Mendele : Indeĳinite pp : ( 21 ) trogt der ruekh on a yunge orlte, a mekhoyeres, mit a tepl brings the devil on a young gentile-f a ugly-f with a pot pilinitses, dos beste laketke mayns. strawberries the best treat mine-neut ‘ Then the devil brings on a young gentile woman, a beauty, with a pot of strawberries, my favorite treat. ’ ( Mendele Moykher-Sforim 1953 : 19 ) Deĳinite pp without vos : ( 22 ) yene mit dem tepl pilinitses, gib ikh a blik, iz shoyn nishto, that with the-d pot strawberries give I a look is already not-here vi oysgetriknt gevorn. as drained become ‘ The one with the pot of strawberries, I notice, is gone, as if evaporated. ’ ( Mendele Moykher-Sforim 1953 : 20 ) Indeĳinite pp : ( 23 ) in shtub dreyt zikh arum a dike, a breyte, a horepashne moyd mit in house turns refl around a fat a broad a toiling maiden with Moshe Taube : Vos and Postmodiĳiers 477 a por bakn vi di pampeshkes ; oyfn kop zeyer veynik hor un a pair cheeks as the doughnuts on-the head very little hair and tsvey kleyne tsepelekh fun hintn. two small pigtails from behind ‘ In the house there hangs around a fat, broad, toiling maiden with a pair of cheeks like doughnuts ; very little hair on her head and two small pigtails in the back. ’ ( Mendele Moykher-Sforim 1953 : 54 ) Deĳinite pp without vos : ( 24 ) dervayl rukt zikh arayn yene breyte moyd mit di meanwhile slides refl into that-f broad maiden with the pampeshkes, oysgeputst shabesdik, un zetst zikh oykh tsum tish. doughnuts dressed up festive and seats refl also to+the table ‘ Meanwhile that young broad maiden with the doughnuts, all dressed up festively, slides in too and sits down at the table. ’ ( Mendele Moykher-Sforim 1953 : 54 ) The distinction of deĳiniteness cuts across that of attribution / predication. Thus a prepositional phrase following an indeĳinite det is not necessarily attributive. Compare the following pair of examples : ( 25 ) ikh hoyb on gut ayntsukukn zikh in di tsvey nefashes : nekeyves ; I heave on good look-into refl in the two creatures females eyne an eltere mit a zaydn tikhl oyfn kop, di andere one-f an older with a silken kerchief on+the head the other-f a yingere mit a parik. a younger-f with a wig ‘ I start having a good look at the two persons : females, one of them older, with a silk headscarf, the other a younger one with a wig. ’ ( Sholem Aleichem 1937 a : 21 ) Here the pp stands in apposition to a predicative adjp and is to be considered predicative as well. A few pages afterwards, the same pp appears as modiĳier following a deĳinite det head, with deĳiniteness marked on the preposition. Here again we encounter the optional preceding vos : 478 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ ( 26 ) ruft zikh on tsu mir di gvirte, yene vos mitn calls refl on to me-d the rich-woman that-f what with+the zaydn tikhl : … silken kerchief ‘ Then the rich woman, the one with the silk headscarf, says to me in reply : … ’ D. vos + quotation A special variety of postmodiĳier introduced by vos consists of a quotation integrated into the np. This seems to be an innovative pattern in Yiddish, since, unlike the examples of the previous paragraphs, which have equivalents in Slavic,10 to the best of my knowledge it is not attested in the co-territorial Slavic languages. Nor was I able to ĳind equivalents in other, unrelated languages. Compare the following pair of examples, in which the ĳirst carries the quotation proper as an independent utterance, ergo as a predicate, whereas the second has it embedded as a modiĳier into a np. ( 27 ) nisht gut tsu zayn a ben-yokhid, a tsiteriger bay tate-mame. “ fun not good to be a son only a trembling by dad-mom from zibn eyner geblibn ”. do – nisht shtey, dort – nisht gey. dos – nisht es, seven one left here not stand there not go. this not eat yens – nisht trink. that not drink ‘ It ’ s not good to be an only child, trembled over by Mom and Dad. “ From seven one remained ” [ so they always say ]. Don ’ t stand here, don ’ t go there. Don ’ t eat this, don ’ t drink that. ’ ( Sholem Aleichem 1937 e : 119 ) ( 28 ) nisht gut tsu zayn a ben yokhid, a tsiteriger, vos fun zibn eyner not good to be a son only a trembling what from seven one geblibn. remained ‘ It ’ s not good to be an only child, an over-protected one, the only one left of seven. ’ ( Sholem Aleichem 1937 e : 120 ) 10 See below, fn. 11. Moshe Taube : Vos and Postmodiĳiers 479 In the following pair of examples, the ĳirst carries the quotation as part of the predicate, whereas the second has it embedded as an attributive modiĳier into a np. ( 29 ) er hot gekoyft a bukh far a rubl. dos bukh heyst “ far a rubl he has bought a book for a ruble the book is-called for a ruble hundert ! ” er zitst un lernt im oyf oysnvenik. hundred he sits and learns it on outside ‘ He has bought a book for a ruble. The book is called For a Ruble a Hundred Rubles ! He sits and learns it by heart. ’ ( Sholem Aleichem 1937 b : 107 ) ( 30 ) az dos fesl iz gevorn ongeĳilt hekher halb, hot mayn bruder elye as the barrel is become ĳilled-up higher half has my brother Elye a zog geton : “ genug ! ” un hot zikh genumen tsum bukh, vos “ far a a say done enough and has refl taken to+the book what for a rubl – hundert .” ruble hundred ‘ When the barrel was over half ĳilled-up, my brother Elye said : “ Enough ! ” and turned to consult the book called For a Ruble – a Hundred Rubles. ’ ( Sholem Aleichem 1937 b : 109 ) To sum up, the examples show the degree of grammaticalization of the interrogative pronoun vos in Yiddish, which by far exceeds what we ĳind in German. Some of these developments are clearly related to the influence of the Slavic co-territorial languages,11 but there is also 11 Thus, modiĳiers consisting of pps are introduced by co ‘ what ’ in Polish, що schcho ‘ what ’ in Ukrainian, and што shto ‘ what ’ in Belorussian. Here are some samples adduced from the Internet : Polish : Szopka świąteczna, czyli życzenia dla tych, co na szczycie ‘ Christmas nativity scene, or wishes for those at the top ’ http ://www.wiadomosci24.pl/artykul/szopka_swiateczna_czyli_zyczenia_dla_tych_co_na_ szczycie_53264.html Po tym poszliśmy do mesy oĳicerskiej i wznieśliśmy toast za panią porucznik i za tych, co na morzu ! ‘ After that we went to the Ofĳicers ’ Mess and raised a toast to Mrs. Lieutenant and to those ( who are ) at sea ! ’ http ://kobiety-kobietom.com/opowiadania/art.php ?art=762 480 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ an important amount of originality in Yiddish, enlarging its range of functions and turning vos into a ‘ universal ’ marker of attributive status, equivalent to the status of az as ‘ universal ’ complementizer,12 the kind of originality that makes the study of Yiddish grammar so attractive and rewarding to linguists. Primary literature Mendele Moykher-Sforim ( Sholem-Yankev Abramovitsh ), 1910 : Dos kleyne mentshele. In : Ale verk fun Mendele Moykher Sforim. Vol. 2. Warsaw : Farlag Mendele. – 1913 : Dos kleyne mentshele. In : Ale verk. Vol. 6. Warsaw : Farlag Mendele. – 1953 : Fishke der krumer. In : Oysgeveylte verk. Vol. 1. Warsaw : Yidish Bukh. Sholem Aleichem ( Sholem Rabinovitsh ), 1937a : Tevye der milkhiker. In : Ale verk. Vol. 1. New York : Morgn-frayhayt. – 1937 b : Motl Peysi dem khazns. In : Ale verk. Vol. 13. New York : Morgn-frayhayt. – 1937 c : Funem yarid. Ershter teyl. In : Ale verk. Vol. 15. New York : Morgn-frayhayt. – 193 7d : Funem yarid. Tsveyter teyl. In : Ale verk. Vol. 16. New York : Morgn-frayhayt. Ukrainian : Убито директора черкаського ринку, що на вул. Сєдова ‘ Director of Circassian Market on Sedov Street Murdered ’ http ://pres-centr.ck.ua/forum3/viewtopic.php ?t=954 Їх привезли із села Новосілки, що у Золочівському районі. ‘ They were brought from the village Novosilky in the Zolochiv region. ’ http ://ukrainainkognita.org.ua/Ukr/Istoryko-kultur/zolochiv&zamok/zamok_ukr.htm Belorussian : Сёння, 28 жніўня, у кнігарні «Кніжныя крыніцы», што на вул. Бузковай 2 у Львове, адкрылася фотавыстава «Знішчаныя і забытыя львоўскія кнігарні». ‘ Today, August 28, [ a photo exhibition “ Destroyed and Forgotten Lviv Bookstores ”—either : “ the photo exhibition... ” or “ a photo exhibition, ‘ Destroyed and Forgotten Lviv Bookstores, ’ ” ] opened at the bookstore «Book Sources» at 21, Buzkov Street, Lviv. ’ http ://89.161.195.80/node/3662 Хоць прырода амаль тая самая, што ў Літве, [ ... ] ёсьць у Беларусі атракцыі, нязнаныя постсацыялістычным смаркачам. ‘ Although the nature is almost the same as in Lithuania, [ … ] there are in Belarus attractions unknown to the post-Socialist snotty-nosed upstarts. ’ http ://89.161.195.80/hachu-na-narach 12 Cf. Mark 1978 : 93 – 95. Moshe Taube : Vos and Postmodiĳiers 481 – 193 7e : “ Elyohu hanovi. ” In : Ale verk. Vol. 18. New York : Morgn-frayhayt : 119 – 124. – 193 7f : “ Der meylekh mit der malke, ” In : Ale verk, vol. 27. New York : Morgn-frayhayt : 74 – 88. Sutzkever, Avrom, 1989 : Di nevue fun di shvartsaplen : dertseylungen. Jerusalem : The Magnes Press. Secondary literature Behaghel, Otto, 1928 : Deutsche Syntax : Eine geschichtliche Darstellung. Vol. 3: Die Satzgebilde. Heidelberg : Winter. Bolinger, Dwight, 1967 : “ Adjectives in English : Attribution and Predication. ” In : Lingua 18 : 1 – 34. Diesing, Molly, 1990 : “ Verb Movement and the Subject Position in Yiddish. ” In : Natural Language and Linguistic Theory 8 : 41 – 79. Goldenberg, Gideon, 1995 : “ Attribution in Semitic Languages. ” In : Langues Orientales Anciennes : Philologie et Linguistique 5 – 6 : 1 – 20. Reprinted in Goldenberg 1998 : 46 – 65. – 1998 : Studies in Semitic Linguistics : Selected Writings. Jerusalem : The Magnes Press. Jacobs, Neil G., 2005 : Yiddish : A Linguistic Introduction. Cambridge : Cambridge. Krogh, Steffen, 2001 : Das Ostjiddische im Sprachkontakt : Deutsch im Spannungsfeld zwischen Semitisch und Slavisch. Tübingen : Niemeyer. Lowenstamm, Jean, 1977 : “ Relative clauses in Yiddish : A case for movement. ” Linguistic Analysis 3 : 197 – 216. Mark, Yudl, 1978 : Gramatik fun der yidisher klal-shprakh. New York : Congress for Jewish Culture. Prince, Ellen F., 1989 : “ Yiddish Wh- clauses, Subject-Postposing, and Topicalization. ” In : Joyce Powers and Ken de Jong, eds., Proceedings of the 5th Eastern States Conference on Linguistics ( escol ’88 ). Columbus, oh : Ohio State University, 403 – 415. Zaretski, Ayzik, 1926 : Praktishe yidishe gramatik far lerer un studentn. Moscow : Shul un bukh. Steffen Krogh How Satmarish is Haredi Satmar Yiddish ? 1. Introduction With the exception of the northeastern Yiddish of the Chabad-Lubavitch Jews and other, mostly minor, groups based in Jerusalem, Haredi Yiddish today is of Central or, to a lesser extent, Southeastern Yiddish provenance. The Satmar Jews, who, according to their tradition, originate from the so-called Unterland, hold a particularly prominent position among today ’ s Haredim. The Unterland mainly includes the low-lying country between the tributaries of the Tisa ( the Bodrog / Laborec and the Someş ) in the northwestern corner of Romania, in East Slovakia, and in Carpathian Ruthenia. In a wider sense, it also comprises the rest of Transylvania and the mountainous parts of East Slovakia and Carpathian Ruthenia. This is contrasted with the Oyberland, which incorporates ( present-day ) Hungary, West Slovakia and the Burgenland.1 The Unterland, in the narrower sense of the word, coincides largely with the formerly Hungarian counties of Szatmár, Máramaros, Ugocsa, Bereg and Ung. After World War i, the northern part of the Unterland ( East Slovakia and Carpathian Ruthenia ) was ceded to Czechoslovakia and the remaining parts to Romania. Carpathian Ruthenia, which in 1938 / 1939 came under Hungarian control as Carpatho-Ukraine, was annexed in 1945 to the Soviet Union and, in 1946, became part of Ukraine. The term ‘ Satmar ’ derives from the name of the town Satu Mare ( Hungarian Szatmárnémeti ), which has been part of Romania since 1920 and, during the interwar years, grew to become an important center for Hasidism. Haredi Jews usually name themselves after the Eastern and Central European towns where their respective Hasidic dynasties resided before World War ii. Since 1928 the Satmar Jews have been led by the Teitelbaum rabbinic dynasty. I am greatly indebted to Sarah Jennings and Peter Slomanson for proofreading the manuscript. My seven informants deserve special thanks for generously sharing their native Unterland Yiddish with me. 1 Weinreich 1964 : 249 f. 484 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ The focus of this paper is the Yiddish of the Haredi Satmar Jews living in and around New York City. The Satmars form the largest group among today ’ s Haredim and, therefore, occupy a key position in terms of the use of Yiddish. This is because they support and promote the use of Yiddish in daily life much more vigorously than all other Haredim. Consequently, they are behind most of the Haredi Yiddish-language publications appearing in and around New York City. Restricting observations to the New York City area is justiĳied, since this area is the most important place of residence, literacy and printing for the Satmar movement. Despite the fact that we refer to today ’ s Satmar community as ‘ Hungarian ’ in general and ‘ Satmar ’ in particular, these designations should not tempt us to view this group as an unbroken continuation of the Hasidim who lived in the Unterland before the war ; since its foundation by Joel Teitelbaum ( 1887 – 1979 ) in the late 1940s, the modern Satmar movement has included adherents originating not only from Hungary ( with its 1914 borders ), but also from Poland and Ukraine. However, anyone who has heard the Yiddish spoken by Satmar Jews in New York City today for themselves will be in no doubt that it is in the ĳirst place Central Yiddish and in the second place, for the most part, Unterland Yiddish. The following are the predominant characteristic features of Central Yiddish, as they appear in Haredi Satmar Yiddish : 2 1 ) Change of common Eastern Yiddish *ey to ay, e. g. *eydel > aydl ‘ polite, reĳined ’ , *geyn > gayn ‘ to go ’ , *sheyn > shayn ‘ beautiful ’ , *shteyn > shtayn ‘ stone ’ . 2 ) Monophthongization of common Eastern Yiddish *ay to a:, e. g. *tsayt > tsa:t ‘ time ’ . 3 ) Change of common Eastern Yiddish *au to ou, e. g. *aus > ous ‘ out ’ . 4 ) Diphthongization of common Eastern Yiddish *e: to ey, e. g. *le:ben > leybm ‘ to live.’ 5 ) Raising of common Eastern Yiddish *o: to u: that was subsequently, in part, shortened to u, e. g. *klo: r > klu: r ‘ clear ’ , *zo:gen > zugn ‘ to say.’ 6 ) Fronting of common Eastern Yiddish *u: and *u to i: and i, e. g. *bru: der > bri: der ‘ brother ’ , *gezunt > gezint ‘ healthy.’ 7 ) Change of common Eastern Yiddish *ou to oy, e. g. *vounen > voynen ‘ to live ’ , *grous > groys ‘ big ’ . 2 In this paper, the transcription of Yiddish follows the standard system devised by yivo Institute for Jewish Research. In the spoken Yiddish material, vowel length is indicated by a colon, and the sound [ ɣ ], a sandhi-conditioned variant of [ χ ], is rendered by the sign gh. Hungarian and Romanian loan words and names which occur in the spoken sequences without being phonetically integrated are italicized and in their traditional spelling. Steffen Krogh : How Satmarish is Haredi Satmar Yiddish ? 485 Within Central Yiddish, the apical r in all positions is a shibboleth of Unterland Yiddish. In the rest of Central Yiddish, the dorsal r, which is often dropped in ĳinal position, predominates. A systematic analysis of non-Haredi Unterland Yiddish and a corresponding description of modern Haredi Satmar Yiddish would help to clarify the relationship between the two idioms. The present paper attempts to ĳill this gap, at least partially, by comparing three grammatical traits in the two idioms mentioned. The evidence is drawn from two types of sources, which, at ĳirst glance, seem to be complementary. The ĳirst source comprises recent oral recordings of some of the last in situ informants, i. e. native speakers of Unterland Yiddish who, unlike the founders of the Haredi Satmar movement in America, never left their Transylvanian home grounds ( except for their enforced sojourn in German, Hungarian or Romanian concentration camps during World War ii and short-term visits abroad after the war ) and were never substantially exposed to any other variety of Yiddish than that of the Unterland. These recordings were conducted by this author in northwestern Romania in 2009, 2010 and 2011. The second source comprises recent published material in modern Haredi Satmar Yiddish from New York City. It could be argued that these two types of sources, both oral and written, are too different to form an informative unity. Ideally, using oral material exclusively would, of course, offer the safest ground for investigating the genetic bonds between original Unterland Yiddish and modern Haredi Satmar Yiddish. However, given that previous research in this ĳield is virtually non-existent, it seemed advantageous – as a preliminary to a more comprehensive survey on Haredi Satmar Yiddish – to consult written sources, which, with respect to the features I have set out to investigate, are not fundamentally different from what we would ĳind in oral material. The material on which the survey is based is a corpus that reflects, as broadly as possible, the diversity of the daily private and public written language of the Satmar community in New York City. It includes issues of the weekly newspapers ‫בלאט‬ ַ ‫דער‬, ‫דער איד‬ and ‫וואך‬ ָ ‫ דיע‬and an issue of the magazine ‫געדאנק‬ ַ ‫דער אידישער‬. The oral material from Romania consists of extensive interviews with seven native speakers of Yiddish, born between 1913 and 1926 in the Unterland ( in the wider sense of the word ), the area from where the core of the postwar Satmar movement is said to originate : Mr Gerson ( Gershn ) Schvarcz, b. 1913 in Érmihályfalva, then in Hungary, since 1920 Romanian as Valea lui Mihai, now residing in Oradea. 486 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Mr Eugen ( Menakhem-Yehude ) Grünfeld, b. 1920 in Zau de Câmpie, c75 km southeast of Cluj-Napoca, now residing in Cluj-Napoca. Mrs Margareta ( Malke ) Mezei, b. 1920 in Sighetu Marmaţiei, now residing in Oradea. Mr Mihai ( Avrom-Khaim ) Freundlich, b. 1921 in Baia Mare, deceased 2011 in Oradea. Mr Lazar ( Moyshe-Leyzer ) Freund, b. 1922 in Baia Mare, now residing in Oradea. Mr Eugen ( Yankev ) Krausz, b. 1923 in the village of Zoreni, near Sânmihaiu de Câmpie, c80 km northeast of Cluj-Napoca, now residing in Cluj-Napoca. Mrs Golda ( Goldi ) Salamon, b. 1926 in Sighetu Marmaţiei, where she still resides. Each of the informants was interviewed about his or her life, especially before the Holocaust, and was subsequently presented with a questionnaire containing a number of sentences and words in Hungarian, which he or she was asked to translate into Yiddish.3 All seven informants have native proĳiciency in Yiddish and ( standard ) Hungarian, as these were the languages in which they were brought up. In most cases, the state language, Romanian, was acquired later, typically in connection with formal education. With the exception of basic Russian, none of the informants speaks a Slavic language. 2. The Common Central Yiddish Basis The two idioms in question, Unterland Yiddish and Haredi Satmar Yiddish, are undoubtedly very closely related varieties of the same Yiddish dialect. Common to both of them is, for instance, the consistent replacement of a nominal indirect object by a prepositional phrase with far. This trait, which to many outsiders with a command of secular Yiddish has become a virtual hallmark of Haredi Yiddish,4 is also found in Polish Central Yiddish, but – according to my experience – merely as a rare variant construction.5 Only in Transcarpathian ( i. e. Unterland and 3 Not all translations provided by the informants were useful in the present investigation. In some cases, the translation proved inaccurate or did not elicit the desired construction (s). 4 On the spreading of this construction within contemporary Israeli Haredi Yiddish, where it is even used to mark historically direct objects, cf. Assouline, forthcoming. 5 It is generally agreed on that the dative is a more marked case than the nominative and the accusative. The innovation in question may have been triggered by a desire to indicate this higher degree of markedness by means of iconicity. The device was a prepositional Steffen Krogh : How Satmarish is Haredi Satmar Yiddish ? 487 Oyberland ) 6 Yiddish is it the canonical means of forming a nominal indirect object. Examples occur in the written Haredi Satmar Yiddish sources as well as in the Yiddish of my seven informants. Examples occurring in the written Haredi Satmar Yiddish sources include : • der porets hot fardingen mit a sheyne por yor tsurik, zayn kretshme far a id do in dorf ‘ The landowner rented his inn here in the village to a Jew a couple of years ago ’ Di vokh : 6 ( 2 ). • take dos hot untergezogt far hitler ’ n az di velt iz tsufridn mit vos er tut ‘ The very same thing prompted Hitler to think that the world was content with what he did ’ Der idisher gedank : 60 ( 2 ). • shpeter [ … ] hobn idishe aktivistn zeyer asakh aroysgeholfn far di shvartse bafelkerung tsu bakemfn di natsyonale diskriminatsye kegn zey ‘ Later Jewish activists helped the black population very much in ĳighting national discrimination against them ’ Der blat : 12 ( 3 ). • derfar kedey tsu vayzn far ’ n kenig az dos iz nisht rikhtig, hot mordkhe hatsadek gebetn dem kenig er zol gebn reshus az idn zoln zikh aroysshteln un nekome nemen fun zeyere sonim ‘ Therefore, Mordecai Hatzadik – to show the king this was not right – asked the king to permit the Jews to rise and take revenge on their enemies ’ Der id A : 55 ( 1 ). In the spoken Yiddish of my seven informants we ĳind : Schvarcz : • ( In reply to the question tshaushesku ? [ Ceaușescu ? ] ) er iz geveyn a giter mentsh – yo – er hod gegeybm ales far de yi :dn ( 1. 06 ) ‘ He was a good man – yes – he gave the Jews everything ’ Grünfeld : • in der za :t transilvanye vus i ibergegeybm gevorn far [ … ] ungarn ( ii. 1. 07 ) ‘ in the part of Transylvania that was ceded to Hungary ’ phrase with far – a construction widely used in Yiddish to express notions of benefactivity and malefactivity. Hungarian is not likely to have played a part in this process since Hungarian does not use prepositions at all. 6 Cf. Weinreich 1964 : 257 f. 488 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Mezei : • vuz zol igh zogn far da :n khusn ? ( 0. 55 ) ‘ What shall I say to your ĳiancé ? ’ • va :l dus hod gefeln far yeydn ( 1. 18 ) ‘ because this [ story ] used to please everybody ’ Freundlich : • gh dertsayl es far ale yi :dn ( ii. 0. 11 ) ‘ I say it to all Jews ’ • dus ken ikh nisht moykhl za :n – nisht far got ( ii. 0. 18 ) ‘ For that I cannot forgive God ’ Freund : de houz indzere hot men gegeybm far de doytshe ( 0. 21 ; the informant ’ s Yiddish rendition of Hungarian Odaadták a házat a németeknek ) ‘ Our house was given to the Germans ’ Krausz : • des houez hot men jedzd gegeybm far de doytshn ( ii. 0. 26 ; the informant ’ s Yiddish rendition of Hungarian Odaadták a házat a németeknek ) ‘ The house has now been given to the Germans ’ Salamon : hob igh gezukt far de mi :me ( iii. 1. 12 ) ‘ Then I said to my aunt.’ In both corpora far is also used with personal pronouns, e. g. : • mayn meynung iz : dos men darf dos yo vayzen far ir ‘ My opinion is that you should show it to her ’ Di vokh : 12 ( 3 – 4 ). • de ba :be ester ho gezukt far mir ( Salamon, i. 1. 41 ) ‘ Grandma Esther said to me.’ There can be no doubt that the innovation that underlies this feature by far predates the Holocaust.7 Given that it is ĳirmly established, not only 7 In songs in Oyberland Yiddish, edited by Taglikht in 1929 ( based on his recollection of yeshivah students performing them c50 years earlier ), there are instances of this construction, e. g. zugts niks ous far kanem ‘ Don ’t tell anybody anything ’ ( Taglikht 1929 : 300 ). Steffen Krogh : How Satmarish is Haredi Satmar Yiddish ? 489 in the Unterland, but also in the Oyberland, and that it is also attested in the rest of the Central Yiddish area, the innovation must have had a much wider geographical range than commonly thought. Today, the origin of the feature is being obscured by the fact that the other Yiddish dialects for which it used to be characteristic have either vanished or are on the verge of extinction. 3. Features Characteristic of Haredi Satmar Yiddish The features that distinguish, or appear to distinguish, Haredi Satmar Yiddish from its ancestral dialect in Transylvania are found primarily within the domain of lexicon8 and syntax. In the sections 3. 1 and 3. 2, I provide a description of two selected syntactic traits which are generally considered typical of Haredi Satmar Yiddish, and which are indicative of the complex development this variety of Yiddish has undergone since it started evolving in the postwar years. 3. 1 Loss of gender and case distinctions One of the most striking features of Haredi Satmar Yiddish, not only in America, but also in other parts of the world,9 is the extensive loss of gender and case distinctions in the inflection of the deĳinite article, attributive adjectives, certain pronouns ( particularly yeder ‘ every,’ yener ‘ that,’ and velkher ‘ which ’ ) and the numeral eyner ‘ one.’ In spoken language, this syncretism has developed to such an extent that the overall form of the deĳinite article is [ də ] and the forms mentioned before end in [ ə ], regardless of gender, case and number. In written language, this state of affairs is reflected in extensive morphological vacillation. In written usage, the most frequent forms of the deĳinite article are di and der, and the most frequent sufĳixes of the other words are -e and -er. It is this feature in particular that has given Haredi Satmar Yiddish the reputation of being deviant and corrupted Yiddish. The analyzed material shows abundant evidence of this syncretism. A few examples will sufĳice to demonstrate this point : • [ ... ] di hunderter khsidim, vos hoben gehat dem groyse skhie onteyl tsu nemen ‘ [ … ] the hundreds of Hasidim that had the great honor to attend ’ Di vokh : 3 ( 1 ). • kristal nakht, dos ershter oĳitsyeler blut-bod vos di daytshe khayes yimakh shmom hobn durkhgeĳirt oyf idn ‘ Kristallnacht, the ĳirst ofĳi8 9 Cf. Krogh, forthcoming. On Haredi Satmar Yiddish in Great Britain, cf. Mitchell 2006 : 101 – 108. 490 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ cial bloodbath that the German beasts – may their names be erased – perpetrated on the Jews ’ Der idisher gedank : 59 headline. • dem diner hot zikh geendigt mit gor groys khizek far ale askonim ‘ All the leaders felt very fortiĳied after the dinner,’ literally : ‘ The dinner ended with very great strengthening for all the leaders ’ Der blat : 110 ( 5 ). • es iz take der legitimer balebos velkhe prubirt dos tsu nutsn ‘ It is the legitimate holder himself that is trying to use it ’ Der id A : 39 ( 2 ). In Unterland Yiddish, by contrast, nominal phrases are generally seen to be morphologically ‘ intact.’ Compare the following examples : Schvarcz : • mir hobm gehat a groysn hoyf ( 0. 5 ) ‘ We had a large yard ’ • igh gedenk nokh ha :nt – dem khazn vos hod gezingen ( 0. 15 ) ‘ Today I still remember the cantor that sang ’ • yonkiper i geveyn a groyser tuk ( 0. 18 ) ‘ Yom Kippur was a great day ’ • in der gantser veld zenen zey avek – de yi :dn – spetsyal in ame :rike ( 0. 38 ) ‘ They dispersed into the whole world, the Jews, especially to America ’ Grünfeld : • igh bin geveyn ba der rumeynisher armey ( ii. 0. 10 ) ‘ I was in the Romanian army ’ • s iz a dorf nor a greserer dorf ( ii. 0. 15 ) ‘ It is a village, but quite a large one ’ • demols is is 10 farbrend gevorn dez beyshamigdesh ( ii. 0. 58 ) ‘ Then the Temple was burnt down ’ • yeydn yu :r brenkt men arous a nayem kalendar ( ii. 1. 00 ) ‘ Every year a new calendar is released ’ 10 Words which were repeated for reasons of hesitation or uncertainty and words which were articulated erroneously and instantly corrected by the informants are not included in the present English translation. Steffen Krogh : How Satmarish is Haredi Satmar Yiddish ? 491 Mezei : • azoy zemer geblibm biz de letste tsa :t ven m ot – de :m gantn la :ger – ouzgelert ( 0. 3 ) ‘ Thus we stayed until the end when the entire camp was emptied ’ • me hot indz gegeyn an ander klayt ( 0. 9 ) ‘ We were given a different dress ’ • z od gebrenkt – a a aza grousn top mit kartofln ( 0. 35 ) ‘ She brought a big pot with potatoes ’ • dem andern tok fri : gayt ara :n de di :nst in ba :detsimer in treft aynem shlufn ( 1. 11 ) ‘ The next day the maid enters the bathroom and ĳinds somebody sleeping ’ Freundlich : • yeydes leybm iz a iz a ekstere a ekstere mayse ( i. 0. 23 ) ‘ Every life is a special story ’ • varem vaser maghd dem mentsh – shvekher ( ii. 0. 0 ) ‘ Warm water makes a person – weaker ’ • zemer gekimen ĳin der mikve ( ii. 0. 13 ) ‘ We returned from the mikva ’ • dus iz an ingerisher [ … ] ma :khl ( iii. 0. 0 ) ‘ This is a Hungarian dish ’ • er hod genimen a shi :tef an ingerishn ( iii.0.8 ) ‘ He chose a Hungarian business partner ’ Freund : • yeyder khayder hod gehad za :n melamet ( 0. 4 ) ‘ Every elementary school had its own teacher ’ • du iz geveyn a yidisher litse :um ( 0. 6 ) ‘ Here was a Jewish high school ’ • ĳin der pri :vung direkt tsin – ara :ngenimen tsim arbet ( 0. 7 ) ‘ From the exam straight to – drafted to labor ’ • in satmar iz er geveyn der ru :f ( 0. 9 ) ‘ In Satu Mare he was the rabbi ’ 492 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Krausz : • ba der yi :disher comunitate vurt ir ? ( i. 0. 11 ) ‘ Were you at the Jewish Community Center ? ’ • er tid zikh farnemen mid dem besoylom ( i. 0. 11 ) ‘ He takes care of the cemetery ’ • er iz – geveyn – a a komunist – a groyser komunist ( i. 0. 30 ) ‘ He was – a communist – a great communist ’ • varem vaser ( i. 1. 00 ) ‘ Warm water ’ • ven du : de fakultate bolyai hot ibergenimen yenem yenem local ( ii. 1. 25 ) ‘ When here the Babes-Bolyai University took over the other building ’ Salamon : • homer gehat a groysn gu :rtn du : nogh der shti :p ( i. 0. 30 ) ‘ We had a large garden here next to the house ’ • yo dem telefon vil ikh a :gh geybm ( i. 2. 23 ) ‘ Yes, I will give you my telephone number ’ • dem aynen zayde hob ikh yo gekent – zayde yankl ( ii. 0. 22 ) ‘ I did know one grandfather – Grandpa Yankl ’ • der rebay ĳin groyzveda :n i geveyzn ov der lavaye ( ii. 0. 36 ) ‘ The rabbi from Oradea attended the funeral ’ • zemer geganen yeydn inderfri tsi der arbet ( iii. 0. 35 ) ‘ Every morning we went to work ’ • ze hobn du : an aygenem bu :t in a shil in a hotel ( iii. 1. 09 ) ‘ Here they have a bath of their own and a synagogue and a hotel ’ • des fenster i geveyn tsi der gas ( iii. 1. 51 ) ‘ The window faced the street ’ • ikh l dir zugn tsi velekhen dokter de zolzd gayn ( iii. 1. 52 ) ‘ I will tell you to which doctor you should go.’ Steffen Krogh : How Satmarish is Haredi Satmar Yiddish ? 493 However, examples that contrast with Standard Yiddish usage also occur in the Yiddish of all seven interviewees. These examples are mainly instances of the deĳinite article in the form de, which is used invariantly in the entire singular and plural. It must have spread from the nominative and accusative singular feminine and from the plural, where it is the original form ( Standard Yiddish di ), to the rest of the paradigm. When de is followed by an attributive adjective, this adjective often ends in the likewise invariant inflectional morpheme -e. Other determiners, such as yeyder, yener and vel (e) kher, can also end in this -e. Compare the following examples : Schvarcz : • egh bin geboyrn in a shteytl ober de shteytl iz a shtot ( 0. 1 ) ‘ I was born in shtetl, but the shtetl is a town ’ • de hoyf iz ĳi :l geveyzn mit layt ( 0. 5 ) ‘ The yard was full of people ’ • de numen gedenk ikh nisht ( 0. 16 ) ‘ I don ’t remember the name ’ Grünfeld : • ikh ho gelernt in de talmettoyre ( i. 0. 20 ) ‘ I was studying in the Talmud Torah ’ • in yene fabri :k vi ikh hob gearbet ( i. 0. 21 ) ‘ In that factory where I used to work ’ • tse velekhe gru :p halt ikh ? tse velekhe khsidishe gru :p geher ikh ? ( i. 0. 31 ) ‘ Which group do I stay with ? Which Hasidic group do I belong to ? ’ • de rebe d gehaysn – listig zayn – trinken bromfn nisht kan vayn ( i. 0. 40 ) ‘ The rabbi ordered : Be cheerful ! Drink liquor, no wine ! ’ • in ĳiftsik iz arouz der tate mid de klayne shvester ( i. 1. 33 ) ‘ In ’50 my father left [ the country ] with my little sister ’ • ho gedarft arbetn far de armey ( ii. 0. 8 ) ‘ I had to work for the army ’ 494 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Mezei : • azoy zemer geblibm biz de letste tsa :t ven m ot – de :m gantn la :ger – ouzgelert ( 0. 3 ) ‘ Thus we stayed until the end when the entire camp was emptied ’ • zolmer zikh arolaygn in de kokh ( 0. 34 ) ‘ so that we can lie down into the kitchen ’ Freundlich : • a plats [ … ] far de esn ( i. 0. 11 ) ‘ a place to eat ’ • de sotsyalizm iz hod gehad zayne khatuim ( i. 0. 24 ) ‘ Socialism had its flaws ’ • in yeyde vokh hod zi gemakht [ … ] in der haym dray mu :l broyt ( ii. 0. 9 ) ‘ She would bake bread three times a week at home ’ • de mame iz arouzgekimen in [ … ] de gas ( ii. 0. 14 ) ‘ My mother came out into the street ’ • de tate hot indz gedekt far de mame ( ii. 0. 14 ) ‘ My father would screen us from my mother ’ Freund : • de letste mu :l ( 0. 1 ) ‘ the last time ’ • de tate in de mame ? ( 0. 1 ) ‘ My father and my mother ? ’ • de houz hot men gegeybm mir ( 0. 21 ) ‘ The house was given to me ’ Krausz : • ints hobmer gehat ĳin de federaţie deys plats ( ii. 1. 26 ) ‘ We got this place from the Federation [ of the Jewish Communities in Romania ( fjcr ) ] ’ Salamon : • demls bin ikh ayn yu :r gegan n de ungarishe shul ( i. 0. 42 ) ‘ Back then I went to the Hungarian school for one year ’ Steffen Krogh : How Satmarish is Haredi Satmar Yiddish ? 495 • hob igh gezukt far der doktern az [ … ] ov de linkn oyg zey ikh nisht azoy git ( i. 2. 17 ) ‘ I said to the doctor that I don ’t see that well in my left eye ’ • er hot ibergemaghd de gantse houz ( ii. 0. 14 ) ‘ He renovated the entire house ’ • yo – hob ikh a bilt ĳin de tate in ĳin de mame ( ii. 0. 16 ) ‘ Yes, I have a picture of my father and my mother ’ • dey frou velokhe kh hob ir gemaghd de hu :r ( iii. 0. 38 ) ‘ The woman whose hair I used to do ’ • in shul bin igh gegan in de ershte klas ( iii. 0. 42 ) ‘ At school I was in ĳirst grade ’ • hob igh gezukt far de mi :me – di host a tokhter – makh da :n tokhter khasene tsi de shna :der nisht mikh ( iii. 1. 12 ) ‘ Then I said to my aunt : You have a daughter, marry off your daughter to the tailor, not me ’ • ir vayst az [ … ] dey khasi :dishe velkhe ze kimen gayn nisht ara :n in de sfardishe shil ( iii. 1. 17 ) ‘ You know that the Hasidim that come don ’t enter the Sephardic synagogue ’ • er hot nor direkt azoy gezukt – de gantsn veyk ( ii. 1. 48 ) ‘ He said that directly – all the way.’ Apart from instances in which the deĳinite article was reduced for obvious phonetic reasons, e. g. before a homorganic consonant in in dem ba :detsimer → in de ba :detsimer ( Salamon, iii. 1. 05 ) ‘ in the bathroom ’ , it was not possible to determine why the informants chose to inflect regularly in some cases but not others. In this respect, the Central Yiddish of the Unterland adopts an intermediate position between the more northern Central Yiddish, in Poland, in which case syncretism is obligatory in the entire feminine singular ( Polish Central Yiddish uniform de versus Standard Yiddish di, di, der ),11 and Haredi Satmar Yiddish in America, in which gender and case syncretism, as was shown above, has been generalized to the entire paradigm of determiners and to all attributive adjectives. Although the Unterland Yiddish and the Haredi Satmar Yiddish system differ considerably, there can be no doubt that the latter merely represents a more advanced stage of the former. 11 Cf. Herzog 1965 : 130 ĳig. 4 : 42. 496 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Given the fact that, in terms of the inflection of the deĳinite article and the other words mentioned, Haredi Satmar Yiddish strongly resembles coterritorial English, it is possible in theory that the development that led to the present state of affairs in Haredi Satmar Yiddish was triggered by the rule of not inflecting determiners and attributive adjectives in English. However, it is important to note that, in the inflection of the attributive adjective, Haredi Satmar Yiddish adds an ending, a schwa, not a zero, as in English. The point of departure for the development in Haredi Satmar Yiddish is, therefore, more likely to have been the syncretism that existed without having been fully developed in the Yiddish brought to America after World War ii by the founders of the Haredi Satmar movement. 3. 2 Pronominal reference In Standard Yiddish, as well as in the Eastern European Yiddish dialects, the personal pronouns er ‘ he ’ and zi ‘ she ’ refer to masculine and feminine antecedents, regardless of whether they are human or nonhuman. Consequently, they can refer not only to der man ‘ the man ’ and di froy ‘ the woman ’ respectively, but also to der vorem ‘ the worm ’ and di moyz ‘ the mouse ’ and even to der zeyger ‘ the clock ’ and di vant ‘ the wall.’ In the Haredi Satmar Yiddish of New York City, however, er and zi refer almost exclusively to human antecedents, whereas all other nouns are replaced by the formal neuters es ‘ it ’ and dos ‘ that ’ . Compare the following examples ( the relevant neuter pronouns in small caps ) : • ven a mentsh kumt tsum heyligen khoyze, nemt er zayn neshome un vasht dos oys un reynikt dos fun yede shmits un rost ‘ When a man visits the Holy Seer, he takes his soul and washes it and cleans it of any dirt and rust ’ Di vokh : 19 ( 1 ). • “ ikh bin oyf aykh goyzer az als pikuekh nefesh zolt ir esn dem zup, ” der rebe hot keyn breyre nisht gehat un er hot dos gegesn ‘ “ I order you, in accordance with the commandment to save a life, to eat the soup ” ; the rabbi had no choice but to eat it ’ Der idisher gedank : 29 ( 1 ). • er hot geshribn az bloyz er, teri nikols, maykl fortyer un zayn froy hobn gevust detaln fun di atake eyder er hot es durkhgeĳirt ‘ He wrote that only he, Terry Nichols, Michael Fortier and his wife knew details about the attack before he carried it out ’ Der blat : 115 ( 5 ). • nokh an interesante teve vos di vol farmogt, dos ven es tsit arayn in zikh flisigkayt, blaybt es nisht ineveynig oyf lang, un es geyt oykh Steffen Krogh : How Satmarish is Haredi Satmar Yiddish ? 497 nisht tsurik aroys di flisigkayt fun vu es kumt orginal ‘ Another interesting quality wool has is that, when it absorbs liquid, it does not stay in there for long, and the liquid does not go out again to where it originally came from ’ Der id A : 31 ( 3 ). At ĳirst glance, it would seem reasonable to conclude that this change must have occurred as a consequence of the comprehensive gender and case syncretism in Haredi Satmar Yiddish mentioned above. When gender and case distinctions are lost, the traditional agreement in gender between a pronoun and its antecedent becomes irrelevant, and a new differentiation between human and non-human emerges, which makes reference to non-human entities by means of a neuter pronoun preferable. Comparable changes have taken place in several other modern Germanic languages, ĳirst and foremost English. Even the secular Yiddish spoken in New York City tends to favor es instead of er and zi when reference is being made to non-human antecedents, as can be seen from innumerable examples in the ‫ארווערטס‬ ָ . In secular Yiddish in New York City, however, the change must have come about for other reasons, most notably the influence of English, because this variety of Yiddish has not undergone the radical gender and case syncretism that characterizes Haredi Satmar Yiddish. The Unterland Yiddish of my seven informants displays an ambiguous picture regarding pronominal reference. At ĳirst glance, it seems to be in accordance with Standard Yiddish, showing examples like the following ( the relevant pronouns are in small caps ) : Grünfeld : • dort iz der hunt – mit tsvay yu :r tserik hob ikh eym gekoyft ( ii. 1. 28 ; the informant ’ s Yiddish rendition of Hungarian Ott van a kutyám. Két évvel ezelőtt vettem ) ‘ There is the dog – I bought it two years ago ’ • dort iz ma :n kats – mit tsvay yu :r tserik hob igh zi gekoyft ( ii. 1. 29 ; the informant ’ s Yiddish rendition of Hungarian Ott van a macskám. Két évvel ezelőtt vettem ) ‘ There is my cat – I bought it two years ago ’ Krausz : • s iz nisht kayn shtut – zi hayst azoy – Sânmihaiu de Câmpie ( i. 0. 0 ) ‘ It ’ s not a town – it ’ s called like this – Sânmihaiu de Câmpie ’ 498 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ • s a medikamentfabrik a groyse medikamentfabrik in yerusholaim – zi hot a a ĳilial in ungarn oukh ( i. 0. 5 ) ‘ It ’ s a pharmaceutical company, a large pharmaceutical company in Jerusalem – it has a branch in Hungary as well ’ • de shil – ze hot iber hindert yu :r ( i. 0. 43 ) ‘ The synagogue – it ’ s more than a hundred years old ’ • er iz gepaygert ( i. 1. 08 ) ‘ It died ’ ( about a faygl ‘ bird ’ mentioned in an earlier sentence ) • de kats – far tsvay yu :r hob igh ze [ … ] gekouft ( ii. 0. 23 ; the informant ’ s Yiddish rendition of Hungarian Ott van a macskám. Két évvel ezelőtt vettem ) ‘ The cat – I bought it two years ago ’ Salamon : • er i nisht kan shlekhter hint ( i. 1. 45 ) ‘ He is not a bad dog ’ • du gayd der tsug vus er fu :rt kayn klouznburk ( i. 1. 48 ) ‘ There is the train that goes to Cluj-Napoca ’ • igh geb em dem gu :rtn er zol em haltn ( i. 1. 49 ) ‘ I leave the garden to him so that he can tend it ’ • de kafe ĳin ame :riko hob ikh nisht lip n ikh tring ze nisht ( iv. 0. 1 ; the informant ’ s Yiddish rendition of Hungarian Az amerikai kávét nem szeretem. Nem iszom meg ) ‘ I don ’ t like coffee from America, and I don ’ t drink it.’ However, the informants also use the neuters es and dus ( des, deys ) when referring to non-human antecedents in the masculine or feminine 12 ( the relevant neuter pronouns are in small caps ) : 12 The determination of the ‘ proper ’ gender of a noun must be based on what is generally known about the gender of that noun in Eastern Yiddish, especially Central Yiddish ( cf. Viler 1926 ), and on the possible testimony of determiners and attributive adjectives, e. g. dem + -(e) n ( in the accusative ) and der + -er excluding neuter gender. The determination of the gender of nouns in Unterland Yiddish poses some fundamental problems. Firstly, it is not always possible to deduce the gender of a noun from its grammatical surroundings. Determiners and attributive adjectives may be lacking, and even if they are present, they may provide ambiguous or no information about the gender of the noun, cf. the remarks above on the invariant article de and the corresponding adjectival ending -e. Secondly, the gender of a noun may vacillate due to influence from Hungarian which lacks grammatical Steffen Krogh : How Satmarish is Haredi Satmar Yiddish ? 499 Grünfeld : • trinken bromfn – yo – in deys trinken de khasi :dim trinken de de mayste ĳin du – bromfn – darf ez za :n ĳin israel – zay zugn deys is ku :sher ( i. 0. 41 ) ‘ Drink liquor, yes, and the Hasidim drink that, most people from here drink that – liquor. It must be from Israel. They say that is kosher ’ • de khasi :dim fleygn deys deys trinken – de dem sli :vovits ( i. 0. 42 ) ‘ The Hasidim used to drink that, the Slivovitz ’ • deys i geveyn ale mu :l ku :sher – der sli :vovits ( i. 0. 42 ) ‘ That has always been kosher, the Slivovitz ’ Mezei : • bam mituk hot men gebrenkt a supe – dus hod gekritst inter de – tseyn va :l s i geveyn ĳil mit [ … ] bleter ( 0. 7 ) ‘ At noon a soup was served. It scratched behind the teeth because it was full of leaves ’ • vuser glig de :r hod gehad ven shtaufnberk hot em gelaygd de bombe dortn – ayner hot es avegerikt in yener iz geshtorbm ( 0. 42 ) ‘ How lucky he was when Stauffenberg put the bomb there next to him. Somebody removed it, and the other one died ’ Freundlich : • de sotsyalizm iz hod gehad zayne khatuim – ober [ … ] es hod gehad zayne zayne avantazhn ( i. 0. 24 ) ‘ Socialism had its flaws, but it had its advantages ’ • in gu :rtn iz a boym – igh zey es ĳin du ( i. 0. 31 ; the informant ’ s Yiddish rendition of Hungarian A kertben van egy fa. Innen látom ) ‘ There is a tree in the garden. I see it from here ’ • dort iz mayn kats – ikh hab [ ! ] ez gekoyft ĳin – shoyn tsvay yu :r ( i. 0. 33 ; the informant ’ s Yiddish rendition of Hungarian Ott van a macskám. Két évvel ezelőtt vettem ) ‘ There is my cat – I bought it two years ago ’ gender and gender-speciĳic pronouns ( also noted by Weinreich 1964 : 261 f ). In some cases, the gender of a noun may have switched to neuter, which would account for why that noun is represented by es and dus ( des, deys ) in a given context. 500 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Freund : • er hod zigh gebrenkt ĳin ouslant skhoyre – hot er des farkoyft ( 0. 5 ) ‘ He used to bring goods from abroad. Then he sold them ’ • in gu :rtn iz a boym – igh zey es ĳin du ( 0. 18 ; the informant ’ s Yiddish rendition of Hungarian A kertben van egy fa. Innen látom ) ‘ There is a tree in the garden. I see it from here ’ • dort iz ma :n kats – far tsvay yu :r hob ikh ez gekoyft ( 0. 19 ; the informant ’ s Yiddish rendition of Hungarian Ott van a macskám. Két évvel ezelőtt vettem ) ‘ There is my cat – I bought it two years ago ’ Krausz : • de shil – ze hot iber hindert yu :r – nor me hot s ibergemakht [ … ] s iz geveyn bombardirt ( i. 0. 43 ) ‘ The synagogue – it is more than a hundred years old – but it has been renovated. It was bombed ’ • s iz nokh kolt – der zip ( ii. 0. 1 ) ‘ It is still cold, the soup ’ • in gu :rtn iz du ayn boym – igh zey es ĳin du ( ii. 0. 22 ; the informant ’ s Yiddish rendition of Hungarian A kertben van egy fa. Innen látom ) ‘ There is a tree in the garden. I see it from here ’ • der epl iz nizhd gut [ ! ] – es es nisht ouf ( ii. 0. 22 ; the informant ’ s Yiddish rendition of Hungarian Az alma nem jó. Ne edd meg ! ) ‘ The apple is not good. Don ’t eat it ! ’ de shil broukht tse bla :bm azoy vi s iz geveyn [ … ] ze hobn s renovirt hobn s reparirt ( ii. 1. 27 ) ‘ The synagogue should remain as it used to be. They renovated it, repaired it ’ Salamon : • s i du a yi :dishe tsaytung – of ayn za :t shra :pt es rumeynish in ov der anderer za :t shra :pt es yi :dish ( i. 0. 40 ) ‘ There is a Jewish newspaper. On one page it is written in Romanian, and on the other it is written in Yiddish ’ • ikh hob a groysn gu :rtn – igh gib es iber far a goy velokher er koset in er farkoyft – igh darf nizhd gu :rnisht ĳin dortn vayl ikh hob es nisht mid veymen tsi baarbetn ( i. 1. 0 ) ‘ I have a large garden. I leave it to a goy who cuts [ the grass ] and sells [ the fruit and vegetables ]. I don ’t need anything from there because I don ’t have anybody to cultivate it with ’ Steffen Krogh : How Satmarish is Haredi Satmar Yiddish ? 501 • me ho gemakht a ĳilm – a frou ĳin baya ma :re ĳin du – a ĳilm – z i gekimen ahe :r in in dra :y ĳi :r mu :l hot men ez gevizn in televízió – dem ĳilm ( i. 1. 42 ) ‘ A ĳilm was made. A woman from Baia Mare from here – a ĳilm. She came here, and three or four times it was shown on television, the ĳilm ’ • des iz zayer shta :rk ( ii. 0. 6 ) ‘ It is very strong ’ ( with reference to broufn ‘ liquor ’ which had been mentioned in an earlier sentence ) • de fotografye – vays ikh nisht in velekhn yu :r – de elteren hobn ez gemakht ( ii. 0. 17 ) ‘ The photo – I don ’t know in which year it was taken. My parents arranged for it to be taken ’ • [ In reply to the question Vi hot di gas geheysn demolt ? ‘ What was the name of the street in those days ? ’ ] ĳin lank [ … ] hot ez gehaysn de Thököly Út – in of rumeynish hot ez gehaysn azoy vi hidzd Dragoș Vodă – azoy hot ez gehaysn in yene yu :rn oukhet in hitst oukhet ( iii. 0. 59 ) ‘ A long time ago it was called Thököly Út, and in Romanian, it had the same name as now : Dragoș Vodă. It had that name in that period, and it still does ’ • ir vayst az [ … ] dey khasi :dishe velkhe ze kimen gayn nisht ara :n in de sfardishe shil [ … ] des is trayfo ( iii. 1. 17 ) ‘ You know that the Hasidim that come don ’t enter the Sephardic synagogue. It is impure ’ • tomer d est makhn a de urin in s et za :n royt zolzdikh nizhd dershrekn – vayl deys is ĳin dey tabletn – nor d est tserik – bakimen de farb azoy vi s i geveyzn in pu :nem ( iii. 1. 53 ) ‘ When you pass urine and it is red, don ’t get frightened because it ’ s caused by these pills. But you will get the coloring of your face back as it used to be.’ This new evidence is a strong indication that the replacement of the traditional mode of pronominal reference by the human / non-human differentiation in Haredi Satmar Yiddish is not an innovation that occurred during the last decades overseas, but is, instead, a trait which originated at a sub-dialectal level on the European home grounds of the Satmar movement and was brought along to America in the wake of the Holocaust. Once in America, it must have intensiĳied as a result of the gender and case morphology collapse. The European locus of the innovation may not even have been the Unterland ( although the innovation is in fact attested there ),13 but another region in Eastern Eu13 In the Yiddish spoken in and around Satu Mare, the center of Joel Teitelbaum ’ s prewar Hasidic movement, this tendency may have been stronger than elsewhere in the Unterland. Unfortunately, I haven ’t been able to locate any in situ informants from Satu Mare itself. 502 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ rope, from which members of the Satmar movement were recruited. The innovation in question is also likely to have been carried through in parts of southeastern Yiddish. Mikhoel Felzenbaum, the well-known Israel-based Yiddish writer and linguist, conĳirms ( p.c. ) its presence in his native Bessarabian Yiddish dialect, in a form which is, in fact, more similar to Haredi Satmar Yiddish than to the Unterland Yiddish that I have tried to cover through my in situ ĳieldwork. So far, I have discussed pronominal reference only in the singular. Regarding reference between a pronoun and an antecedent noun in the plural there is a signiĳicant difference between, on the one hand, Haredi Satmar Yiddish and, on the other hand, the Unterland Yiddish of my informants. In this case, Unterland Yiddish apparently corresponds with standard Yiddish and the bulk of Eastern European Yiddish dialects, using the plural of the personal pronoun, whereas Haredi Satmar Yiddish again distinguishes between human and non-human, using zey for the former and, not infrequently, es or dos for the latter. Compare the following examples ( the relevant neuter pronouns are in small caps ) : When I visited there in 2009, my search for Yiddish speakers with a prewar background was unsuccesful. According to the local Jewish Community Center, the last Yiddish speaker of Satu Mare had passed away a couple of months prior to my arrival. A twenty-six minute video recording with a ( now deceased ) Yiddish speaker from Satu Mare, with which Péter Varga ( Budapest ) kindly provided me, and my own recordings of Baia Mare Yiddish ( Freundlich and Freund – Baia Mare is located about 70 km east of Satu Mare ) are the closest I have come to prewar Satu Mare Yiddish. In the recording, which was conducted by Péter Varga approximately 10 years ago, there were no relevant examples of pronominal reference. The digital archive of the Shoah Foundation Institute in Los Angeles includes four video testimonies in Yiddish by Jews who were born and raised in or very close to Satu Mare. All four interviewees emigrated from Romania after World War ii. Consequently, they cannot be considered in situ informants, and the signiĳicance of their Yiddish, though entirely fluent, natural and far from being attrited, must be treated with caution for the purposes of the present study. One of the interviewees, Mr Meyir-Mano Daskal, born in 1906 in Satu Mare and residing at the time of the interview ( 1998 ) in Israel in – as appears from the recording – a non-Haredi environment, uses neuter pronouns several times during the interview when referring to non-human antecedents that are either deĳinitely or in all likelihood masculine or feminine, e. g. ( the relevant neuter pronouns in small caps ) : • er hot a groysn va :ngu :rtn [ … ] des hod gehaysn – of ungarish hot ez gehaysn der barg ĳin satmer ( i. 0. 22 ) ‘ He owns a large vineyard. This was called – in Hungarian it was called the Satu Mare Mountain ’ • dort iz men aru :vgegangen [ … ] of a barg aru :f – s hod gehaysn de shpiglbarg ( i. 0. 23 ) ‘ There a mountain could be ascended. It was called the Mirror Mountain ’ • m hot ints ara :ngeĳi :rt in blok – s hod gehaysn tsegaynerblok ( iii. 0. 10 ) ‘ We were led into the barrack. It was called the Gipsy Barrack ’ • ho bakimen a vu :rsht ober des iz dogh geveyn a milya :rd vert ( iii. 0. 18 ) ‘ I got a sausage but after all it was worth a billion.’ Steffen Krogh : How Satmarish is Haredi Satmar Yiddish ? 503 • tsulib dem hoben zikh di mashinen asakh shneler tsibrokhen hot men dos gebrengt tsu farekhten ‘ Therefore, the engines broke down much faster ; then they were taken in for repair ’ Di vokh : 14 ( 5 ). • ikh hof az m´vet mekabl zayn di verter vos m´hot do geshmuest, m´vet es mekabl zayn tsu farbesern di maysim ‘ I hope that attention is paid to the words that were uttered here. Attention will be paid so that the deeds may become better ’ Der idisher gedank : 19 ( 2 ). • geyendig aroys fun oĳis hot er zikh dermant az di oybershte shuflodn hot er nisht unterzukht. er efnt dos oyf ‘ On leaving the ofĳice he recalled he had not examined the top drawers. He opens them ’ Der blat : 56 ( 2 ). • ven der mentsh vert elter, farlirn di disks a teyl funem vaser vos ligt gevenlikh derin. dos makht es mer boygzam un mer oysgeshtelt az es zol zikh tseraysn ‘ As a person grows older, his spinal discs lose some of the water that is usually in them. That makes them more elastic and more prone to bursting ’ Der id A : 36 ( 4 ). Given that this feature seems to be absent from all coterritorial languages in the historical and present stages of Haredi Satmar Yiddish in both Eastern Europe and in America – Slavic languages, Hungarian, Romanian and English – its genesis is difĳicult to explain. However, the parallel to the same procedure in the singular cannot be ignored. The development must have begun in the singular and spread to the plural. According to the above-mentioned Mikhoel Felzenbaum ( p.c. ), exactly the same state of affairs can be observed in Bessarabian Yiddish. The origin of the abandonment of gender agreement between a pronoun and its non-human masculine or feminine antecedent may date back to the time when the ancestors of Unterland Jewry still resided in Galicia and were exposed to coterritorial Slavic languages on a daily basis. In colloquial Polish, e. g.,14 there is a tendency, when referring deictically to an inanimate noun, to let to, the neuter of the demonstrative pronoun ten ‘ that,’ represent that noun, regardless of whether it is masculine or feminine.15 This feature could have been borrowed by Central Yiddish, where its use could have widened to include, not only the demonstrative dus, but also the personal pronoun es. This particular use of dus and es is typical of colloquial Central Yiddish from Poland and has, to my knowledge, never been subjected to scholarly scrutiny. 14 Cf. Mendoza 2004 : 294 f. 15 As this trait is also found in colloquial German, e. g. when A – pointing at an apple ( Germ. der Apfel ) – says to B : Nimm das !, it may not be borrowed in Yiddish at all, but be rooted in the common basis of Yiddish and modern German. 504 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ In the Central Yiddish of the Unterland it has undergone further widening to include the non-deictic use of the pronouns and – at a more advanced stage in certain sub-dialects – to include animals. 4. Summary In this paper three salient grammatical features of Haredi Satmar Yiddish have been presented. The ĳirst, the replacement of a nominal indirect object by a prepositional phrase with far, which is equally well established in Haredi Satmar Yiddish and Unterland Yiddish ( the assumed ancestral dialect of the former ), unmistakably precedes the founding of the modern Satmar movement in postwar America. The remaining two traits, comprehensive syncretism within the gender and case system, and reference to masculine and feminine antecedents by means of neuter pronouns, display an ambiguous picture, inasmuch as they are prominent characteristics of Haredi Satmar Yiddish, but merely alternative or peripheral constructions in Unterland Yiddish. However, on closer inspection, it appears that the current traits featured by Unterland Yiddish must represent the ĳirst stage of the morphological collapse and subsequent restructuring within nominal phrases, which can be observed in Haredi Satmar Yiddish. Regarding one aspect, however – the possibility of referring to an antecedent noun in the plural by means of a neuter pronoun in the singular – the result of the process cannot be deduced from Unterland Yiddish grammar. In Haredi Satmar Yiddish, this trait must have been either caused by a recent innovation or adopted from one of the other Eastern European Yiddish dialects which contributed to the formation of this Haredi Yiddish variety. Bessarabian Yiddish displays an exact parallel to the feature in question. To prove that this correspondence is not purely coincidental, further research must establish from where the Satmar movement in America recruited its members from after World War ii. Haredi Satmar Yiddish – although at its core undoubtedly Central Yiddish and Unterland Yiddish – may turn out to be far less Satmarish than commonly thought. And considering that a signiĳicant number of those who joined the Satmar movement after World War ii in America originated from places other than the very city of Satu Mare – the legendary Grand Rabbi Joel Teitelbaum himself was born and raised in Sighetu Marmaţiei ( then Máramarossziget ), and both his wives in Poland – this is not surprising. Steffen Krogh : How Satmarish is Haredi Satmar Yiddish ? 505 A. Sources in Haredi Satmar Yiddish 1. Newspapers Der blat. Tsaytshrift fun alveltlikhn ortodoksishn idntum. 15 June 2001. 132 pages. Der id. Organ fun umophengigen ortodoksishen identum in Amerike. 21 March 2008. Sections A – B. Supplement Der shiker’er id. 96 + 72 + 11 pages. Di vokh. 30 July 1998. 32 pages. 2. Journal Der idisher gedank 2, 18 October 1999. 96 pages. B. Sources in Unterland Yiddish 1. Oral interviews conducted by this author : 1 ) Lazar ( Moyshe-Leyzer ) Freund, interview conducted on 11 May 2011 in Oradea. 2 ) Mihai ( Avrom-Khayim ) Freundlich, interviews ( quoted as i – iii ) conducted on 11 and 13 May 2011 in Oradea. 3 ) Eugen ( Menakhem-Yehude ) Grünfeld, interviews ( quoted as i – ii ) conducted on 14 July 2010 and 15 May 2011 in Cluj-Napoca. 4 ) Eugen ( Yankev ) Krausz, interviews ( quoted as i – ii ) conducted on 14 July 2010 and 15 May 2011 in Cluj-Napoca. 5 ) Margareta ( Malke ) Mezei, interview conducted on 11 May 2011 in Oradea. 6 ) Golda ( Goldi ) Salamon, interviews ( quoted as i – iv ) conducted on 20 July 2009 and 14 May 2011 in Sighetu Marmaţiei. 7 ) Gerson ( Gershn ) Schvarcz, interview conducted on 12 May 2011 in Oradea. 2. Oral interviews conducted on behalf of the Shoah Foundation Institute ( available to the public only at speciĳic sites, e. g. the United States Holocaust Memorial Museum in Washington D.C. ) : 1 ) Meyir-Mano Daskal, interview code 47019. 2 ) Josef Katz, interview code 13639. 3 ) David Rosenfeld, interview code 20435. 4 ) Sarah Taub, interview code 28219. 506 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ C. Secondary Literature Assouline, Dalit, forthcoming : “ Grammaticalization and language contact : The preposition far in Israeli Haredi Yiddish. ” In : Marion Aptroot and Björn Hansen, eds., Yiddish Language Structures. ( Empirical Approaches to Language Typology ). Berlin – New York : de Gruyter. Beranek, Franz J., 1941 : Die jiddische Mundart Nordostungarns. Brünn – Leipzig : Rohrer. Herzog, Marvin I., 1965 : The Yiddish Language in Northern Poland : Its Geography and History. The Hague : Mouton & Co. Krogh, Steffen, forthcoming : “ The Foundations of the Written Yiddish of the Ultra-Orthodox Satmar Jews. ” In : Marion Aptroot and Björn Hansen, eds., Yiddish Language Structures. ( Empirical Approaches to Language Typology ). Berlin – New York : de Gruyter. Mendoza, Imke, 2004 : » Nominaldetermination im Polnischen. Die primären Ausdrucksmittel. « Habilitationsschrift, lmu München. http://www.uni-salzburg.at/portal/page ?_pageid=625,740063&_ dad=portal&_schema=PORTAL Mitchell, Bruce, 2006 : Language Politics and Language Survival : Yiddish among the Haredim in Post-War Britain. Paris – Louvain – Dudley, ma : Peeters. Taglikht, Yisroel-Khayim, 1929 : “ Lider fun Ungern un de Slovakay. ” In : Shriftn fun yidishn visnshaftlekhn institut. Filologishe shriftn 3 : 297 – 312. Viler, Y., 1926 : “ Der gramatisher min fun di hoyptverter in mizrekh-galitsishn yidish ” . In : Landoy-bukh. D ” r Alfred Landoy tsu zayn 75stn geboyrnstog dem 25stn november 1925. Shriftn fun yidishn visnshaftlekhn institut 1. Filologishe serye 1. Vilna : Kletskin, 249 – 264. Weinreich, Uriel, 1964 : “ Western Traits in Transcarpathian Yiddish ” . In : For Max Weinreich on his Seventieth Birthday. Studies in Jewish Languages, Literature, and Society. London – The Hague – Paris : Mouton & Co., 245 – 264. ‫פּאליטיק‬ ָ ‫קולטור און‬ Kultur und Politik Culture and Politics Gennady Estraikh Zalman Wendroff The Forverts Man in Moscow A Maverick among Moscow Yiddish Writers Among the Yiddish literati who lived in Moscow when the city became the capital of Soviet Russia, Zalman Wendroff ( Vendrovski, 1877 – 1971 ) stood out as a person relatively well known in the international world of the Yiddish press. Born in Slutsk, now Belarus, into a family of a shoykhet-cum-melamed, Vendrovski moved to Łódź in 1893. There he got his ĳirst experience in journalism, contributing to the Kraków newspaper ‫ ( דער ייִ ד‬Jew ). In 1900, he used the passport of his brother to cross the Russian border, leaving therewith a lifelong imprint in his ofĳicial papers, which identiĳied him under the name of David. In Britain, where Zalman-David came, he worked, studied in evening classes, and became involved in Zionist and anarchist circles.1 The anarchist leader Rudolf Rocker, a non-Jewish editor of several Yiddish periodicals in Britain, remembered that, when they ĳirst met in Glasgow, Wendroff – he adopted the pseudonym then – “ was inclined to Zionism ; we had long arguments about it. When he came to live in London afterwards he found himself much nearer to our views, and was a valued contributor ” to the ‫רײנד‬ ַ ‫ ( ַארבעטער‬Workers ’ Friend ), edited by Rocker.2 In Britain, Wendroff married a Moscow-born intellectual woman who had fled Russia because of her political views. In 1905, the young couple went to Moscow, notwithstanding their slim chances of getting permission to reside legally there, outside the Pale of Jewish Settlement. For some time, Wendroff gave private English lessons and managed to live without a residence permit, bribing the ‫שווייצאר‬ ַ ( concierge ) of their apartment building to avoid denunciation.3 In 1906, following the compliant concierge ’ s death, he once again left Russia. This time he wound up in America, where the list of his jobs included working as a stringer for Yiddish periodicals. I want to thank Alan Rems for sharing with me the material of his genealogical research. 1 2 3 Vendrovski 2008 : C-3 a – c-3 b. Rocker 2005 : 80. Wendroff 1970. 510 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Two years later, Wendroff returned to Russia and settled in Warsaw as a reporter for the ‫זשורנאל‬ ַ ‫מארגן ־‬ ָ ( Morning Journal ), the American Yiddish daily with the second-largest circulation. He also contributed, from 1909, as a member of staff, to the largest-circulated European Yiddish daily, ‫הײנט‬ ַ ( Today ), launched in Warsaw in 1908. In March and April 1911, ‫הײנט‬ ַ featured his Palestinian travelogue. Especially successful were his humorous stories under the general name of ‫זשיטעלסטווא‬ ָ ‫ווא‬ ָ ‫פּרא‬ ַ ( Residence Permit ), which appeared as a weekly feature from 18 November 1911 to 27 August 1912. In 1912, the Yehudiya publishing house, owned by the publishers of ‫הײנט‬ ַ , produced a volume of these stories, distributed as a gift to the newspapers ’ readers.4 The following year, a Russian translation of Residence Permit came out under the same imprint. A bibliography of Yiddish books published in Russia on the eve of World War i lists fourteen titles by Wendroff.5 When the Russian army pulled out of Warsaw in August 1915, Wendroff evacuated to Moscow and worked for the EKOPO, the Jewish Committee for the Relief of Victims of War, which played an important role in Russian Jewish life of that period. Daniel Charney, the younger brother of the Yiddish literary critic Shmuel Niger and the labor leader Baruch Vladeck, and a Yiddish writer in his own right, recalls in his memoirs that at the end of 1918 he invited his “ good old friend ” Zalman Wendroff to work on ‫ ( דער אמת‬Truth ), the newspaper published by the Jewish Commissariat at Lenin ’ s government. The new regime lacked professional Jewish journalists, so Charney, hardly a Bolshevik, effectively edited ‫דער אמת‬. However, in mid-February 1919 the newspaper stopped appearing, and its journalists had to ĳind other sources of subsistence.6 In the environment of military communism, which made money virtually meaningless, state employment became an imperative of survival, giving access to the centralized system for the procurement of food and other goods. Wendroff found a job at the People ’ s Commissariat of Railways, where he headed the press ofĳice. He also worked briefly as an administrator at the Moscow Hebrew theatre Habima. On 13 March 1920, during a public discussion about the theatre, Wendroff gave vent to his feelings about the Jewish communists ’ anti-Hebrew campaign, accusing them of transforming “ Jewish culture into a Jewish cemetery, where they, together with outdated and dead things, bury also everything still alive, valuable, and idealistic. ” He was indignant about the Bolshevik militants ’ desire to liquidate the Habima : 4 5 6 Finkelstein 1978 : 217 f. Estraikh 2005 : 20. Charney 1943 : 226 f. Gennady Estraikh : Zalman Wendroff 511 They deem bourgeois the language in which the Habima actors perform, as well as the theater itself and its audience. I testify as a Jewish writer with an experience of writing in Yiddish over twenty years – and my fellow writers can conĳirm it – that both Jewish languages are equally alien to the Jewish bourgeoisie. [ ... ] Cobblers, tailors, and other workers living in shtetls, rather than the bourgeoisie, teach their children in Hebrew.7 In 1920, Moscow lived half-starved. In the words of the Yiddish writer Der Nister, the city was “ half dead, a kind of Pompeii. ” 8 Still, members of the Moscow Circle of Yiddish Writers and Artists ( mcywa ), would, from time to time, get support from the American Jewish Joint Distribution Committee ( jdc ). Therefore it was literally vital to be part of the circle. Although the mcywa had been established as an apolitical mutual aid association, by 1920 it had already acquired a more militant Bolshevik hue and made attempts to cleanse the mcywa of ideologically adverse literati, choosing Wendroff as the ĳirst target.9 Wendroff felt compelled to respond. On 7 January 1921, he wrote a scathing letter, arguing that he hated “ bitterly all parties, from Zionist to Communist ” and it was his “ nature to be recusant and to reject any party discipline. ” Therefore the stories of his links with Zionism were either unfounded rumors or simply slander aimed at leaving him without rations.10 Ultimately, Wendroff ’ s membership was renewed, but – as a result of his temporary expulsion – he missed the distribution of two barrels of herring, which the jdc had given to the mcywa. Still, he returned to the circle ’ s ranks by the time of another important distribution of gifts : American yellow trench coats, with brass buttons and hoods.11 A Foreign Correspondent Shmuel Niger became the ĳirst ‫ ( ָארווערטס‬Forward ) newsman in revolutionary Russia. From 30 March 1917, his telegrams sent from Petrograd began to appear on the front pages of the biggest New York Yiddish daily. A year later, he moved to Moscow, where he combined his work at the Soviet government ’ s Jewish Commissariat with representing ‫ָאר־‬ ‫ווערטס‬. Some of Niger ’ s dispatches would be reproduced in the general 7 8 9 10 11 Ivanov 1999 : 240 f. Borrero 2003 : 77 f ; Estraikh 2005 : 43. Estraikh 2005 : 44 f. Abchuk 1934 : 31 f. Charney 1943 : 301 f. 512 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ American press, including The New York Times. Later, when Niger left Moscow for Vilna, ‫ ָארווערטס‬had no regular representation in the Soviet capital. Until November 1921, the Soviet authorities usually refused to admit foreign correspondents ; later, too, it was difĳicult to get permits to open bureaus of foreign periodicals.12 From Wendroff ’ s 1957 interview given to the Paris communist Yiddish newspaper ‫נײע פּרעסע‬ ַ ‫ ( די‬The New Press ), we know that he began to work for the Jewish Telegraphic Agency ( JTA ) in 1922, and soon afterwards was invited to write for the New York Yiddish press, ĳirst for the liberal ‫טאג‬ ָ ‫ ( דער‬Day ) and later for the socialist ‫ ָארווערטס‬. He also wrote intermittently for other non-Soviet Yiddish newspapers, most notably the Warsaw daily ‫מאמענט‬ ָ ( Moment ). Soviet ofĳicials, especially at the People ’ s Commissariat of International Affairs, were keenly interested in projecting a positive image of Soviet society, so the authorities allowed, and even encouraged, Wendroff to do this ; had this not been the case, his cooperation with foreign newspapers, especially with ‫ – ָארווערטס‬the main rival of the New York communist daily ‫רײהײט‬ ַ ( Freedom ), simply could not have continued for over a decade.13 The Menshevik-and-Bund-leaning ‫ ָארווערטס‬, read by half a million people, was an important forum, known for its strong influence with the labor movement and relief organizations. As a result, although the Jewish Sections of the Soviet Communist Party treated ‫ ָארווערטס‬as an irreconcilable enemy, other constituents of the Soviet bureaucratic apparatus, most notably the Committee for the Agricultural Settlement of Jewish Toilers, regarded the American daily as an important partner. Boris Smolar, who lived in Moscow from 1928 to 1930 as the correspondent of the jta and ‫טאג‬ ָ ‫דער‬, came to the conclusion that in a conflict between the Jewish Sections and “ more comprehensive government interests, ” the position of the former “ could never prevail. ” 14 Meanwhile, the forum of American Jewish socialists continued to sympathize with the new Russian regime, while remaining at odds with the Comintern and its American outposts. ( The Soviet Communist Party ’ s Jewish Sections were seen as the Comintern ’ s element too. ) According to the ‫ ָארווערטס‬writer David Shub, many American socialists 15 tried to draw a demarcation line between the Comintern and the Soviet government. They condemned the Comintern, but the Soviet government they regarded as a labor government and did not want to criticize it openly. 12 13 14 15 Desmond 1982 : 30 f. Kenig 1957 ; Tikhii 2009. Smolar 1982 : 45. Shub 1970 : 612. Gennady Estraikh : Zalman Wendroff 513 As late as 1923, ‫ “ ָארווערטס‬published pro-Soviet articles and reports from Russia. ” Characteristically, the jdc also learned “ to walk carefully on Communistic eggs without smashing any, ” avoiding direct contact with “ the uncomfortable partners, the Jewish Communists [ … ] ; the Jews of the United States had no relish for an afĳiliation with such brethren. ” 16 The Soviet Union retained its allure in later years also, when some members of the editorial staff, including Abraham Cahan, editor-inchief, hoped that Stalin would improve the Soviet system. In September 1926, Cahan revealed his satisfaction with Stalin ’ s victory over the “ wild, bloodthirsty tactics and rhetoric of Zinoviev and Trotsky. ” 17 In 1927, he brought back from his trip to the Soviet Union the conviction that the dictatorship of the proletariat was “ as bad as if it were a dictatorship of the aristocracy. ” Yet while characterizing the Soviet leadership as “ a bunch of fanatics ” who were “ in a dream, a phantasmagoria, ” he was ready to give them the beneĳit of the doubt : they, especially such “ a sensible man ” as Stalin, might “ mean well. ” 18 Cahan sought to provide comprehensive coverage of Soviet affairs, obtaining information from people on the ground. In the early 1920s, ‫ ָארווערטס‬would receive articles and letters from several Soviet locales – as a rule, through its Berlin bureau. In addition to unnamed amateur reporting, the newspaper published articles with bylines of Leyb Yakhnovitsh, who briefly edited the Odessa Yiddish paper ‫קאמוניסטי־‬ ָ ‫ ( שע שטים‬Communist Voice ), and A. Kiever ( Dov-Ber Slutski ), a Kievbased intellectual. In his letter to Cahan, dated 4 January 1924, Slutski explained that he found it convenient to send his material to Berlin, because the postal links with Germany were reliable and, in addition, the Berlin bureau would decipher and retype his difĳicult shorthand. ( Jacob Lestschinsky, Slutski ’ s childhood friend, headed the Berlin bureau of ‫ ָארווערטס‬. ) Slutski also asked to stop sending him the newspaper, because he was not allowed to receive it. Until October 1924, when Wendroff had ĳinally obtained special permission to receive copies of ‫ ָארווערטס‬, he too would get only occasional or indirect access to the newspaper.19 On 30 March 1923, Cahan wrote one of his numerous instructions to Lestschinsky, sharing his thoughts, inter alia, about the difĳiculties of obtaining trustworthy, candid reports from their local correspondents in the Soviet Union. Cahan therefore asked Lestschinsky to instruct them 16 17 18 19 Bogen 1930 : 315. Estraikh 2010 : 152. Cahan 1927. Estraikh 2010 : 151. 514 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ to shun political topics and concentrate on describing mundane details of everyday life in various Soviet localities.20 Wendroff, who ultimately remained the newspaper ’ s only correspondent in the Soviet Union, was happy to oblige, especially as it was his forte to be an entertaining writer with a good eye for colorful details. Thus, looking condescendingly at housing conditions typical for the vast majority of Moscow residents, Wendroff wrote sarcastically about “ communal apartments, ” where several families lived cheek by jowl. In his article “ A humorous portrayal of contemporary flats in Soviet cities, ” published in ‫ ָארווערטס‬on 5 December 1923, he made fun of the climate in such accommodation, arguing that a similar comradeship of inhabitants could be found only among prisoners sharing the same cell for many years.21 Baruch Vladeck, manager of ‫ ָארווערטס‬, was more sympathetic to the Soviet country than Cahan and many other members of the staff. In his letter to Wendroff, dated 14 December 1923, he admitted that he himself was far from agreeing with everything that we assume here. The attitude that people have here is determined by their feeling rather than thinking. And feeling, as you know, can be a very treacherous thing. Yet I can assure you that, on the tenth floor [ of the Forverts building, where Cahan ’ s and Vladeck ’ s ofĳices were situated ], the attitude to you is very favorable [ ... ]. You are already perceived as one of us and we hope that, with God ’ s help, you’ll stay with us. The only thing – let ’ s ask the Almighty to get you eventually more freedom in choosing topics. In a letter to Cahan on 27 September 1926, Wendroff summed up his ĳirst three and a half years of writing for ‫ ָארווערטס‬, mentioning that only a small number of his articles dealt directly with political issues : As for “ politics, ” I avoid it as much as it can be avoided. No domain or facet of Soviet life escapes contact with current politics. Therefore, one has to touch on politics while discussing any topic, particularly if the objective is to give clear descriptions, rather than photos, of events and scenes from life. The thing which you call “ propaganda ” is, in fact, a speciĳic point of view, which is absolutely required. One can ’ t write from Russia in a different way. I have to tell you that getting Soviet newspapers in New York and reading them there can ’ t give a comprehensive understanding of Soviet reality. Only a person who lives here can understand the meaning of this or that newspaper article. In all, I can tell you that writing from Soviet Russia for the Forverts is harder than you can imagine it. 20 Ibid. 21 Estraikh 2006 : 56. Gennady Estraikh : Zalman Wendroff 515 Many topics are interesting, but they will not ĳind a place in the pages of the Forverts. Other issues can ’ t be properly discussed. You always have to appreciate the problems which your Soviet-based contributors encounter in their work. From the Shtetl to Colonies Jewish colonization projects in the Soviet Union in general, and in the Crimea in particular, were central topics of the Yiddish press coverage in the 1920s. On 26 August 1926, ‫ ָארווערטס‬informed its readers that it would print six articles by Wendroff of a political nature, describing Soviet Jewish colonization from the vantage point of the Communist Party ’ s Jewish Sections. The editorial note emphasized that the articles would appear in their original form, despite the fact that ‫ ָארווערטס‬had very little in common with the communists. Yet the editors were ready to endorse many of Wendroff ’ s statements, because they had consistently supported the colonization drive, making clear this attitude at the time of the September 1925 Philadelphia conference, when the American Jewish establishment decided to support the jdc ’ s initiative to sponsor Soviet Jewish agricultural settlements.22 Then, on the eve of the landmark conference, the ‫ ָארווערטס‬editorial explained that, of all Jewish campaigns that had originated in the United States, the colonization in Russia was the most important one and that each American Jew had to consider it a privilege to participate in the new undertaking.23 Wendroff ’ s ĳirst article, published on 30 August 1926, introduced the reader to the background of the project aimed at turning tens of thousands of Jews to farming. He disagreed with those who described the colonization drive as a bluff created by the Jewish communists. In reality, the campaign grew out of a grass-roots initiative. Wendroff emphasized that there was no real competition between the colonization drives in the Soviet Union and Palestine, because Soviet Jews usually lacked money – over 10,000 rubles – needed for resettling in Palestine. Indeed, in October 1925, Cahan spoke in Jaffa to passengers of the Soviet vessel Lenin, which had brought 361 Jewish emigrants from Odessa ; to be allowed to disembark, each of them had to have at least 500 British pounds, or 2,500 American dollars.24 At the same time, even the payment of 300 rubles collected for moving to a farming settlement in Ukraine or Crimea became a hurdle 22 Forverts 1926 ; Dekel-Chen 2005 : 72. 23 Forverts 1925. 24 Cahan 1925. 516 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ for a third of potential colonists, and their contribution had to be reduced. Palestine could get a sufĳicient number of migrants from such countries as Poland, Romania, Lithuania, and Latvia, and Zionists leaders certainly knew it, but they worried that the Soviet colonization project could lighten their political weight and, most importantly, affect their fund-raising efforts. Wendroff also mentioned other, non-Zionist, opponents of Soviet Jewish colonization, who contended, for instance, that it was neither fair nor safe to move to the land that belonged historically to non-Jewish peasants. Anti-Bolshevik socialists worried that success of colonization would enhance the influence of Jewish communists, while nationalists maintained that it would speed up the decline of the traditional patterns of Jewish life, or Yiddishkayt. Skeptics also argued that the campaign was doomed to fail anyway because of the improvements in economic conditions in urban habitats and, as a consequence, a dearth of people lured to farming.25 In his second article, Wendroff addressed some arguments of the opponents and skeptics. He dismissed speculation that Soviet rule could founder, triggering a massacre of Jewish colonists by Ukrainian peasants, despite the fact that, theoretically at least, shtetl dwellers were hardly better protected than the colonists. Wendroff insisted that Yiddishkayt was not declining in the newly established colonies ; rather, that the Yiddish language and Jewish traditions had a better chance of survival in the colonies, with their exclusively Jewish population, than in multi-ethnic towns. Signiĳicantly, at that time, Sabbath continued to be observed in all colonies. Wendroff ridiculed those who deĳined support of Soviet Jewish colonization as “ un-American ” activity, and reminded ‫ ָארווערטס‬readers that no one questioned the patriotism of those American capitalists who had made signiĳicant investments in the ussr.26 In his articles, Wendroff mentioned the organizational problems of colonization. The colonies did not get enough houses, which was one of the reasons why some of the colonists either returned to their shtetls or moved elsewhere. The situation often depended on the form chosen for the farming collective : the commune proved to be a less practical form of collectivization than the cooperative.27 Classiĳied as toilers, the avant-garde, and, therefore, beneĳiciaries of society, colonists had to do everything themselves ; they were not allowed to hire other peasants, even during the harvesting period. Status uplift played a very signiĳicant role in the colonization campaign : Jews who were classiĳied as bour25 Wendroff 1926 a. 26 Wendroff 1926 b. 27 Wendroff 1926 c. Gennady Estraikh : Zalman Wendroff 517 geois and disfranchised ( meaning variously disadvantaged ) citizens moved to colonies to ĳind solutions for their economic as well as social problems.28 Some journalists of ‫ ָארווערטס‬found Wendroff ’ s portrayal of colonization misleading. According to Stepan Ivanovich ( Shmuel/Semen Portugeis ), a leading representative in the West of the right-wing Mensheviks, the Soviet regime had deprived many Jews of their right to continue living in places more civilized than colonies, where people faced unnecessary suffering. Ivanovich ridiculed the desire of Bolsheviks ( and numerous Jewish ideologists ) to improve the Jewish nation, making it healthier through farming.29 Although Lestschinsky had a more positive attitude to colonization, he saw it as a rather marginal development against the grim backdrop of Soviet Jewish life.30 Meanwhile, Wendroff wrote about the November 1926 conference in Moscow, which imbued many people with the belief that the Soviet government sought to build a Jewish statehood.31 He found a supporter in Vladeck, who believed that Soviet Jews would beneĳit from colonization.32 In his letter, dated 11 December 1926, Wendroff hailed Vladeck ’ s article and emphasized that, indeed, he regarded the Soviet colonization drive as one of the greatest events in Jewish history. Three days later, on 14 December, Wendroff once again wrote to Vladeck, who by that time had arrived in Berlin. He reassured Vladeck that he would get a visa for him to enter the Soviet Union and that there was no need to worry about the functionaries of Soviet Jewish organizations, because in the reality they were “ not such bandits ” as they might appear from newspaper articles. In addition, Vladeck would be welcomed by people other than those from the Jewish Sections. He wrote : 33 I am sure that you, like many other visitors, will leave our country with a much better opinion about it than you had before your trip, even if your opinion always was quite positive. The air of Soviet Russia has this effect on people. In effect, Vladeck, at that time, did not go to Russia, but met in Berlin with representatives of Soviet communists and their opponents, émigré anti-communists. 28 29 30 31 32 33 Wendroff 1926 d, 1926 e, 1926 f. Ivanovich 1926. Lestschinsky 1926. Wendroff 1926 g. Vladeck 1926. Vladeck 1927. 518 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ The Rupture In 1929, the Chicago Daily Tribune, which was always in the forefront anti-communist ranks of the American press, published articles by Mark Razumny, a Yiddish journalist from Riga, who was allowed to visit the Soviet Union. An editorial introduction explained the newspaper ’ s methodology of gathering information about the Soviet Union : 34 In order that our readers may have at least a measure of news from Russia accurately and impartially presented, we have abandoned our bureau in soviet Russia. For most of the news that American correspondents can obtain in Russia is contemptuously, and rightly so, described as handouts. [ ... ] Unwilling to export at our expense propaganda for the soviet news agency throughout the world, we have adopted our present plan of covering Russia. From time to time we have been able to send our agents through Russia and reproduce exclusively the actual conditions in that country. This procedure may reduce our volume of news from Russia, but the quality is reliable. ‫ ָארווערטס‬, which certainly had problems with Wendroff ’ s material based on “ handouts, ” would also send its “ agents through Russia. ” Little is known about Wendroff ’ s contact with the visiting writers and activists. According to David Shub, Wendroff helped Cahan during the latter ’ s 1927 visit, and in November 1928 arranged a pass for the leader of the American Jewish labor movement, Nathan Chanin, giving him the privilege of standing on the Red Square ’ s tribune for foreign guests during the parade celebrating the eleventh anniversary of the October Revolution.35 In 1926, the arrival of the writers Israel Joshua Singer and Hersh David Nomberg made Wendroff angry. In his letters to Cahan written on 27 September and 7 November 1926, he protested against this practice. He also felt maltreated because the visiting writers went to Ukraine and Belorussia, whereas Cahan would not agree to send him additional money for traveling to various locations across the country. Around that time, Wendroff began to worry about the status of his association with ‫ָאר־‬ ‫ווערטס‬. In his letter to Vladeck on 11 December 1926, he complained that his articles stopped appearing in the newspaper and reminded Vladeck that he began to write for ‫ ָארווערטס‬not because he was ĳishing for the 34 Chicago Daily Tribune 1929. 35 Shub 1970 : 719, 767 f. Gennady Estraikh : Zalman Wendroff 519 job, rather because he accepted an offer sent to him by Lestschinsky. So he wanted some sense of certainty about his situation. On 1 March 1927, ‫ ָארווערטס‬published editorial notes, showing deference to Wendroff and explaining the reasons for complementing his articles with Nomberg ’ s and Singer ’ s travel notes : The same note explained that the newspaper was open to various kinds of materials about the Soviet Union, though it would not publish explicit pro-Soviet or anti-Soviet propaganda.36 ,‫זשורנאלי סט‬ ַ ‫לאנט ולער‬ ַ ‫טא‬ ַ ‫ווענדראף איז ַא‬ ָ ‫זײנע בריוו און שילדערונגען ון דעם איצ־‬ ַ ‫און‬ ‫סאוועטישער רעפּובליק‬ ָ ‫טיקן לעבן אין דער‬ ‫פּאסירונגען‬ ַ ‫אינטערעסאנטע‬ ַ ‫מאסן‬ ַ ‫נטהאלטן‬ ַ ‫ַא‬ ‫פּלאץ‬ ַ ‫זײן וווינונגס ־‬ ַ .‫קאליר ולע בילדער‬ ָ ‫און‬ ‫בא־‬ ַ ‫רעספּאנדענצן‬ ָ ‫קא‬ ָ ‫זײנע‬ ַ ‫ אין‬.‫מאסקווע‬ ָ ‫איז‬ ‫שרענקט ער זיך ָאבער ניט אויף דער רוסיש ער‬ ‫באזוכט ער‬ ַ ‫צײט‬ ַ ‫צײט צו‬ ַ ‫ ון‬.‫שטאט‬ ָ ‫הויפּט‬ ‫דארטן‬ ָ ‫ און ון‬,‫אויך ַאנדערע שטעט און געגנטן‬ .” ‫שרײבט ער אויך ַארן „ ָארווערטס‬ ַ ,‫בײשפּיל‬ ַ ‫ צום‬,‫צײט צוריק‬ ַ ‫מיט ַא געוויסער‬ ‫אינטערעסאנטע סעריע‬ ַ ‫זײן‬ ַ ‫האבן מיר געדרוקט‬ ָ ‫ווקאז‬ ַ ‫קא‬ ַ ‫שרײבונגען ון די קור ־ בעדער אויף‬ ַ ‫בא‬ ַ ‫רעספּאנדע נצן‬ ָ ‫קא‬ ָ ‫זײנע זעקס גרויסע‬ ַ ‫און‬ ‫ אין קורצן וועט‬.‫לאניעס‬ ָ ‫קא‬ ָ ‫וועגן די ייִ דישע‬ ‫באזוכן ייִ דישע שטעט אין‬ ַ ‫נדראף‬ ָ ‫רײנד ווע‬ ַ ‫קאר עס־‬ ָ ‫רוסלאנד און אונדז צושיקן‬ ַ ‫סאוועט ־‬ ָ .‫דארטן‬ ָ ‫פּאנדענצן ון‬ ָ ‫ און דער‬,‫רוסלאנד איז ָאבער ברייט און גרויס‬ ַ ,‫דארטן איז ול מיט שטריכן‬ ָ ‫איצטיקער לעבן‬ ‫אינטערעסאנ־‬ ַ ‫דא גענוג‬ ָ ‫ עס איז‬.‫נײע ַארבן‬ ַ ‫מיט‬ ‫ דערי־‬.‫באכטער‬ ַ ‫בא ָא‬ ַ ‫טעריאל ַאר ילע‬ ַ ‫מא‬ ַ ‫טע‬ ‫מאכט זיך אונדז ַא געלעגנהייט‬ ַ ‫ ווען עס‬,‫בער‬ ‫רוסלאנד‬ ַ ‫שרײבער אין‬ ַ ‫לאנט ולן‬ ַ ‫טא‬ ַ ‫צו שיקן ַא‬ ‫ ַאר עלן מיר ניט זיך מיט איר‬,‫באזוך‬ ַ ‫אויף ַא‬ ‫געהאט‬ ַ ‫האבן מיר‬ ָ ‫זא געלעגנהייט‬ ַ ‫ ַא‬.‫באנוצן‬ ַ ‫צו‬ ‫רבראכט עט־‬ ַ ‫דארטן ַא‬ ָ ‫האט‬ ָ ‫נאמבערג‬ ָ .‫ ד‬.‫ווען ה‬ ‫רײזע‬ ַ ‫ ווען ַאן ענלעכע‬,‫דערנאך‬ ָ ‫ און‬,‫וואכן‬ ָ ‫לעכע‬ .‫שרײבער‬ ַ ‫גאבטער‬ ַ ‫בא‬ ַ ‫געמאכט ַא צווייטער‬ ַ ‫האט‬ ָ 36 Forverts 1927. Wendroff is a talented journalist. Indeed, his dispatches and descriptions of contemporary life in the soviet republic contain colorful pictures and give account of interesting events. Although he lives in Moscow, his correspondence transcends topics of the Russian capital. From time to time he also visits other cities and regions, writing from there for the Forverts. Some time ago, for instance, we published an interesting series of his articles describing spas of the Caucasus and his six long articles about Jewish colonies in Soviet Russia. In the near future, Mr. Wendroff will visit Jewish towns in Soviet Russia and write for us from there. However, Russia is a vast country. Her contemporary life is full of peculiarities and new hues. It provides enough fascinating material for numerous journalistic reflections. Therefore we did not miss any chance to send a talented writer to Russia. Such occasions happened when H. D. Nomberg spent several weeks there and, later, when another gifted writer, [ I. J. Singer ], made a similar journey. 520 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ On 15 December 1928, in a letter to Vladeck, Wendroff once again surmised that the newspaper did not need him any more : during the second half of the year, only six or seven of his articles had not ended up in the editor ’ s bin. At the same time, his journalism remained in demand : he received offers from other New York Yiddish papers, while European Yiddish papers continued to print his articles, including those rejected by ‫ ָארווערטס‬. As may be derived from Wendroff ’ s letter on 28 February 1929, Vladeck tried to defuse his anxiety, reassuring him that the editors continued to regard him as their Moscow correspondent. The situation had changed dramatically after the Palestine Arab anti-Jewish riots in August 1929. News about and around these events precipitated a mass departure of readers and writers from ‫רײהײט‬ ַ . They were outraged with the Comintern ’ s – and Frayhayt ’ s – interpretation of the riots as a commendable episode in the Arab people ’ s struggle against their British and Zionist colonizers. Over forty years later, in June 1971, Paul Novick, one of the founders of ‫רײהײט‬ ַ and its editor from 1939, recalled that in the months of August and September 1929, all American Jewish communist “ organizations were in a crisis in connection with the unrest in Palestine at that time. We came into a headon collision with the Jewish community ” and “ paid dearly for our stand, having lost a great many of our readers and having weakened our mass base. ” 37 In this climate, the position of ‫ ָארווערטס‬on the Soviet regime became one of unreserved hostility. Cahan, who was always sensitive to his readers ’ mood, did not want to print any positive articles about the Soviet Union. In the meantime, Wendroff had received a clear signal that Cahan sought to replace him. In his letter on 24 January 1930, Wendroff informed Vladeck that about two months earlier Boris Smolar had received the following telegram from his New York-based colleague I. Parsky : forward consulted me regarding moscow correspondent asked whether you or i could serve stop willing pay more than day [ i.e. the newspaper Der tog ] stop cable me whether possible for you or arrange with other foreign correspondent even other language under pseudonym until i arrive moscow to substitute you stop [ The jta ’ s founder and director Jacob ] landau unobjecting Smolar ’ s reply was short : none but wendroff will be tolerated here 37 Estraikh 2008 : 121. Gennady Estraikh : Zalman Wendroff 521 Wendroff felt aggrieved at these behind-the-scenes preparations aimed at replacing him. He wrote to Cahan that it was a mistake to hope that a non-Soviet journalist would “ do a better job ” in reflecting “ the whole truth about Soviet Russia, in the spirit of the ‘ experts ’ seated in Berlin and Paris. ” He explained that it was impossible to defy censors without being banned from the country ( quoted from a copy attached to Wendroff ’ s letter to Vladeck on 24 January 1930 ) : To begin with, I very much doubt that a special correspondent of the Forverts will be tolerated here in the ĳirst place. You have to remember that the Forverts is known as a partisan newspaper rather than a capitalist one, a forum for an ideologically antagonistic camp, which makes it in our eyes worse than a “ capitalist newspaper. ” I can write for you only because I always have kept my pen clean during the past thirty years of my journalistic and literary career. I write objectively and as a friend of the Soviet country. If a person dares in his writings to be hostile to the Soviet power, he will not be tolerated here. In this sense, no foreign passport can provide full protection. Here people are not ashamed to expel journalists who were more important than Parsky and represented bigger newspapers than the Forverts. You might think about having two correspondents – me and another one. However, I don ’ t like this combination either. No one would accept it, because no other foreign newspaper has more than one correspondent in Moscow. On 20 March 1930, still having not received a reply from Cahan, Wendroff wrote again to Vladeck : [ ... ] the newspaper has changed its attitude to Russia. No doubt, the Forverts has never harbored particular sympathies toward Soviet Russia, but it previously had the virtue of ĳinding some space for “ nice words ” about us. In any case, there was a place in the Forverts for objective portrayals of Soviet reality. From the very beginning, my work for your newspaper was based on the condition that I would report about life in Soviet Russia, describing it in the way I saw it rather than how you saw, or wanted to see, it. [ … ] When editors did not agree with my “ pro-Soviet ” pieces, they published their commentaries or expressed their opposing opinion in their editorial articles. However, during the last six months hardly any of my articles, regardless of contents, have appeared in the newspaper. You simply don ’ t want to print them, because they would weaken your anti-Soviet propaganda campaign, which is being rigidly conducted by the whole [ anti-Soviet ] foreign press, including your newspaper. 522 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Zalman Wendroff ( left ) with his brother, c. 1930s. Courtesy of Alan Rems Gennady Estraikh : Zalman Wendroff 523 Life after Forverts After the rupture with ‫ ָארווערטס‬, Wendroff continued to write for other foreign newspapers. His last traceable publication in the Warsaw ‫מאמענט‬ ָ came out on 3 June 1933. At that time, he still worked for the jta. The American journalist Linton Wells, who worked in Moscow in the early 1930s, included in his autobiographic book a photo taken in November 1933, during a meeting of foreign journalists with the Soviet President Mikhail Kalinin. Wendroff was also there, representing the jta.38 The People ’ s Commissariat of Foreign Affairs praised him as a very reliable person, whose journalism represented “ maximum [ Soviet- ]friendly information. ” It was considered important to allow him to be seen as a more or less independent journalist and, generally, help him maintain good relations with the jta, discouraging the agency from sending to Moscow a foreign correspondent.39 In his unique role as a Soviet Yiddish writer working for the foreign press, Wendroff was known among his fellow literati as “ Dollar ” or “ Dollar Correspondent. ” In a society where foreign-currency salaries were few and far between, he enjoyed a relatively lavish lifestyle. According to his grandson, His status as foreign correspondent, receptions at Foreign Minister Litvinov ’ s and the National Business Committee [ ... ], getting paid in foreign currency, owning a one-family apartment in the center of Moscow – all these were almost unheard of in those times. Sporting a suit “ bespoke ” at a London tailor ’ s under his fur-lined coat, swinging a cane, he always looked elegant, smart and capable.40 Among Soviet Yiddish writers, however, he remained barely visible. He certainly did not belong to the elite of the Soviet Yiddish literary milieu. Rather, he was one of numerous literati who could earn income from various jobs, including translations from English and Russian. For instance, Wendroff ’ s translation of Liubov Khavkina ’ s Kak liudi nauchilis ’ stroit ’ zhilishcha ( ‫האבן זיך אויסגעלערנט בויען וווינונגען‬ ָ ‫ ) ווי ַאזוי מענטשן‬came out in Białystok in 1921, and that of Mark Twain ’ s The Prince and the Pauper ( ‫ ) דער פּרינץ און דער בעטלער‬in Vilna in 1923, while Moscow publishing houses printed his renditions of Oscar Wilde ’ s The Happy Prince ( ‫ ) דער גליקלעכער פּרינץ‬in 1921 and Jack London ’ s White Fang ( ‫ווײסער‬ ַ ‫שטויסצאן‬ ָ ) in 1937. He was spared during the Stalinist “ great purge, ” 38 Wells 1937 : 344 f. 39 Aldoshin, Ivanov and Semenov 2002 : 697 f. 40 Vendrovski 2008 : c-3 c. 524 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ though his son, a young scholar, perished in the Gulag. By the end of the 1930s, Wendroff ’ s literary works began to appear in Soviet Yiddish periodicals, and in 1941, his collection of stories, ‫ ( אוי ן שוועל ון לעבן‬On the Threshold of Life ), came out in Moscow. A man in his sixties, he was active during the war, working for Yiddish programs of Moscow Radio and for the Jewish Antifascist Committee. Esther Markish recalled that Wendroff came to her in 1949, a few days after the arrest of her husband, the Yiddish poet Peretz Markish, who had been in charge of Yiddish broadcasts during the war. When she asked him how he could have taken the risk of coming to visit the family of an arrested writer, he replied : “ I am no spring chicken [ … ]. So, I ĳigured the worst thing that could happen would be that I might be arrested a few days sooner. ”41 Although he was not arrested at the time of the liquidation of the committee, his turn came in December 1950. He was sentenced to ten years ’ imprisonment for “ anti-Soviet propaganda, ” and was kept in prison until 1954. According to some versions of Raoul Wallenberg ’ s arrest and imprisonment by the Soviet secret police, the Swedish diplomat shared a cell with Wendroff for some time.42 During the post-imprisonment period of his life ( he died in Moscow on 22 September 1971 ), Wendroff was regarded as the doyen of the remaining Soviet Yiddish literati. In this capacity, for instance, he chaired a meeting between several Yiddish writers and a group of foreign delegates to the Moscow Youth Festival in the summer of 1957. In March 1962, the Soviet press agency Novosti widely distributed a letter, signed by ĳive Soviet Jewish intellectuals, including Wendroff as the representative of the Yiddish literary circles, in which they refuted the charges of anti-Semitism in the ussr.43 Like several other Soviet Yiddish writers, Wendroff became a regular contributor to foreign communist Yiddish periodicals, including the Warsaw newspaper ‫ ָאלקס ־ שטימע‬and the journal ‫ייִ דישע שרי טן‬. Strictly speaking, it was not completely ‘ kosher, ’ because manuscripts were supposed to be channeled through an ofĳicial Soviet institution, such as the Soviet press agency Novosti. However, when a writer sent a story, poem or essay for publication in Poland, a socialist country, or in a communist periodical in a capitalist country, they presumably did not regard themselves as dissidents. In January 1957, when the ‫ָאלקס ־ שטימע‬ marked Wendroff ’ s eightieth birthday, his readers in Poland learned 41 Markish 1978 : 162. 42 Bierman 1981 : 177 f. 43 New York Times 1962. Gennady Estraikh : Zalman Wendroff 525 that “ he didn ’ t feel a single day older than stated in his passport. ” Still, he preferred to lie down, “ because from his own experience he had learned that it was better to lie down than to ‘sit’ ” in prison.44 In 1962, a collection of his stories, Opowiadania z przesłości ( Stories from the Past ), translated by Stanisław Wygodzki, came out in Warsaw. Stories from this book appeared in English in the 2004 collection of his stories, When It Comes to Living, translated by Wendroff ’ s great-niece Irene Jerison. On 8 October 1956, Wendroff wrote to Paul Novick : I have found myself in the situation of losing my whole archive accumulated during over ĳifty years of my journalistic and literary work, including all my books, articles, stories, diaries, etc. As a result, I am left, to borrow a phrase, naked on a naked land. After explaining euphemistically the results of his arrest and its associated conĳiscation of his private archive, Wendroff asked Novick to help him get clippings of his articles and stories published in the New York communist newspaper. On 31 January 1958, he informed Novick that since October 1957 he had been getting – through the International Commission of the Soviet Writers ’ Union – copies of ‫רײהייט‬ ַ ‫מארגן ־‬ ָ . By mid-1961, the newspaper had published some of his works and, in his letter on 25 June, Wendroff asked Novick to send him, as a substitute for royalties, a suit or, at least, a couple of white shirts and a tie. On 5 October 1969, Wendroff received a telegram from New York, sent by Itche Goldberg, head of the Zhitlovsky Foundation, stating that Morgn-Frayhayt ’ s sister organization had awarded Wendroff with a Chaim Zhitlovsky Prize. The Moscow publishing house Sovetskii Pisatel’ ( Soviet Writer ), the main producer of Yiddish books in the post-Stalinist Soviet Union, brought out his collections of stories in Russian, Rasskazy o bylom ( Stories from the Past, 1957 ) and in Yiddish, ‫גאס‬ ַ ‫ ( אונדזער‬Our Street, 1967 ). A volume of Wendroff ’ s stories, translated into Russian and entitled Nasha ulitsa ( Our Street ), was published posthumously, in 1980, by the Sovetskii Pisatel’ . Although his books that came out in the autumn years of his life were warmly reviewed, they did not become signiĳicant literary events. At the end of the day, Wendroff ’ s forte was not in ĳiction but in journalism. A selection of his journalism describing Soviet Jewish life in the 1920s and 1930s could create a much better and more useful literary memorial to this remarkable man of Yiddish letters. 44 Gilboa 1971 : 388. 526 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Bibliography Letters quoted in this article are preserved in the following archival collections : ( 1 ) correspondence between Wendroff and Abraham Cahan – yivo archive, Papers of Abraham Cahan, rg 1139 Folder 247 ; ( 2 ) correspondence between Wendroff and Baruch Vladeck – The Tamiment Library and Robert F. Wagner Labor Archive, Baruch Charney Vladeck Papers Tam 037 ( r-7325 ), box 15 ; ( 3 ) correspondence between Wendroff and Paul Novick/Itche Goldberg – yivo Archive, Papers of Paul Novick, rg 1247, ĳile 304 ; ( 4 ) correspondence between Dov-Ber Slutski and Abraham Cahan – yivo archive, Papers of Abraham Cahan, rg 1139 Folder 97. Abchuk, Avrom, 1934 : Etyudn un materyaln tsu der geshikhte fun der yidisher literatur-bavegung in fssr. Kharkov : Literatur un kunst. Aldoshin, V. V., Ivanov, Iu. V. and Semenov, V. M., 2002 : Sovetsko-amerikanskie otnosheniia : gody nepriznaniia, 1927 – 1933. Moscow : Mezhdunarodnyi Fond “ Demokratiia ”. Bierman, John, 1981 : Righteous Gentile : The Story of Raoul Wallenberg, Missing Hero of the Holocaust. New York : Viking Press. Bogen, Boris D., 1930 : Born a Jew. New York : Macmillan Company. Borrero, Mauricio, 2003 : Hungry Moscow : Scarcity and Urban Society in the Russian Civil War, 1917 – 1921. New York : Peter Lang. Cahan, Abraham, 1925 : “ Ab. Kahan bashraybt dos onkumen fun a shif keyn Yafo mit yidishe imigrantn fun Sovet-Rusland. ” In : Forverts, 6 October : 1, 12. – 1927 : “ Soviet Government Condemned by Cahan : Jewish Daily Forward Editor on Return from Russia Says the Leaders are Visionaries. ” In : The New York Times, 19 November : 17. Charney, Daniel, 1943 : A yortsendlik aza, 1914 – 1924. New York : tsiko. Chicago Daily Tribune, 1929 : “ Covering Russia. ” In : Chicago Daily Tribune, 14 April : 12. Dekel-Chen, Jonathan L., 2005 : Farming the Red Land : Jewish Agricultural Colonization and Local Soviet Power, 1924 – 1941. New Haven – London : Yale University Press. Desmond, Robert W., 1982 : Crisis and Conflict : World News Reporting between Two Wars, 1920 – 1040. Iowa City : University of Iowa Press. Estraikh, Gennady, 2005 : In Harness : Yiddish Writers ’ Romance with Communism. Syracuse : Syracuse University Press. Gennady Estraikh : Zalman Wendroff 527 – 2006 : “ The Old and New Together : David Bergelson ’ s and Israel Joshua Singer ’ s Portraits of Moscow Circa 1926 – 27. ” In : Prooftexts 26 (1 –2 ) : 57. – 2008 : Yiddish in the Cold War. Oxford : Legenda. – 2010 : “ The Berlin Bureau of the Forverts. ” In : Gennady Estraikh and Mikhail Krutikov, eds., Yiddish in Weimar Berlin : At the Crossroads of Diaspora Politics and Culture. Oxford : Legenda, 141 – 162. Finkelstein, Chaim, 1978 : Haynt : A tsaytung ba yidn, 1908 – 1939. Tel Aviv : Y. L. Peretz. Forverts, 1925 : “ Di konferents vegn der yidisher kolonizatsye in Rusland. ” In : Forverts, 10 September : 4. – 1926 : “ Notitsn fun der Forverts-redaktsye. ” In : Forverts, 26 August : 4. – 1927 : “ Notitsn fun der Forverts-redaktsye. ” In : Forverts, 1 March : 2. Gilboa, Yehoshua A., 1971 : The Black Years of Soviet Jewry, 1939 – 1953. Boston : Little, Brown. Ivanov, Vladislav, 1999 : Russkie sezony teatra Gabima. Moscow : Artist. Rezhisser. Teatr. Ivanovich, S[ tepan ], 1926 : “ Iz take kolonizatsye di rikhtike hilf far di yidn in Rusland ? ” In : Forverts, 4 November : 5 ; 5 November : 5. Kenig, G., 1957 : “ Z. Vendrof, veteran fun di yidishe shrayber in FSSR. ” In : Di naye prese, 5 – 6 January : 7. Lestschinsky, Jacob, 1926 : “ A meynung vegn der yidisher kolonizatsye in Rusland. ” In : Forverts, 7 November : 4. Markish, Esther, 1978 : The Long Return. New York : Ballantine Books. New York Times, 1962 : “ Soviet Cites Data on Jewish Gains : Letter, Distributed in West Denies Discrimination. ” In : The New York Times, 13 March : 32. Rocker, Rudolf, 2005 : The London Years. Nottingham : Five Leaves Publications. Shub, David, 1970 : Fun di amolike yorn : bletlekh zikhroynes. New York : tsiko. Smolar, Boris, 1982 : In the Service of My People. Baltimore, md : Baltimore Hebrew College. Tikhii, K. T., 2009 : “ Problemy formirovaniia pozitivnogo obraza sssr v ssha v pervoi polovine 1920-kh gg. ” In : Oykumena 1 : 21 – 32. Vendrovski, Karl, 2008 : “ Memories of my Grandfather. Translated from the Russian by Irene Jerison. ” In : Alan Rems, “ The Vendrovsky Family Over Two Centuries ” ( unpublished ), c-3 a – c-3 d. Vladeck, Baruch, 1926 : “ Faktn vegn der yidisher kolonizatsye in Rusland. ” In : Forverts, 17 November : 7. – 1927 : “ Vladek tsurik fun Eyrope. ” In : Forverts, 5 January : 8. Wells, Linton, 1937 : Blood on the Moon. Boston – New York : Houghton Mifflin Co. 528 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Wendroff, Zalman, 1926 a : “ Vi es halt mit der yidisher kolonizatsye in Rusland. ” In : Forverts, 30 August : 2, 5. – 1926 b : “ Vayterdike argumentn far un kegn yidisher kolonizatsye in sovetRusland. ” In : Forverts, 1 September : 7. – 1926 c : “ Felern un grayzn in der kolonizatsyons-arbet in Rusland. ” In : Forverts, 3 September : 7. – 1926 d : “ Yidishe kolonyes azoy vi zey zaynen un vi es shteln zey for undzere kritiker. ” In : Forverts, 6 September : 2, 5. – 1926 e : “ Itstike lage in der yidisher shtetl in Rusland. ” In : Forverts, 8 September : 9. – 1926 f : “ Yidn geyen oyf erd-arbet, vayl zey viln broyt un birger-rekht. ” In : Forverts, 15 September : 7. – 1926 g : “ A ‘ yidishe republik ’ oder nit keyn ‘yidishe republik ’ . ” In : Forverts, 17 December : 4, 7. – 1970 : “ A shveytserisher untertaner. ” In : Sovetish heymland 1 : 31 – 33. Rebecca Margolis Holocaust and Post-Holocaust Yiddish Theater in Montreal A Canadian Response to Catastrophe Introduction What are the wider implications of Yiddish theater performance during and after the Holocaust in a bystander nation such as Canada ? This study will examine Yiddish theater in Montreal as a Canadian response to catastrophe. It will do so by discussing wartime and post-war ventures to establish permanent, locally trained Yiddish theater troupes in the city, notably by two individuals : Chayele Grober ( 1894 – 1978 ) and Dora Wasserman ( 1919 – 2003 ). The study will examine the repertoire and rhetoric associated with each of these Yiddish community theater projects and the responses of each theater to the events that have since become known as the Holocaust. It posits that the two theater studios bracket a transitional period in Yiddish life within a Jewish immigrant center as it was shifting from an outpost to a hub of Yiddish cultural production on the international stage. During and after the Holocaust, Jewish life in Montreal encompassed a strong Yiddish cultural component. By the early 1920s, the city had become home to over 50, 000 Jews out of a total urban population of some 620, 000. On the 1931 census, 99 percent of Jews in the province of Quebec – a vast majority of whom lived in the Montreal area – claimed Yiddish as their mother tongue. Most of Montreal ’ s Jewish residents had immigrated to Canada within the previous two decades and maintained linguistic and cultural ties with the Old Country. A group of activists closely attuned to the European Jewish heartland as well as its other immigrant centers established a local infrastructure that reflected and refracted global trends in Yiddish culture. As such, Montreal was home to a spectrum of ideologies that promoted Yiddish culture – most notably the Workmen ’ s Circle, the Bund, and the Poale Zion ( which promoted both Yiddish and Hebrew ) – through a wide variety of local organizations. With the province historically divided into two separate spheres – the politically and economically dominant and English-Protestant urban minority and a French-Catholic majority whose population remained largely agrarian – and the Jews marking Montreal ’ s ĳirst sizable non-Christian group, the acculturation of 530 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ the mass Yiddish immigration ranged from incomplete to non-existent. This exclusion from the mainstream encouraged the creation and longterm maintenance of Jewish cultural life, notably in Yiddish.1 By the 1920s, Montreal hosted a daily newspaper, a network of secular Zionist schools with Yiddish and Hebrew curricula, and a non-partisan ‫ייִ דישע‬ ‫לקסביבליאטעק‬ ָ ‫א‬ ָ ( Jewish Public Library ), as well as a sizable group of Yiddish writers whose primary forum for publication was specialized literary journals. Although Montreal remained a minor center of Yiddish culture, it evolved close connections to the larger hubs in Europe as well as nearby New York, and was very active in promoting trends in Yiddish politics and the arts locally. The city remained a major Jewish immigrant center and a vibrant hub of Yiddish cultural life well into the decades after the Holocaust.2 Until the eve of the Second World War, Canadian Yiddish theater consisted largely of imported productions and sporadic amateur performances organized through local cultural organizations. Even as the country ’ s Yiddish center, Montreal was unable to sustain locally produced Yiddish theater until 1939. Instead, Yiddish theater there consisted almost entirely of local theater companies who imported talent from nearby New York City supplemented by visiting performances, and was largely dominated by popular fare. In addition to these offerings, there were sporadic performances by local community organizations such as the Workmen ’ s Circle. While the 1930s marked the emergence of local dramatic societies of a more political orientation – ‫טעאליג‬ ַ ( Theater League ), associated with the Zionist Jewish National Workers’ Alliance, and the militant ‫טעאטער ־ גרופּע‬ ַ ‫ ( ַארבעטער‬Workers’ Theater Group, or arteg ) – they were short-lived.3 Only when the local Yiddish milieu was bolstered by the arrival of refugees from Nazi Europe and, subsequently, displaced persons and other post-war arrivals from Europe, did the city begin to consistently produce theater that drew on local talent. The country ’ s Yiddish theater came into its own with the arrival in Montreal of professionally trained European actors displaced by the events of the Second World War and Holocaust. The founders of Montreal ’ s two permanent Yiddish theaters were products of a new tradition of avant-garde Soviet Jewish theater. Both established studios in Montreal that trained local talent to produce high-caliber theater. In contrast to the wildly popular interwar phenomenon of touring Yiddish theater troupes, such as the Wilna Troupe ( ‫ ) ווילנער טרופּע‬and others, both Grober and Wasserman created theaters 1 2 3 See Robinson and Butovsky 1995. See Robinson, Anctil and Butovsky 1990. See Larrue 1996. Rebecca Margolis : Holocaust and Post-Holocaust Yiddish Theater 531 that were ĳirmly rooted in Montreal : they relied on local resources, local talent and local audiences for support. While caused by the displacing effects of the war and its aftermath, which brought both women to Montreal, this rootedness rendered them an integral part of the local Yiddish cultural and theater scenes. Although both Grober and Wasserman emphasized the artistic dimension of their projects over any potential ideological aspects, their theaters came to form part of wider community discourse about the evolution of Yiddish culture during and after the Holocaust. Chayele Grober, a seasoned actress who had established an international career as a performer of Yiddish and Hebrew songs, initially founded her Montreal Yiddish theater studio in response to circumstances beyond her control. Trained with the Moscow-based Hebrewlanguage Habima theater company, Grober left the troupe in 1928 to establish a solo program of dramatic interpretations of Yiddish and Hebrew folk songs, and spent the next four decades touring her shows internationally. During a visit to Montreal in that same year, she became acquainted with local Yiddish writer and activist H. M. Caiserman, who helped her to establish permanent residence in Canada and introduced her to the journalist Vladimir Grossman, who acted as her manager ( and later became her husband ) as she continued to perform internationally. When the war broke out in 1939, she found herself in Montreal, and, unable to tour Europe as planned, decided to found a local experimental theater. According to her memoirs, after several months of being in the city, she realized that she required a new project, and “ all I knew was the stage. ” Although, in her estimation, Montreal was not a theater city, she undertook the project after proposing the idea to the Caisermans, who responded with enthusiasm and backed her in her efforts.4 The ‫טעאטער גרופּע‬ ַ ‫ ( ייִ דיש‬Yiddish Theatre Group) was formally established in March 1939 under Grober ’ s direction and the auspices of the Jewish Public Library as a local experimental theater atelier. At the formal launch in the home of Montreal-born opera singer Pauline Donalda, Grober outlined her program for the group, with its studies based on the Stanislavski Method and dramatic techniques akin to those of the Moscow Art Theater. During the three years of its existence, Grober ’ s yteg produced widely lauded original works that included montages, adaptations of classic Yiddish literary works, and original poetry penned by local writers. Despite being an amateur theater, the studio offered its young members rigorous and systematic training in song, dance, rhythmics, 4 Grober 1968 : 103. 532 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Yiddish Theatre Group cast, program for the January 1942 performance. Jewish Public Library Archives, Montreal Rebecca Margolis : Holocaust and Post-Holocaust Yiddish Theater 533 and diction, with an emphasis on improvisation and the process of developing a repertoire. Members of the troupe worked collectively to adapt a literary work into a scene using song, speech, and movement. The studio would then intermittently present the products of these efforts to the general public. Grober collaborated with local writers, notably established Montreal Yiddish poet J. I. Segal ( 1896 – 1954 ), and productions included specially commissioned sets from local painter Alexander Bercovitch ( 1892 – 1951 ). The yteg operated thanks to wide community support that encompassed Yiddish writers, artists, and cultural activists, and was hailed in the Yiddish press as the coming of age of Canadian Yiddish theater. Dora Wasserman, a product of the Moscow Yiddish Art Theater ( goset ), spent the years of the Second World War performing in theater troupes in Kiev and Kazakhstan before arriving in Montreal in 1950 as a displaced person. Her studio emerged out of local community theater projects that she coordinated, including small performances at local institutions or Yiddish children ’ s theater workshops held in her home. The principal of a local secular Jewish school invited her to direct student theater productions and helped her to establish the Jewish People ’ s Schools Graduates’ Society as a community amateur group in 1957, and the Society staged ambitious productions in the auditorium of the school. When the troupe expanded, Wasserman transformed the Jewish People ’ s Schools Graduates’ Society into a repertory theater in 1960. Wasserman incorporated the studio as the Yiddish Theatre Group in 1967 and it joined the city ’ s newly created Saidye Bronfman Centre for the Arts, known today as the Segal Centre for Performing Arts. Still active today, the Dora Wasserman Yiddish Theatre has produced a wide array of productions, from classic works of Yiddish theater to specially commissioned Yiddish translations of English- and French-language plays. Until she left the theater in 1998 due to failing health, these 70 + productions included adaptations of works by Sholem Aleichem, I. L. Peretz, Isaac Bashevis Singer, and Chaim Grade, and others, alongside works by local authors such as M. M. Shafĳir and Shimshen Dunsky. As one of the world ’ s few permanent Yiddish theaters, it has gained an international reputation and continues to perform annually in Montreal as well as abroad. Despite the fact that audiences are increasingly composed of non-Yiddish speakers, it has been characterized as a stronghold of Yiddish culture. Both Grober and Wasserman were directly affected by the catastrophe of the Holocaust, but their theaters ultimately offered very different responses. These variances underline the degree to which the war 534 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ years were a transitional period in Yiddish cultural life, even in a location far removed from Nazi Europe. During the existence of Grober ’ s studio, Yiddish Montreal remained an outpost of a Yiddishland that was ĳirmly entrenched in Europe ; in Wasserman ’ s time, with the decimation of the Yiddish heartland in Europe, Montreal became a major center of Yiddish culture that was revitalized by displaced European Yiddish activists and artists permanently transplanted to the city. The two theaters bridged the shift of Yiddish language from the realm of everyday communication to one of increasingly symbolic functions in the secular realm. Grober ’ s theater existed during a period when the actors, supporters and audiences largely related to Yiddish as a vernacular. In 1941, over three-quarters of Canadian Jews identiĳied Yiddish as their mother tongue on the Canadian census and Yiddish institutions were thriving despite the immigrant community ’ s dominant trend of linguistic acculturation to English. In contrast, Wasserman ’ s Yiddish theater in post-war Montreal evinces Jeffrey Shandler ’ s concept of post-vernacular Yiddish, which argues that the culture has become increasingly performative in the post-Holocaust era, with the language taking on values not contingent on linguistic fluency ; in response to these conditions, music and theater, which do not rely on an ability to speak or even understand a language, have expanded rapidly.5 The community aspect of Grober ’ s and Wasserman ’ s theaters also reflected the different dynamics surrounding the place of Yiddish culture during and after the Holocaust. Grober ’ s theater was widely reocgnized as a major development in Montreal ’ s Yiddish cultural life and supported as a signiĳicant artistic venture ; however, this support was not enough to maintain the studio. Wasserman ’ s theater has been characterized as a bastion of secular Yiddish culture in a context where Yiddish was facing decline. It has received extensive support that has buoyed it into the present day to form an integral part of Jewish theater in the city of Montreal. Although Grober initially understood her sojourn in Montreal as temporary, and the studio as a project to occupy her until the end of the war when she could resume her international touring schedule, the local Yiddish community involved itself closely in her project. The rhetoric around Grober ’ s yteg theater hinged on the advent of homegrown, high-quality Yiddish theater and the maturation of the Canadian Yiddish cultural milieu rather than on issues of Yiddish linguistic or cultural continuity. Grober ’ s theater marked a crystallization of ambitious Yiddish cultural ventures in the city. Community supporters 5 Shandler 2004. Rebecca Margolis : Holocaust and Post-Holocaust Yiddish Theater 535 formed an executive committee that raised funds and handled some of the logistical aspects of the project ; at one point the yteg had over 200 subscribers. Its inauguration and performances attracted the leaders of various Jewish organizations as well as Jewish members of parliament. The city ’ s Yiddish daily, The ‫ ( קענעדער ַאדלער‬Canadian Jewish Eagle ), whose editors and contributors had long advocated for Yiddish theater with high artistic merit, reported closely and enthusiastically on the development of the yteg. The newspaper ’ s editor, Israel Rabinovitch ( 1894 – 1964 ), a theater enthusiast and co-founder of the pioneering local ‫ ( הזמיר‬The Nightingale ) dramatic and musical group in 1914, who penned regular columns on local theater, wrote numerous articles in support of the yteg. Further, the yteg coordinated public events on Yiddish theater such as symposia and lectures.6 According to Grober ’ s memoirs, “ the yteg became an artistic hub around which the Jewish intellectual population gathered. ” 7 In tandem with this broad community support, the yteg was ĳirmly situated within a wider matrix of Yiddish theater that was evolving simultaneously across the globe. The nexus of Montreal ’ s Yiddish activity was nearby New York City, as well as major Yiddish cultural centers in Poland and the Soviet Union. During the existence of the yteg studio, close connections with the Yiddish motherland in Europe had been interrupted during wartime, but by no means severed. With a transnational Yiddish culture expanding rapidly in the interwar period to develop literary artistic traditions to parallel other major European civilizations, the ultimate goal of the yteg was to produce art on a par with the greatest expressions of Western theater in the majority language of the Jewish nation. The yteg repertoire centered on études based in Yiddish literary works that addressed particular aspects of the Jewish historical experience such as immigration from Europe to America. With its moving tableaux or dramatizations of folksongs with universal themes such as dislocation, the yteg repertoire remained challenging yet accessible to non-Yiddish speakers, as indicated by the positive reviews of its performances in the mainstream English-language press. Ultimately it was the lack of wider community backing that forced the yteg to close, despite the efforts of its supporters. In 1942, Yiddish Montreal remained an immigrant community in the process of Canadianizing. While Grober received support from various parts of the local community, the infrastructure to support a venture such as a permanent Yiddish art theater was not yet in place. The community was in a period of transition linguistically as well as culturally : as its 6 7 Margolis 2011. Grober 1968 : 104. 536 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Yiddish activists attempted to create stability around Yiddish cultural ventures, they found themselves increasingly pushed to the margins of an acculturating Canadian Jewish mainstream. Grober ’ s studio closed when she appealed to a representative of the main chapter of the Workmen ’ s Circle in New York for funding and was informed that Yiddish theater needed to be self-supporting, a perspective that reflected an understanding of Yiddish theater as self-sustaining commercial fare. The vision that Grober and her local supporters held of a high-caliber, edifying, community-based Yiddish theater was not conducive to the popular view of Yiddish theater as entertainment for the masses. Much changed in Yiddish Montreal between the demise of Grober ’ s yteg in 1942 and the late 1950s, when Wasserman ’ s theater became active. The decreased number of Yiddish-speaking newcomers due to the tightening of immigration laws – notably during the period 1933 – 1948 – combined with ongoing linguistic integration resulted in a marked decrease in the language as Jewish lingua franca in Canada. The percentage of Canadian Jews who identiĳied Yiddish as their mother tongue dropped from 77 percent in 1941 to 51 percent in 1951 and 32 percent in 1961. As the destination of some 15, 000 Holocaust survivors ( out of a total of some 35, 000 in Canada ), including renowned writers, actors and other cultural ĳigures, Montreal became a hub of Yiddish cultural activity. However, the overall trend remained a decline of Yiddish as the core Jewish vernacular in Canada. Yiddish newspapers offer but one example of the shift. The ‫ קענעדער ַאדלער‬continued daily publication until the early 1960s, but more and more of its traditional readership sought out English-language publications. While the newspaper continued to offer a wealth of diverse material related to the Holocaust, with linguistic integration, it diminished as a focal point of local Jewish cultural life and became less and less accessible as linguistic facility in Yiddish declined among subsequent generations of Montreal Jews. More broadly, while a host of Yiddish writers continued to publish poetry and prose in the language, translation came to play an increasing role in the dissemination of these works.8 As the place of Yiddish shifted from communicative language to heritage language in the secular sphere, education and performance, notably community theater, marked two areas of growth in the post-Second World War era. In the short period between Grober ’ s and Wasserman ’ s Yiddish theaters, the dynamics of Yiddish culture shifted. Both theaters were ĳirmly entrenched community ventures, yet whereas Grober ’ s theater 8 Margolis 2006. Rebecca Margolis : Holocaust and Post-Holocaust Yiddish Theater 537 was located within a discourse of cultural crystallization, Wasserman ’ s was situated as part of a wider trope of cultural survival against massive losses. Unlike Grober, who found herself stranded in Montreal for what she expected to be a ĳinite period of time, Wasserman arrived from a ravaged post-war Jewish Europe seeking permanent roots in Montreal. By 1950, the decimation of European Yiddish civilization was no longer a question : Wasserman had experienced it ĳirsthand. While, like Grober ’ s, Wasserman ’ s studio grew out of an artist ’ s dream to create high theater, it soon gained the status of a beacon in a ravaged Yiddish world. Shloime Wiseman, the principal of the ‫אלקסשולע‬ ָ ‫ ייִ דישע‬who invited Wasserman to establish her Jewish People ’ s Schools Graduates’ Society in the 1950s, was a strong advocate of Yiddish culture. Since the 1920s, Wiseman had cultivated mechanisms for his students to engage with Yiddish actively both inside and outside of the classroom through clubs, student publications, and performance.9 With Yiddish on the decline, Wiseman understood Wasserman ’ s project as a way of maintaining Yiddish as a living language among his graduates once they left the Yiddish-intensive atmosphere of the school. The project also involved longtime shule teachers Shimshen Dunsky and M. M. Shafĳir, as well as post-Holocaust arrivals such as the poet Mordkhe Husid, who shared Wiseman ’ s vision of the project as a means of safeguarding the continuity of Yiddish in Montreal. An explicit rhetoric of Yiddish continuity manifested itself in conjunction with Wasserman ’ s performances in the 1960s, a period which coincided with the end of commercial Yiddish theater in Montreal. During this period, Montreal ’ s established Jewish community was creating infrastructure to support the venture of permanent, amateur theater in a language that was no longer its lingua franca. Community theater became widely identiĳied as a viable means of keeping Yiddish alive, even as the community as a whole increasingly acculturated and anglicized. As part of a media interview concerning her 1962 production of Sholem Asch ’ s ‫מאזעס‬ ָ ‫ ( ָאנקל‬Uncle Moses ), Wasserman stated, “ We are convinced that Yiddish is still very much a living, breathing language and a signiĳicant component of Jewish life. ” 10 While Wasserman emphasized Yiddish theater as a living art, her studio served to train generations of actors who were not necessarily fluent speakers of the language and also provided an increasingly rare opportunity for audiences to see Yiddish productions. Despite its characterization not only as a community institution, but as a “ symbolic stronghold, ” with 9 Margolis 2011. 10 Cited in Larrue 1996 : 117. 538 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Wasserman as “ the great defender of Yiddish culture, ” 11 the theater has focussed on creating an innovative, fresh repertoire within an increasingly post-vernacular context. She opted not to rely on the beloved standards of the Yiddish stage, nor did her theater explicitly address themes of catastrophic loss. In the 1960s, Wasserman sought out a local pioneer of the French Canadian theater, Gratien Gélinas, for support, as well as other prominent individuals in the local English- and French-language theater milieus. She expressed a clear commitment to building bridges between cultures through theater. Among her productions were groundbreaking works of Yiddish theater including specially commissioned translations of plays such as French-Canadian playwright Michel Tremblay ’ s Les belles-sœurs.12 The repertoire Wasserman selected emphasized the malleability and vitality of Yiddish theater, which could encompass not only classics of the Yiddish stage but bold interpretations of works adapted from other cultures. In the public eye, Wasserman ’ s achievements hinged on her success as a director as well as her steadfast commitment to Yiddish culture. When she was invested into the prestigious Order of Canada ( 1993 ), she was identiĳied as follows : “ A creative producer and director, she has made an outstanding contribution to the performing arts in Canada and to the cultural heritage of the Canadian Jewish community. Founder of the Yiddish Theater of Montreal, she has staged many plays, including adaptations of Canadian works, in Yiddish, thereby helping to preserve a rich language and literature. ” 13 The discourse around her theater inevitably integrates the Holocaust. For example, the website of the Dora Wasserman Yiddish Theatre ’ s biography of Wasserman concludes with the line, “ It was Dora Wasserman ’ s vision, talent and determination that helped Yiddish theater rise from the ashes of the Holocaust and thrive again as a vibrant cultural force. ” 14 What did it mean to create new expressions of Yiddish theater during and following the Second World War ? Montreal was not the immediate destination of the Holocaust survivors who settled in the city. Rather, most spent several years as displaced persons in Europe waiting for papers that would allow them to start new lives abroad. Canada ’ s immigration policy remained restrictive through 1948, and most of the 11 Ibid. 12 Margolis forthcoming. 13 The Governor General of Canada, It ’ s an Honour, Dora Wasserman. ( http ://www.gg.ca/ honour.aspx ?id=3123&t=12&ln=Wasserman ). Wasserman was also invested into the Order of Quebec ( 2003 ). 14 Dora Wasserman Yiddish Theatre 2011. Rebecca Margolis : Holocaust and Post-Holocaust Yiddish Theater 539 Jews who entered the country after World War II did so beginning in the late 1940s.15 Those who sojourned in displaced-persons camps, like Wasserman, were exposed to a flurry of Yiddish cultural activity. In Germany, which housed a large number of the Jewish displaced persons camps, a vast majority of the some 150 Jewish newspapers that were published between 1945 and 1950 appeared in Yiddish. These ĳilled a wide need among displaced persons for reading material, offered a forum for new literature, and also engaged with issues of cultural continuity.16 Yiddish performance played an important role in post-war Jewish culture. In displaced persons camps, a variety of music was performed, including a wide-ranging Yiddish repertoire. Guest performances by renowned Yiddish singers raised morale in the camps, while the displaced persons created their own original songs that addressed their experiences of loss and displacement, and allowed them to mourn, memorialize, and articulate deĳiance in the aftermath of the Holocaust as well as longing for a new home.17 Yiddish theater productions, which were extremely popular in displaced persons camps, gave the survivors – both performers and audiences – personal agency to articulate and form their collective memories of the Holocaust as well as actively shape their experiences of the past, present, and future. In addition to staging classics of the Yiddish theater, they depicted Jewish wartime suffering and resistance, and promoted Zionist themes.18 Wasserman was among those who performed a Yiddish repertoire for displaced persons at a transit camp for Jewish refugees in Vienna. In the transitional period of the immediate postwar era, Yiddish served as a transnational uniĳier and lingua franca among displaced persons, whom Miriam Isaacs identiĳies as “ the last sizeable Yiddishspeaking community in Europe. ” 19 A number of survivors identiĳied the public use of Yiddish not only with everyday communication but with Jewish cultural continuity ; they understood writing and publishing in the language as a form of reclamation and an avenue to psychological healing,20 while others romanticized it.21 However, the transition away from Yiddish was underway even in the displaced persons camps : while publications in Yiddish were seen as assertions of a revival among dis15 16 17 18 19 20 21 Abella and Troper 1982. Lewinsky 2010. Brill 2010. Myers Feinstein 2011. Isaacs 2010 : 86. Ibid. : 87. Ibid. : 91. 540 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ placed persons, they reached a limited readership outside of the camps ; further, as the older generation of survivors focussed on rebuilding, the younger one sought out new expressions of culture, in particular of a Zionist orientation.22 In the postwar exodus from Europe, efforts to restore and revive Yiddish were transplanted to new immigrant centers such as Montreal. With the arrival of thousands of survivors, including many noted cultural ĳigures, the city became a revitalized hub of Yiddish activity. While two areas of marked growth in the post-Second World War era were education and performance, other areas of Yiddish culture that required high linguistic proĳiciency declined, notably Yiddish publications, including newspapers, journals and books. Thus while David Roskies ’ s discussion of Yiddish and Hebrew after the Holocaust posits that the Yiddish press, which published a wide variety of literary responses to the catastrophe, “ was to remain for decades the main purveyor of Holocaust memory, ” 23 the actual readership of these newspapers declined as Yiddish was supplanted as shared Jewish vernacular. Conversely, areas that facilitated access to Yiddish culture such as schooling, music or theater grew in importance as potential arenas of Holocaust commemoration. Secular Jewish schools with Yiddish curricular content integrated the Holocaust into classroom learning as well as memorial events. In contrast, the Holocaust remained marginal to both Grober ’ s and Wasserman ’ s Montreal Yiddish community theaters. Grober ’ s and Wasserman ’ s theaters both articulated responses to the Holocaust, but never as a core component of the repertoires. The yteg repertoire was based in works of Yiddish literature centered on the immigrant and workers’ experience, adaptations of poetry by American and Soviet poets, or classics written by I. L Peretz. Wasserman ’ s productions comprised large-scale musicals and dramatic works, both classics of the Yiddish stage and innovative new productions. Both approaches were forward-looking and rooted in the concept of theater as a universally accessible form of art that ultimately transcends cultural differences. Although Wasserman experienced the displacement of the Holocaust ĳirsthand and acted as a performer in the displaced persons camps, her approach to theater was centered on the creation of art rather than the commemoration of the losses of the Holocaust. The performance in the yteg ’ s ĳinal season in 1942 marked the studio ’ s ĳirst and only direct reference to the destruction of Jewish life in Nazi Europe. The yteg ’ s third program – prepared by Grober together with the poet J. I. Segal – opened with an epic poem composed by Segal 22 Ibid. : 101 f. 23 Roskies 2011 : 84. Rebecca Margolis : Holocaust and Post-Holocaust Yiddish Theater 541 for the yteg titled ‫געטא‬ ָ ‫ ( די הייליקע‬The Holy Ghetto ). The text of the poem depicts a ghetto ĳilled with wandering half-dead people uttering snatches of tormented dialogue. It concludes : 24 ‫רפּײניק‬ ַ ‫א‬ ַ ‫ וועלט‬,‫ארשעם אונדז נישט‬ ַ ,‫וועלט‬ ,‫אונדז נישט‬ ,‫וועלט גיב אונדז אונדזער ָארט אויף דר ׳ ערד‬ ,‫ גלות‬,‫ארענטערט‬ ַ ‫האט די וועלט‬ ָ .‫ עמי‬,‫ נחמו‬,‫נחמו‬ World, don’t shame us, world, don’t torment us, world, give us our place on earth, but the world replied : goles [ exile ], nakhamu, nakhamu, ami [ comfort, ye, comfort ye, my people ( Isaiah 40 : 1 ) ]. Segal ’ s work marked a departure from the previous repertoire of the yteg in both form and content. This ĳinal performance of the yteg before the studio ’ s closing offered a Canadian response to the perils facing European Jewry in Nazi Europe through the eyes of a Montrealbased poet. By the end of 1942, the scope of the destruction of European Jewry, in particular in Poland, was no longer in question, with detailed reports appearing in mainstream Canadian English-language newspapers.25 Further, for the Yiddish community, the systematic persecution of Jews in Nazi Europe had long been publicly acknowledged in the Yiddish press, in news reports, editorials and literary responses ; 26 Segal was among the Keneder Adler ’ s regular contributors and functioned as its literary editor. Although the performance ’ s audience included non-Yiddish speakers, these were largely non-Jews who had come to see Grober ’ s experimental theater ; this is evidenced by the elucidatory nature of the English and French sections of the program book in comparison with the Yiddish. The assumption was that Jewish audience members understood the Yiddish content, which addressed the suffering of their European brethren. In this way, Segal – via the yteg – was able to give voice to the anguish of the local Montreal Jewish community in a public forum. One can only speculate as to whether there would have been more Holocaust content had this performance not been the yteg ’ s last. Like Grober ’ s, Wasserman ’ s repertoire did not emphasize the Holocaust. One area where it has offered explicit responses to the Holocaust has been outreach and broad community education in its resident youth wing, a troupe called Young Actors for Young Audiences ( yaya ) that was formed two decades ago as a venture to integrate youth into the theater. Beginning in 2003, under the direction of artistic direc24 In her memoirs, Grober calls the poem, ‫געטא‬ ָ ‫ ( די געטלעכע‬The Godly Ghetto ). Noting that it does not appear in any of Segal ’ s published works, she cites the poem in full. Grober 1968 : 104 – 111. 25 Frisse 2011 : 232 f. 26 Margolis 2012. 542 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ tor Bryna Wasserman ( Dora Wasserman ’ s daughter ), the group staged a production called “ No More Raisins, No More Almonds, ” a performance written by Holocaust survivor and educator Batia Bettman that comprised a selection of Yiddish songs written about the experiences of youth in a ghetto during the Holocaust. Performed by some 60 Montreal high school students for audiences of the same age in Canada as well as the United States, the play aims to “ teach the lessons of the Holocaust, combat racism and anti-Semitism and promote tolerance ” ( Teachers’ Guide ). As part of this goal, the performances are followed by a “ talkback ” that allows the audiences, largely of non-Jewish background, to ask the performers questions about the show, resulting in open dialogue between students of non-Jewish and Jewish backgrounds. This approach hinges on a pedagogical approach to teaching tolerance and anti-racism through the lessons of the Holocaust.27 On the surface, the function of the yaya Holocaust repertoire could not have been more different from the yteg ’ s 1942 production of ‫די‬ ‫געטא‬ ָ ‫ הייליקע‬. Sixty years later, the yaya audiences were far-removed from the Holocaust in terms of both geography and group experience. The Holocaust was not “ their ” story : the play, although it centered on the Holocaust, was a means to build bridges between groups and thereby combat discrimination. The two works represent responses to the Holocaust from vastly different eras of Yiddish cultural life. Concluding remarks Both Grober ’ s and Wasserman ’ s theaters were born out of a quest to create high-quality Yiddish theater, with one major point of divergence : the changing position of Yiddish in relation to the Holocaust. Both theaters depended on community support, trained non-professional actors in the art of Yiddish theater, and presented innovative productions to a wide public, both Yiddish- and non-Yiddish-speaking. However, in contrast to the yteg, the Dora Wasserman Yiddish Theatre evolved in a context where Yiddish was on the wane, both in terms of numbers of speakers and as a shared marker of Jewish identity. Grober ’ s yteg existed at a crossroads where a vibrant Yiddish cultural life was still a viable expression of Canadian Jewish identity. Wasserman ’ s theater has evolved within a larger rubric of loss and preservation of Jewish heritage. Both theaters were shaped by the War and Holocaust, most concretely through the uprooting and displacement of their respective directors. However, they reflect very different responses to catastrophe. 27 E. g., Carrington and Short, 1997. Rebecca Margolis : Holocaust and Post-Holocaust Yiddish Theater 543 Bibliography Abella, Irving and Harold Troper, 1982 : None is Too Many : Canada and the Jews of Europe, 1933 – 1948. Toronto : Lester & Orpen Dennys. Carrington, Bruce and Geoffrey Short, 1997 : “ Holocaust Education, Anti-racism and Citizenship. ” In : Educational Review 49 ( 3 ) : 271 – 282. Frisse, Ulrich, 2011 : “ The ‘ Bystanders’ Perspective ’ : The Toronto Daily Star and Its Coverage of the Persecution of the Jews and the Holocaust in Canada, 1933 – 1945. ” In : Yad Vashem Studies 39 ( 1 ) : 213 – 243. Gilbert, Shirli, 2010 : “ ‘We Long for a Home’ : Songs and Survival among Jewish Displaced Persons. ” In : Michael Berkowitz and Avinoam Patt, eds., “ We Are Here ” : New Approaches to Jewish Displaced Persons in Postwar Germany. Detroit : Wayne State University Press, 289 – 307. Grober, Chayele, 1968 : Mayn veg aleyn. Tel Aviv : Y. L. Perets-farlag. Isaacs, Miriam, 2008 : “ Yiddish in the Aftermath : Speech Community and Cultural Continuity in Displaced Persons Camps. ” In : Simon J. Bronner, ed., Jewishness : Expression, Identity, and Representation. Oxford : Littman Library of Jewish Civilization, 84 – 104. Larrue, Jean Marc., 1996 : Le théâtre yiddish à Montréal / Yiddish Theater in Montreal. Montreal : Éditions Jeu. Lewinsky, Tamar, 2010 : “ Dangling Roots ? Yiddish Language and Culture in the German Diaspora. ” In : Michael Berkowitz and Avinoam Patt, eds., “ We Are Here ” : New Approaches to Jewish Displaced Persons in Postwar Germany. Detroit : Wayne State University Press, 308 – 334. Margolis, Rebecca, 2006 : “ Yiddish Translation in Canada : A Litmus Test for Continuity. ” In : ttr ( Traduction Terminologie Rédaction ) 19 ( 2 ) : 149 – 189. – 2011 : Jewish Roots, Canadian Soil : Yiddish Culture in Montreal, 1905 – 45. Kingston – Montreal : McGill – Queen ’ s University Press. – 2012 : “ A Review of the Yiddish Media : Responses of the Jewish Immigrant Community in Canada. ” In : Ruth Klein, ed., Nazi Germany, Canadian Responses. Kingston – Montreal : McGill – Queen ’ s University Press, 114 – 143. – forthcoming : “ Les belles-sœurs and Di shvegerins : Translating Québécois into Yiddish for the Montreal Stage in 1992. ” In : Luise von Flotow and Sherry Simon. eds., Translation Effects : The Making of Modern Culture in Canada. Ottawa : University of Ottawa Press. Myers Feinstein, Margarete, 2011 : “ Re-imagining the Unimaginable : Theater, Memory, and Rehabilitation in the Displaced Persons Camps. ” In : David Cesarani and Eric J. Sundquist, eds., After the Holocaust : Challenging the Myth of Silence. London – New York : Routledge, 39 – 54. 544 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Robinson, Ira, Pierre Anctil and Mervin Butovsky, eds., 1990 : An Everyday Miracle : Yiddish Culture in Montreal. Montreal : Véhicule Press. Robinson, Ira and Mervin Butovsky, eds., 1995 : Renewing Our Days : Montreal Jews in the Twentieth Century. Montreal : Véhicule Press. Roskies, David G., 2011 : “ Dividing the Ruins : Communal Memory in Yiddish and Hebrew. ” In : David Cesarani and Eric J. Sundquist, eds., After the Holocaust : Challenging the Myth of Silence. London – New York : Routledge, 82 – 101. Shandler, Jeffrey, 2004 : “ Postvernacular Yiddish : Language As a Performance Art. ” In : The Drama Review 48 ( 1 ) : 19 – 43. Smith, Mark L., 2011 : “ No Silence in Yiddish : Popular and Scholarly Writing about the Holocaust in the Early Postwar Years. ” In : David Cesarani and Eric J. Sundquist, eds., After the Holocaust : Challenging the Myth of Silence. London – New York : Routledge, 55 – 66. Sherman, Joseph, ed., 2004 : Yiddish After the Holocaust. Oxford : Boulevard Books, The Oxford Center for Hebrew and Judaic Studies. Dora Wasserman Yiddish Theater, 2011 : “ Dora Wasserman, c. m., c. q., ” http://www.yiddishtheater.org/en/dora_biography.php Tamar Lewinsky Un az in Treblinke bin ikh yo geven iz vos ? H. Leyvik und die Sheyres-hapleyte Im April 1946 entsandte der Jüdische Weltkongress eine Kulturdelegation zur ‫שארית ־ הפּליטה‬, den jüdischen Überlebenden und Flüchtlingen in den Displaced Persons-Camps im besetzten Deutschland. Die drei amerikanisch-jüdischen Künstler, die am 20. April in Frankfurt aus einer Militärmaschine stiegen, waren der hebräische Schriftsteller Israel Efros, die Sängerin Emma Shayver-Lazorov und der jiddische Poet H. Leyvik. In Uniformen der internationalen Hilfsorganisation unrra ( United Nations Relief and Rehabilitation Administration ) gekleidet und unter deren strenger Kontrolle 1 trafen die drei Künstler mit den jüdischen Überlebenden und Flüchtlingen in München, Garmisch, Mittenwald, Landsberg, Holzhausen, St. Ottilien, Dachau, Föhrenwald, Tutzing, Gauting, Neu-Freimann, Ainring, Leipheim, Feldaĳing, Stuttgart, Berchtesgaden und Aschau zusammen.2 Fünf Wochen lang bereiste die Kulturdelegation die amerikanische Besatzungszone und setzte sich in vielen persönlichen Begegnungen mit dem Schicksal der in Deutschland gestrandeten osteuropäischen Juden auseinander. Besonders die Begegnung zwischen H. Leyvik und der ‫שארית ־ הפּליטה‬ war für beide Seiten prägend. Sie verwies zurück auf die Zeit vor dem Zweiten Weltkrieg und klang noch Jahre nach dem Besuch in Deutschland in den literarischen und publizistischen Werken des Poeten nach. In diesem Aufsatz sollen einige Aspekte der Begegnung zwischen H. Leyvik und der ‫ שארית ־ הפּליטה‬beleuchtet und in ihrem literarischen und historischen Kontext diskutiert werden.3 Zunächst wird der Blick auf die Rezeption der Werke Leyviks durch die dps gelenkt werden. In einem weiteren Schritt sollen aber auch die historische und soziale Dimension der Beziehung zwischen H. Leyvik und der ‫ שארית ־ הפּליטה‬un1 Vgl. Leyvik 1947 a : 53. 2 Alle drei Mitglieder der Kulturdelegation haben ihre Reiseeindrücke in Buchform festgehalten : Efros 1947 ; Leyvik 1947a ; Shayver-Lazorov 1947. 3 Zu den internen politischen Diskussionen der dp-Selbstverwaltung um den Besuch der Kulturdelegation und zur Haltung von Besatzungsarmee und unrra vgl. Levi Shalits persönlich gefärbten Bericht über die Begegnung zwischen H. Leyvik und der ‫ שארית ־ הפּליטה‬: Shalit 1992 ; Zur Hilfstätigkeit Leyviks im Auftrag des New Yorker Y. L. Perets-Schriftstellerverbandes vgl. Lewinsky 2008 : 47 – 50. 546 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ tersucht werden. In diesem Kontext wird zu zeigen sein, wie das Motiv von Leid und Erlösung, das sich wie ein roter Faden durch das Gesamtwerk Leyviks zieht, sich in der Haltung des Dichters den dps gegenüber richtungsweisend verhält – sowohl in seiner Sicht auf die Kriegs- als auch auf die Nachkriegsjahre. Abschließend soll Leyviks szenische Verarbeitung der Begegnung mit der ‫ שארית ־ הפּליטה‬im Theaterstück ‫די‬ ‫ערנוואלד‬ ַ ‫ חתונה אין‬diskutiert werden. Die Sheyres-hapleyte und Leyvik – Die letzten Leser begegnen ihrem poetischen Chronisten Als H. Leyvik in Deutschland eintraf, war er bei den entwurzelten jüdischen dps kein Unbekannter. Bereits nach dem Ersten Weltkrieg gehörte er zu den einflussreichen Stimmen der jiddischen Literatur in Osteuropa und den usa. Seit der Machtergreifung der Nationalsozialisten reagierte er wie ein Seismograph auf die Entwicklungen innerhalb der jüdischen Welt und kommentierte diese in Hunderten von Artikeln und in Gedichten.4 Als einer der ersten jiddischen Schriftsteller in den usa hatte er sich intensiv poetisch mit der Judenverfolgung und der Schoa auseinandergesetzt. Sein preisgekrönter Gedichtband ‫אין טרעבלינקע בין‬ ‫ איך ניט געווען‬erschien 1945 in New York. Im Januar 1946, also bereits einige Monate vor dem Eintreffen der Kulturdelegation, wurden in der Münchener jiddischen Tageszeitung ‫ אונדזער וועג‬auf Anregung des Redakteurs Levi Shalit5 einige von Leyviks Treblinke-Gedichten nachgedruckt. Shalit, seit der Zwischenkriegszeit ein glühender Verehrer Leyviks,6 hatte kurz nach Kriegsende und unter dramatischen Umständen erste Auszüge des Bandes in die Hände bekommen : Der Überlebende des Todesmarsches Richtung Tirol war einen Monat nach seiner Befreiung nach München gekommen, wo sich eine größere Zahl jüdischer Displaced Persons zusammengefunden hatte. In einer Kaserne übernachtete er neben einem Angehörigen der Jüdischen Brigade, der jüdischen Einheit der britischen Streitkräfte in Palästina, der hebräische und jiddische Zeitungen bei sich trug – darunter auch eine Ausgabe von ‫טאג‬ ָ ‫ דער‬mit einem Gedicht Leyviks aus dem Treblinke-Zyklus.7 4 5 6 7 Goldsmith 1992 : 23. Shalit zeichnete damals noch unter dem Namen Shalitan. Shalitan 1945 b. Shalit 1992 : 124 f. Tamar Lewinsky : H. Leyvik und die Sheyres-hapleyte 547 Shalit druckte nicht nur die Gedichte Leyviks in seiner Zeitung nach und machte sie so den jüdischen Displaced Persons zugänglich, sondern richtete Ende 1945 zweifach, in einer poetischen Replik und in einer Rezension, das Wort an den Künstler : Zunächst wandte sich Shalit mit dem Gedicht ? ‫וואס‬ ָ ‫יא געווען איז‬ ָ ‫ און אויב אין טרעבלינקע בין איך‬, verfasst am 21. November 1945 in Nürnberg und Leyvik gewidmet, an sein Vorbild. In diesem Gedicht stellt er Leyvik die Frage nach der Verpflichtung des Überlebenden zu erzählen und das Erlebte literarisch festzuhalten. Die Antwort bleibt er dem Leser schuldig, doch macht er deutlich, dass nicht die biographische Erfahrung allein zum Prüfstein für die Legimitation und für die Möglichkeit einer künstlerischen Auseinandersetzung mit Auschwitz und Treblinka gemacht werden könne.8 Scham, Trauma, ( noch ) nicht vollzogene Vergeltung sind die Themen, die den Verfasser bewegen und ihn daran hindern, sich literarisch der Katastrophe zu nähern : 9 ‫ווארט‬ ָ ‫שטאמלדיק‬ ַ ‫איז מן‬ .‫ רציחה געשלין‬,‫ווייטאג‬ ָ ,‫האס‬ ַ ‫מיט‬ ! ‫היעראגלין‬ ָ ,‫אר דיר‬ ַ ‫דאך מנע שורות‬ ָ ! ‫נאר‬ ָ ‫ווארט‬ ָ ‫ ַא‬,‫ טרעבלינקע‬,‫דאנעק‬ ַ ‫מײ‬ ַ : ‫אר מיר ַאליין‬ ַ ‫און‬ .‫באגרין‬ ַ ‫נאך ַאלײן ניט‬ ָ ‫האב‬ ָ ’ ‫וואס כ‬ ָ Eine Woche nach dieser poetischen Wendung publizierte Shalit eine Rezension zu ‫אין טרעבלינקע בין איך ניט געווען‬. Jedes Gedicht, so unterstreicht Shalit in seiner Besprechung, sei ein Monument für den ‫חורבן‬. Neben der literaturkritischen Beurteilung des Bandes steht die Frage nach dem Lesepublikum für solche Werke im Fokus von Shalits Ausführungen. Seine Antwort fällt eindeutig aus : Nicht die us-amerikanischen Juden, die Jiddisch nur noch mangelhaft beherrschten, würden durch die Gedichte Leyviks angesprochen. Es seien vielmehr die osteuropäischen Juden, die Leyvik noch aus der Zeit vor dem Krieg kannten, welche von seinen Zeilen bewegt würden und für sie, für die Überlebenden – aber auch für die ermordeten osteuropäischen Juden – , seien die Gedichte daher bestimmt : 10 ‫מאכן קײנע‬ ַ ‫און נישט ווילנדיק רעגט זיך מיר ׃ „ למי ַאתּה עמל ? ” איך וויל נישט‬ ‫זײנען די לעצטע לײענער ון‬ ַ ‫ איך גלויב נישט לײדער און ב ” ה ַאז מיר‬.‫אויסירן‬ ‫ ייִ דן ון‬,‫מיליאנען הרוגים‬ ָ ‫ווײטאג אויף די‬ ָ ‫שטארקער ווערט דער‬ ַ ‫ ָאבער‬,‫ייִ דיש‬ ‫הארצן דער נישט אויהערנדי־‬ ַ ‫שנײדט זיך אין‬ ַ ‫מעסער־שארף‬ ַ .‫מזרח־אײראפּע‬ ָ 8 Dazu auch die Einleitung in Shalit 1949 : o. S. 9 Shalitan 1945 a. 10 Shalitan 1945 b. 548 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ ‫טאקע אין‬ ַ ‫ לײוויק איז‬.‫ווארט‬ ָ ‫מיליאנען לעזער ון ייִ דישן‬ ָ ‫קער צער אויף ָאט די‬ ‫ארברענט‬ ַ ‫דארטן‬ ָ ‫זײנען‬ ַ ‫מיליאנען לעזער‬ ָ ‫זײנע‬ ַ ‫ ָאבער‬,‫טרעבלינקע נישט געווען‬ .‫געווארן‬ ָ Es war eine außergewöhnliche Konstellation, eine Inversion des Verhältnisses von Verfasser und Leser, auf die Shalit hier verwies : Denn im vorliegenden Fall war der Leser derjenige, der das Univers concentrationnaire 11 betreten hatte, während der Verfasser sich nicht dem Diktum stellen, ob man nach Auschwitz noch Gedichte schreiben dürfe, sondern sich mit der Frage auseinandersetzen musste, wer dazu berechtigt ist. Wie also begegneten diejenigen, die Konzentrationslager, Flucht und Verfolgung in Europa überlebt hatten, einem Schriftsteller, der nicht in Treblinka gewesen war und trotzdem darüber schrieb und sich später auch intensiv mit dem Leben in den dp-Camps auseinandersetzte ? Nicht nur bei Shalit, sondern auch in anderen zeitgenössischen Rezensionen und Berichten wird deutlich, dass Leyvik von den dps dazu legitimiert wurde, über die Vernichtung des europäischen Judentums und die wenigen Überlebenden zu schreiben. Vor allem erklärt sich dies durch die Biographie des Poeten und durch seine Werke. Obschon Leyvik kein Auschwitz-Überlebender war, hatte er Verfolgung, Haft und Leid am eigenen Leib erfahren. In impressionistischen epischen Gedichten verarbeitete er seine traumatischen Erfahrungen jahrelanger Haft und Verbannung, die er vor seiner Flucht in die USA im Zarenreich erdulden musste. Leyviks Werk kreist dabei immer wieder um seine Biographie.12 Eine knappe Generation bevor die schrecklichen Ereignisse der Schoa zur Gewissheit wurden, hatte Leyvik ein literarisches Modell geschaffen, das in verschiedenen Aspekten auch die spätere khurbnLiteratur beeinflusste. Gerade die ältere Generation der jüdischen dps, die ja nicht nur den Zweiten Weltkrieg, sondern auch den Ersten, den › Grossen Krieg ‹, wie er damals noch hieß, erlebt hatten, waren mit Gestalten wie Leyviks ‫ גולם‬und mit seinen messianischen Visionen aufgewachsen. So verwundert es nicht, dass Levi Shalit den Dichter stürmisch begrüßte : 13 11 Rousset 1946. 12 Zu Leben und Werk Leyviks siehe z.B. Leksikon 1963 ( v) : 108 – 128 und Winer 1992 : 196 – 202. 13 Shalitan 1946. Der Artikel, der eigentlich ein Willkommensgruß an die ganze Kulturdelegation ist, widmet sich fast vollständig Leyvik. Die beiden anderen Gäste werden nur in den letzten Abschnitten erwähnt. Tamar Lewinsky : H. Leyvik und die Sheyres-hapleyte 549 ‫ארשטײער ון דער ייִ דישער ליט־‬ ָ ‫ דער גרעסטער‬,‫ [ ער‬, ]‫און ער איז געקומען‬ ‫זײן ַא בע־‬ ַ ‫נאך געקענט‬ ָ ‫האט דען‬ ָ ‫ ווער‬.‫ווארט‬ ָ ‫ ון צעווײטיקטן ייִ דישן‬,‫עראטור‬ ַ ‫מעריקאנער ייִ דנטום ? ! אויב אונדזערע ברידער אין‬ ַ ‫סערער שליח צו אונדז ון ַא‬ ‫דאס‬ ָ ‫ איז‬,‫פּײן‬ ַ ‫וואך געווען צו אונדזער‬ ַ ‫זײנען‬ ַ ‫ ַאז זײ‬,‫זאגן‬ ָ ‫ַאמעריקע ווילן אונדז‬ ‫ דעם שעער ון‬,‫ איז שיקן אונדזער לײוויקן‬,‫טאן‬ ָ ‫האבן געקענט‬ ָ ‫וואס זײ‬ ָ ,‫בעסטע‬ ‫ דעם דיכטער ון איו(שע לידער און חלומער ון‬,‫„ גולם ” ביז טרעבלינקע־לידער‬ .‫משיח־טרוים‬ Dass es für den Leser in Deutschland unmöglich war, Person und Werk Leyviks losgelöst voneinander zu betrachten,14 wird auch in den huldigenden Willkommensgrüßen offensichtlich, die der Historiker Israel Kaplan an die Gäste aus den usa richtete. Wie schon Levi Shalit beschreibt Kaplan Leyvik als idealen Emissär für die Aufgabe, den traumatisierten kz-Überlebenden in ihrer » geistigen Lethargie « zu begegnen und ihnen eine erlösende Botschaft zu überbringen. In der jüdischen Geschichte, resümiert Kaplan, sei aus jeder Katastrophe eine messianische Tendenz erwachsen, die als Gegenpol zum Erlittenen Mut und Hoffnung freigesetzt habe. In diese Tradition ordnet er auch Leyvik ein, der durch sein Werk einen » Neo-Messianismus « erträumt habe : 15 ‫דאס ווערק געשריבן‬ ָ .” ‫לײוויקס משיח־מיסטעריע הויבט זיך ָאן מיטן „ גולם‬ ,‫ די גוטסקײט‬,‫נאך ַא וועלכן — ַא צדיק ־ הדור‬ ָ ‫אר ייִ דן און ון ַא ייִ דן‬ ַ ,‫אין ייִ דיש‬ ‫האט‬ ָ ‫הארציקײט און נשמהדיקײט ַאלײן ! און די עדער ון ָאט דעם מענטשן‬ ַ ‫ן־געשטאלט אין דער‬ ַ ‫עפּיגא‬ ָ ‫ברוטאלן‬ ַ ,‫זא רויען‬ ַ ‫רויסגעבראכט ַא וויזיע ון ַא‬ ַ ‫ַא‬ ! ‫משיחיזם ־ קײט — דער גולם‬ Das Visionäre in Leyviks brutaler und zerstörerischer Messias-Gestalt sieht Kaplan in der Antizipation des Hitlerregimes. Der Dichter würde während seines Besuchs in Deutschland sicherlich dessen Nachklänge erspüren können und in Nürnberg, wo den Hauptkriegsverbrechern der Prozess gemacht wurde, den » Goylem-Scherben « dieses » Goylem germanikus « begegnen.16 Doch nicht nur in den Werken Leyviks, folgt man Kaplans Ausführungen, ist der messianische Gedanke zu suchen. Die Person Leyviks erscheint ihm geradezu als Lichtgestalt für die ‫ שארית ־ הפּליטה‬: 17 14 Zur Gestalt Leyviks und der Bedeutung des Poeten als säkularer Prophet vgl. Winer 1992 : 13 – 17. 15 Kaplan 1946. 16 Ibid. 17 Ibid. ‫הײנט‬ ‫לקט ייִ דישע שטודיעס ַ‬ ‫פּאליע‪ .‬צווישן מצורעים און‬ ‫מעטרא ָ‬ ‫ָ‬ ‫אמאליקע וועלט ־‬ ‫ָ‬ ‫אין די מויערן ון רוים‪ ,‬די‬ ‫זײנע וווּנדן —‬ ‫רטאן אין איבערבינדן ַ‬ ‫ָ‬ ‫א‬ ‫קאליקעס זיצט ַא בעטלער‪ ,‬וועלכער איז ַ‬ ‫ַ‬ ‫דאס איז דער צוקונטיקער משיח‪ַ .‬אזוי איז גורם ַאן ַאלטע ייִ דישע לעגענדע‪.‬‬ ‫ָאט ָ‬ ‫לײדנדיקן של ־ רוח איז צו‬ ‫ארשטויסענע און ון ַא ַ‬ ‫יא‪ ,‬צווישן ָאט די לעבנס ־ ַ‬ ‫ָ‬ ‫דערווארטן און שעפּן דערהויבענע אימפּולסן און דערלײזערישן שוווּנג‪.‬‬ ‫ַ‬ ‫דורכגעפּלאגטע ברי־‬ ‫ָ‬ ‫זײנע ַא‬ ‫וואנדלט צווישן די מענטשן‪ַ ,‬‬ ‫טראגט ער זיך‪ ,‬לײוויק‪ַ ,‬‬ ‫ָ‬ ‫דער ון שארית־הפּליטה‪ ,‬פּרוּווט ַאדורך זײערע אויסגעווײטיקטע געזיכטער‪,‬‬ ‫גאר אין‬ ‫האענונגען‪ .‬זיכער וועט ער ָ‬ ‫לײדן און ָ‬ ‫ארטיט זיך צו ַארויסלײענען די ַ‬ ‫ַ‬ ‫נאך יל מעכטיקע‬ ‫נאך דערהויבונג און מיט ָ‬ ‫אר אונדז מיט מער ָ‬ ‫אוישײנען ַ‬ ‫ַ‬ ‫גיכן‬ ‫דערלײזערישע ווערטער‪.‬‬ ‫און מיר —‬ ‫זײן‬ ‫טראכט די שארית ־ הפּליטה לײוויקן אין ַ‬ ‫ַ‬ ‫בא‬ ‫־טשינאווניק ַ‬ ‫ָ‬ ‫אונררא‬ ‫ַ‬ ‫ניט ווי ַאן‬ ‫דורכשטראלן‬ ‫ַ‬ ‫שטארק צו ַא‬ ‫ַ‬ ‫נאך גענוג‬ ‫גײסט איז ָ‬ ‫זײן ַ‬ ‫אוניארם‪ַ .‬‬ ‫ָ‬ ‫אויגעצוווּנגענער‬ ‫גאסן ון רוים זעען מיר אים‬ ‫יעדן אויסערלעכן ל(וש‪ .‬ווי ַא דוד הראו(ני איבער די ַ‬ ‫ליטעראטור און שׂר ־ הרוח אונדזערן‪.‬‬ ‫ַ‬ ‫ָאן‪ ,‬דעם פּרינץ ון‬ ‫דא‪.‬‬ ‫געווארט אויף אים׃ ער איז ָ‬ ‫ַ‬ ‫האבן‬ ‫מיר ָ‬ ‫גאסט !‬ ‫גרײז‪ ,‬גרויסער ַ‬ ‫ַ‬ ‫גײסט‪ ,‬שײנער‬ ‫טיער ַ‬ ‫‪Kaplan bezieht sich hier einerseits auf eine talmudische Legende, nach‬‬ ‫‪welcher der Messias unerkannt zwischen den Bettlern vor den Toren‬‬ ‫‪Roms sitzt und seine Wunden verbindet18 und andererseits auf die‬‬ ‫‪schillernde Gestalt David Reuvenis, der im 16. Jahrhundert messiani‬‬‫‪sche Hoffnungen weckte, im Februar 1524 auf einem Schimmel in Rom‬‬ ‫‪einritt, und eine Papstaudienz erhielt.19‬‬ ‫‪Die Überlagerung von poetischer Vision, jüdischer Geschichte und‬‬ ‫‪Person kommt auch in einem Gedicht zum Ausdruck, das der jiddische‬‬ ‫‪Dichter Dovid Volpe – auch er hatte Dachau überlebt – dem Dichter‬‬ ‫‪Leyvik widmete. Der Gast wird darin gleichsam zum tröstenden Pro‬‬‫‪ : 20‬שארית ־ הפּליטה ‪pheten der‬‬ ‫ווארט ווי דער נ(יא‬ ‫זאג ַא טרײסט ־ ָ‬ ‫ָ‬ ‫אר אונדז‪ ,‬אויף ב(לס ערד ;‬ ‫דא‪ַ ,‬‬ ‫ָ‬ ‫געקאוועט‪,‬‬ ‫ָ‬ ‫אלק‪ ,‬אין ווײ‬ ‫אר ַא ָ‬ ‫ַ‬ ‫שארף ון שווערד‪.‬‬ ‫ַאנטרונענע ון ַ‬ ‫‪Volpe erinnert sich in seiner Autobiographie, dass der Besuch der De‬‬‫‪legation ein wahres Kulturfestival gewesen sei – mit Empfängen und‬‬ ‫‪voll besuchten Veranstaltungen.21 Die Abreise der Gäste, so der Dichter,‬‬ ‫‪habe bei den dps ein Gefühl der Leere hinterlassen.22‬‬ ‫‪bT Sanh. 98a.‬‬ ‫‪Graetz 1907 ( ix ) : 220.‬‬ ‫‪Volpe 1946.‬‬ ‫‪Volpe 1997 : 308.‬‬ ‫‪Ibid. : 309.‬‬ ‫‪18‬‬ ‫‪19‬‬ ‫‪20‬‬ ‫‪21‬‬ ‫‪22‬‬ ‫‪550‬‬ Tamar Lewinsky : H. Leyvik und die Sheyres-hapleyte 551 Entscheidend für die Legitimation Leyviks als poetischer Chronist der Schoa und der ‫ שארית ־ הפּליטה‬war neben seiner Funktion als säkularer Prophet des jiddischen Wortes also sicherlich auch die Deutschlandreise und das Zusammentreffen mit den jüdischen Displaced Persons. Sie erlaubten Leyvik nicht nur, über die ‫ שארית ־ הפּליטה‬zu schreiben, sondern auch in ihrem Namen zu sprechen. Beide Seiten, der Poet und seine Leser in Deutschland, näherten sich einander im Frühjahr 1946, als Leyvik durch die amerikanische Besatzungszone reiste, Schritt für Schritt an. Der Schriftsteller und Literaturkritiker Yitskhok Goldkorn spricht davon, dass Leyvik den dps innerlich eng verbunden gewesen sei. ‫זײן טין אויסדרוק אין דעם גרויסן ווערק „ אין‬ ַ ‫באקומען‬ ַ ‫האט‬ ָ ‫וואס‬ ָ ,‫ [ ַא בונד‬... ] ‫ ווי בכלל אין‬,‫לאגערן‬ ַ ‫באזוך אין די‬ ַ ‫זײן‬ ַ ‫ אין‬,” ‫טרעבלינקע בין איך ניט געווען‬ ‫אומבאקוועמער‬ ַ „ ‫שרײבעריש צו דער‬ ַ ‫זײן כּ סדרדיקן אומקערן זיך פּערזענלעך‬ ַ .” ‫טעמע‬ Die Gestalten aus den Werken des Visionärs, urteilt Goldkorn, verkörperten die ‫שארית ־ הפּליטה‬, sie sei der Prototyp der leidenden Bettler, die vor den Toren Roms auf Erlösung hoffen, sie sei das » tragische Symbol des modernen sadistischen Sodoms «, das ehemalige kz-Häftlinge in Bewohner internationaler Lager verwandelt habe.23 Er verleiht deshalb dem Dichter, der die Überlebenden durch eine » Glaubenstransfusion « moralisch gestärkt habe, den Titel eines » Ehren-dps « und » Ehrenbürgers « der ‫שארית ־ הפּליטה‬,24 ein Identiĳikationsangebot, das Leyvik mit Dankbarkeit und ohne zu zögern annahm. Schrieb er doch nach seiner Rückkehr aus Deutschland selbst : 25 ‫ ווי ייִ דישע דיכ־‬,‫מעריקאנער‬ ַ ‫ ווי ַא‬,‫לאגערן‬ ַ ‫מיר זענען געקומען צו די ייִ דן אין די‬ ‫ מיר נעמען מיט דעם טיטל‬.‫ארן מיר ַאוועק ווי ייִ דישע די ־ פּיס‬ ָ ‫ארן‬ ָ ‫ און‬,‫טער‬ .‫שטאלץ‬ ָ ‫מיט‬ H. Leyvik schreibt über die Sheyres-hapleyte Nach seiner Rückkehr in die usa publizierte der » Ehren-dp « Leyvik seine Tagebuchaufzeichnungen, die während des fünfwöchigen Aufenthalts in Deutschland entstanden waren in ‫טאג‬ ָ ‫ דער‬. 1947 erschien der Reisebericht in Buchform unter dem Titel ‫ מיט דער שארית ־ הפּליטה‬. In 23 Goldkorn 1949 : 47. 24 Ibid. : 47 f. 25 Leyvik 1947 a : 299. 552 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ den Einträgen spiegelt sich immer wieder die Erschütterung wider, die einzelne Begegnungen und Bilder beim Verfasser hervorriefen. Leyvik unterstreicht wiederholt, dass er in der Konfrontation mit den Überlebenden und ihren Geschichten an die Grenzen seiner Vorstellungskraft stoße. Jedes Gespräch mit den Überlebenden bestürzt ihn von neuem und gleichzeitig bringt er ihnen tiefste Bewunderung entgegen. Im Benediktinerkloster St. Ottilien beispielsweise, in welchem ehemalige Dachauer Häftlinge kurz nach ihrer Befreiung ein jüdisches Krankenhaus eingerichtet hatten, sieht er zum ersten Mal auf seiner Reise eine Gruppe dp-Kinder. Ihre Lehrerin hatte ihre beiden eigenen Kinder im kz verloren und opfert sich nun für die jüdischen Waisen auf, im Versuch, den Verlust zu überwinden und das eigene Überleben zu rechtfertigen.26 Der Auftritt der Kulturdelegation im Kloster ĳindet vor einem Publikum von fast vierhundert Personen statt, das Programm wird ergänzt durch Auftritte des Lagerorchesters St. Ottilien und einer Sängerin, die kz-Lieder zum Vortrag bringt. Es ist ein Abend, der Publikum und Künstler tief bewegt.27 Am folgenden Tag besucht Leyvik diejenigen Patienten, die dem Konzert nicht beiwohnen konnten, an ihren Betten. Seine Furcht vor der Begegnung und vor der Sprachlosigkeit ist aus jeder Zeile herauszuhören. Sei es bei einem hochgewachsenen Mann, der von Weinkrämpfen geschüttelt wird, der, so Leyvik, aufgehört habe, sein Schicksal zu beweinen und nur noch weinen könne. Sei es bei einem Patienten, dessen halbes Gesicht durch eine Schussverletzung entstellt ist. Sei es bei einem jungen Mann, der halbseitig gelähmt ist.28 Leyvik dokumentiert in seinem Tagebuch akribisch die Begegnungen und Gespräche, notiert Anekdoten und Gräuelgeschichten, die ihm die dps erzählen und zeigt sich stets tief getroffen und gleichzeitig beeindruckt. Geradezu charakteristisch für seine Schilderungen – ob es sich dabei um Krankenbesuche in St. Ottilien, um Aufenthalte in größeren dp-Camps wie Föhrenwald oder Feldaĳing handelt oder um Sitzungen mit den ofĳiziellen Vertretern der dp-Selbstverwaltung – ist die Überhöhung der Überlebenden als Märtyrer : 29 .‫באנעמען‬ ַ ‫לאגערן ניט‬ ַ ‫זאכן אין די ייִ דישע‬ ַ ‫איך קען ַא סך‬ ‫וואס ַאיעדער‬ ָ ,‫לײדן‬ ַ ‫גאנצן סכום ון‬ ַ ‫באנעמען דעם‬ ַ ‫מער ון ַאלץ קען איך נישט‬ .‫דורכגעמאכט‬ ַ ‫האט‬ ָ ‫קלענסטער מיטגליד ון דער שארית ־ הפּליטה‬ .‫ ָאנמעכטיק און קלײן‬,‫שוואך‬ ַ ‫ַאנטקעגן דעם מינדסטן ייִ דישן קרבן יל איך זיך‬ 26 27 28 29 Leyvik 1947 a : 131 – 133. Ibid. : 135 – 139. Ibid. : 141 – 144. Ibid. : 11. Tamar Lewinsky : H. Leyvik und die Sheyres-hapleyte 553 .‫שפּראך איז נישט בכּוח ַאנטקעגן צו קומען‬ ַ ‫קײנעמס‬ ‫ צי ַאלע ון דער שארית ־ הפּליטה זענען‬,‫טאן מיט דעם‬ ָ ‫גארנישט צו‬ ָ ‫ס’האט‬ ָ .‫ צי נײן‬,‫הײליק‬ .‫זאל צוגײן צו זײ ווי הײליקע‬ ָ ‫ ַאז מען‬,‫גארנישט‬ ָ ‫זײ ַאלײן ווילן‬ .‫ נישט וועלן‬,‫טאקע‬ ַ ‫דארן‬ ַ ‫ און‬,‫טאקע‬ ַ ‫זײ מעגן‬ ? ‫ָאבער ַאנדערע — נישט זײ‬ Die publizistische Auseinandersetzung Leyviks mit der ‫שארית ־ הפּליטה‬ ist geprägt vom moralischen Imperativ, die Überlebenden zu heroisieren. Niemand, der Auschwitz nicht selbst erfahren hatte, besaß nach Leyvik die Berechtigung, sich kritisch über die dps zu äußern. Paradigmatisch für diese Haltung ist ein Artikel, den er 1947 als Reaktion auf die teilweise missbilligende Berichterstattung über die ‫שארית ־ הפּליטה‬ in amerikanisch-jüdischen Publikationen verfasste : 30 Un mir ale, derhojpt di Jidn in Amerike, hern doch nit ojf cu rejdn un cu szrajbn, az der gojrl fun der Sz.-H. iz undzer gojrl, az ir wej iz undzer wej ; fundestwegn herszt noch alc cwiszn undz a blondszenisz, an umzicherkajt, a min tapn in der ĳincternisz, wen nor mir rirn zich cu cu dem pajnlechn kapitl. Es kumt ojs, az mir rejdn noch alc wi wegn a jidiszn szejwet, wos iz farworfn geworn ergec ojf der lewone [ … ] Firn mir pilpulim : Wi zol zajn undzer cugang cu der Sz.-H. – ci zol undzer cugang zajn a romantiszer, ci a poetiszer, ci gor a sztrejng realistiszer […]? Ober wos ken undz helfn undzer szakle-wetarje un wuhin ken es ĳirn ? Beser gezogt : wos kenen undzere szakles-wetarjes [ sic ] helfn bepojel mamesz ir, der Sz.-H. alejn ? Dos iz noch majn mejnung dos wichtikste. Von den Hilfsorganisationen und der jüdischen Öffentlichkeit verlangt er einen empathischen und kritikfreien Umgang mit der Situation der dps in Deutschland. Den Freiheitswunsch eines Häftlings, schreibt Leyvik weiter, müsse man durch seine Augen zu verstehen versuchen ( und bezieht sich damit vermutlich nicht nur auf die Situation der dps, sondern auch auf seine eigene Biographie ) : 31 S’iz nit recht cu kumen cu an arestant un, sztejendik of der zajt grate [ sic ], farnemen zich merer mit psichologisze baobachtungen un mit gebn im politisz-gezelszaftleche ejces, ejder mit zajn hojpt-bejnkszaft : arojsgejn fun turme un kumen cu zajne noentste, wos wartn ojf im. 30 Leyvik 1947 b. Im Original in lateinischer Schrift. 31 Ibid. 554 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Leyvik empfand sich als Beschützer der ‫שארית ־ הפּליטה‬, doch waren mit dieser Haltung durchaus auch Probleme verbunden. Seine Heroisierung der Überlebenden ließ keine Kritik von Seiten ausländischer Juden und selbst der Repräsentanten der ‫ שארית ־ הפּליטה‬zu. Schon vor seinem Besuch in Deutschland, im März 1946, zeigte sich diese Haltung Leyviks in einem Artikel in ‫ אונדזער וועג‬unter dem Titel ‫ארשוועכן אונדזערע קדושים‬ ַ ‫טארן ניט‬ ָ ‫ מיר‬.32 Dort nimmt er Bezug auf die Reden, die von zwei Vertretern der ‫ שארית ־ הפּליטה‬im Rahmen einer Diskussion zur Rolle der jüdischen Kollaboration während des Naziregimes gehalten worden und von der jüdischen Presse in den usa aufgegriffen worden waren. Zwar spricht er den Referenten das Recht zu, dieses Thema anzusprechen, da sie gleichzeitig Opfer und Zeugen seien. Die Berechtigung amerikanisch-jüdischer Publizisten, die jüdische Kollaboration zu diskutieren und zu werten, weist er jedoch entschieden zurück. Einerseits würde durch diese Diskussion das Bild des jüdischen Martyriums befleckt, andererseits würde man die wahren Schuldigen durch die Anerkennung jüdischer Verfehlungen entlasten. Die Opfer sollten darüber entscheiden, wann der Zeitpunkt gekommen sei, diese Fakten an die Öffentlichkeit zu bringen. Bis dieser Moment gekommen sei, so Leyvik,33 ,‫רויסגעבראכט ון די קרבנות־עדות ַאלײן‬ ַ ‫וואס ווערן ַא‬ ָ ,‫אקטן‬ ַ ‫מוזן מיר די‬ ‫רומצאמען עס מיט קענטיקן‬ ַ ‫ ַא‬,‫איבערלאזן עס אין ַא ווינקל‬ ָ ‫אררעגיסטרירן און‬ ַ ‫ למען־השם ניט‬.‫טעריאלן‬ ַ ‫מא‬ ַ ‫פּצאמען עס ון ַאלע ַאנדערע הויפּט ־‬ ַ ‫שטריך און ָא‬ ‫רטירערשאט און קידוש ־‬ ַ ‫מא‬ ַ ‫גאנצן בילד ון ייִ דישער‬ ַ ‫צוזאמענמישן עס מיטן‬ ַ ‫ ווי ַא גרויסער טײל ון דער‬,‫סאדיסטיש צו זיך ַאלײן‬ ַ ‫ למען ־ השם ניט ווערן‬.‫השם‬ ‫זאלן צוליב די אײניקע‬ ָ ‫זאלן ווערן — ַאז מיר‬ ָ ‫ ַאז מיר‬,‫וואלט וועלן‬ ָ ‫גוייִ שער וועלט‬ ‫גאנצע‬ ַ ‫ארשוועכן די‬ ַ ‫אררעטערישקײט‬ ַ ‫געאלנקײט און‬ ַ ‫ַאקטן ון ייִ דישער‬ ‫גאנצן ייִ דישן ייִ חוס און די‬ ַ ‫מאכן דעם‬ ַ ‫ צו קלײנגעלט‬,‫רטירערשאט‬ ַ ‫מא‬ ַ ‫ייִ דישע‬ .‫מיליאנען ייִ דישע קרבנות צו טויט‬ ָ ‫באגלײט די‬ ַ ‫האבן‬ ָ ‫וואס‬ ָ ,‫גאנצע ייִ דישע ג(ורה‬ ַ Leyviks Absicht war es, die ‫ שארית ־ הפּליטה‬zu schützen und zu verteidigen. Damit fuhr er aber einen anderen Kurs als die Selbstverwaltung der ‫שארית ־ הפּליטה‬, die sich aktiv mit diesen Themen beschäftigte – nicht, um das Ansehen der ‫ שארית ־ הפּליטה‬zu schmälern, sondern im Gegenteil, um Klarheit über die eigene Geschichte zu gewinnen. Für die jüdische Gemeinschaft in Deutschland handelte es sich dabei nicht um eine symbolische Frage. Die Frage war konkret : Als Gesellschaft – und 32 Leyvik 1946. 33 Ibid. ; Leyvik setzte sich auch während seiner Reise sehr intensiv mit dieser Problematik auseinander, wie seine Tagebuchaufzeichnungen vom 2. Mai 1946 zeigen ( Leyvik 1947 a : 168 – 173 ). Tamar Lewinsky : H. Leyvik und die Sheyres-hapleyte 555 sei es nur als provisorische – musste sie ihre moralischen Werte verteidigen und das war nur durch eine Politik möglich, die sich kritisch mit der Vergangenheit auseinandersetzte und diejenigen aus ihrer Mitte ausschloss, die mit dem Feind kollaboriert hatten. So entstanden in den dp-Camps sogenannte Ehrengerichte, die intern Verfahren gegen frühere Kollaborateure, Mitglieder von Judenräten, Kapos und Ghetto- und Lagerpolizisten anstrebten.34 Wie gezeigt wurde, war aber die moralische Überhöhung der Opfer ein leitender Aspekt in Leyviks Arbeiten. Noch 1952 kritisierte er in ‫טאג‬ ָ ‫ דער‬ein anonymes Dokument, das im Vorjahr in den Warschauer ‫אר געשיכטע‬ ַ ‫ בלעטער‬abgedruckt worden war. Dieses Dokument, gefunden in den geretteten Teilen des Ringelblum-Archivs,35 verzeichnete die großen Deportationen aus dem Warschauer Ghetto und kritisierte entschieden die Haltung des Judenrates und der Ghettopolizei. Laut Leyvik würde mit diesem Dokument – hinter dem er eine Fälschung der antisemitischen polnischen kommunistischen Partei vermutet – das Andenken an die jüdischen Märtyrer im Ghetto entweiht. In demselben Artikel bezieht sich Leyvik auch auf das in den yivo-Blättern erschienene ‫געטא‬ ָ ‫טאגבוך ון ווילנער‬ ָ von Zalman Kalmanovitsh. In diesem Tagebuch, so Leyvik,36 ‫טראגיש דורכגעדרונגען און דורכלויכטן‬ ַ ,‫ווערט דער ייִ דישער מענטש דערהויבן‬ ‫נאוויטש ַאליין ווערט‬ ָ ‫למא‬ ַ ‫קא‬ ַ ‫ און אויך‬.‫זײנע עליות‬ ַ ‫סײ אין‬ ַ ,‫זײנע ירידות‬ ַ ‫סײ אין‬ ַ .‫זײן שילדערונג דערהויבן‬ ַ ‫דורך‬ Wie der Historiker Ber Mark in einer umfangreichen Replik in der Folgenummer der ‫אר געשיכטע‬ ַ ‫ בלעטער‬zeigen konnte, handelte es sich beim Autor des anonymen Dokuments um den jiddischen Schriftsteller Yehoyshue Perle, dessen Abscheu vor den Entscheidungen des Judenrates von Ringelblum und allen anderen Mitgliedern der Widerstandsgruppe Żydowska Organizacja Bojowa / ‫ניזאציע‬ ַ ‫רגא‬ ַ ‫קאמף ־ ָא‬ ַ ‫ ייִ דישע‬geteilt wurde. Damals begann die Diskussion um die richtige Form des Gedenkens, die schließlich in eine Spaltung mündete : Während die einen in den Dokumenten nach den historischen Entwicklungen suchten und die Erinnerung wachzuhalten bestrebt waren, indem die Wunden der Geschichte wieder geöffnet wurden, sakralisierten die anderen das Andenken an alle Umgekommenen.37 Diese Kontroverse, die 1952 in der 34 Myers Feinstein 2010 : 238 – 248. 35 Leksikon 1968 ( vii ) : 195. 36 Zitiert nach dem Nachdruck des Originalartikels in der Münchener jiddischen Presse : Leyvik 1952. 37 Roskies 2005 : 179 f. 556 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Auseinandersetzung zwischen Mark und Leyvik entflammte, hatte bereits Mitte der 1940er Jahre in der jiddischen Presse in Deutschland ihren Auftakt. Leyviks Haltung der ‫ שארית ־ הפּליטה‬gegenüber bedeutete nicht, dass er ihre gesellschaftlichen Schwächen ignorieren wollte und konnte. Er fand durchaus kritische Worte für die jüdische Gemeinschaft in Deutschland. Die Schuld suchte er aber nicht bei der ‫שארית ־ הפּליטה‬, sondern in den Umständen, unter denen diese Juden leben mussten. Zu diesen Umständen zählte vor allem, dass sie ausgerechnet in Deutschland, auf deutschem Boden und neben der deutschen Bevölkerung ausharren mussten. Denn so sehr Leyvik die ‫ שארית ־ הפּליטה‬heroisierte, so sehr verachtete er den » Goylem germanikus «, wie ihn der Historiker Israel Kaplan genannt hatte. Besonders deutlich kommt diese Ablehnung in einem Tagebucheintrag zum Ausdruck, den er am 22. Mai 1946 in Berchtesgaden, kurz vor seiner Abreise aus Deutschland, verfasst hatte. In diesen Notizen, niedergeschrieben unter dem Eindruck der fünfwöchigen intensiven Begegnung mit der ‫ שארית ־ הפּליטה‬und dem Aufenthalt in der amerikanischen Besatzungszone, spürt Leyvik den Begrifflichkeiten nach, die sich in der Sprache der dps eingebürgert hatten, unter anderem dem ständigen Gebrauch des Ausdrucks ” ‫דײטשע ערד‬ ַ ‫ „ בלוטיקע‬. Zunächst, so schreibt er, habe er sich an der überall präsenten Formulierung, an ihrer reflexhaften Wiederholung, gestört. Doch je länger er in Deutschland gewesen sei, umso klarer habe er verstanden, dass sich ein ganzes Land schuldig gemacht habe.38 Für ihn war das » Kainsmal «, das sich auf der Stirn der Deutschen durch den Massenmord eingebrannt hatte, über Generationen nicht abzuwischen. Wer dies vor der Zeit versuchen würde, so Leyviks Urteil, beginge eine historische Freveltat und müsste selbst zu einem der ” ‫ „קין ־ שותּים‬gestempelt werden : 39 .‫דײטשער ערד‬ ַ ‫זײן אויף דער‬ ַ ‫הײנט נישט‬ ַ ‫טארן‬ ָ ‫אר מיר ׃ ייִ דן‬ ַ ‫קלאר‬ ָ ‫ס ’ איז‬ Aus diesem Grund war Leyvik ein entschiedener Gegner der neu entstehenden jüdischen Gemeinden und zunächst auch der Wiedergutmachungsverhandlungen.40 Gut und Böse, verflucht und heilig, ‫ חורבן‬und ‫ – גאולה‬dass die extreme Dialektik in Leyviks Auseinandersetzung mit der ‫שארית ־ הפּליטה‬ und Deutschland den Poeten während seines Besuchs in Deutschland 38 Leyvik 1947 a : 14 f. 39 Ibid. : 16. 40 Lewinsky 2008 : 216. Tamar Lewinsky : H. Leyvik und die Sheyres-hapleyte 557 förmlich zerriss, wird in zahllosen Episoden deutlich : So ist beispielsweise der Fahrer des Wagens, der die Kulturdelegation am 22. April 1946 von München in die bayerische Kleinstadt Garmisch bringt, ein Überlebender der sogenannten Todesmärsche, die ein Jahr zuvor über dieselben Straßen getrieben wurden, die sie nun befuhren. Wie könne man sich vorstellen, so Leyvik, dass sich vor einem Jahr solche Szenen auf diesen Landstraßen zwischen blühenden Feldern abgespielt hätten : 41 ‫ ַאז צווישן ָאט־די עלדער מיט די אויגײענדיקע‬,‫ארשטעלן‬ ָ ‫גאר‬ ָ ‫קאן מען זיך‬ ָ ‫ווי‬ ‫מארדן און‬ ָ ‫מיליאנען‬ ָ ‫האבן זיך ָאפּגעשפּילט סצענעס ון‬ ָ ‫זאנגען און גרינסן‬ ַ ‫האבן‬ ָ ‫ מער נישט — מיר‬.‫דאך ָאפּגעשפּילט‬ ָ ‫האבן זיך‬ ָ ‫רפּײניקונגען ? ָאבער זײ‬ ַ ‫א‬ ַ .‫ דעם ולן אמת‬,‫גאנצן אמת‬ ַ ‫ארצושטעלן זיך דעם‬ ָ ‫נישט קײן כּוח‬ ‫דאך געוויס נישט‬ ָ ‫וואלטן מיר‬ ָ ,‫זא כּוח‬ ַ ‫יא ַא‬ ָ ‫רמאגן‬ ָ ‫א‬ ַ ‫ ווען מיר‬,‫ווארעם‬ ָ ‫צוגעאלן‬ ַ ‫וואלטן‬ ָ ‫וואלטן ַארויסגעשפּרונגען און‬ ָ ‫ מיר‬.‫מאשין‬ ַ ‫אײנגעזעסן אין דער‬ ַ ‫אר־‬ ַ ‫הארץ‬ ַ ‫דײן‬ ַ ‫וואס‬ ָ ,‫ווארעם די ערד‬ ָ .‫צו דער ערד און זי ָאנגערירט מיט די ליפּן‬ .‫רשאלטן און הײליק‬ ָ ‫א‬ ַ .‫טויט־מארשן‬ ַ ‫דאך הײליק ון ייִ דישע‬ ָ ‫ איז‬,‫שטעלט‬ Di khasene in Fernvald Diese Polaritäten, die so charakteristisch sind für Leyviks Schreiben und Denken, ĳinden sich auch im dramatischen Poem ‫ערנוואלד‬ ַ ‫די חתונה אין‬ wieder, das als Kulminationspunkt von Leyviks Auseinandersetzung mit der ‫ שארית ־ הפּליטה‬und seinen Eindrücken von Deutschland angesehen werden kann. Die Basis für dieses Werk, in welchem die erste Hochzeit im dp-Lager Föhrenwald im Zentrum steht, bildete der Besuch Leyviks im dp-Lager. Die Beschreibungen, die sich in den Regieanweisungen ĳinden, sind daher oft sehr detailliert und realistisch. Besonderen Eindruck machte auf H. Leyvik der Besuch in der Schneiderei des Lagers. Dort wurde ihm stolz ein Schrank mit sechs weißen Hochzeitskleidern gezeigt, den die Näherinnen ” ‫צושטײער‬ ַ ‫קאלעקטיווער כּלה ־‬ ָ ‫ „ אונדזער‬nannten.42 Jede Frau im Lager konnte dort für ihre Hochzeit ein Kleid ausleihen. In Leyviks Tagebuchaufzeichnungen vom 8. Mai 1946 liest man : 43 ‫קאנ־‬ ָ ,‫צאל זעקס‬ ָ ‫ צוליב דער‬,‫ ווערן‬,‫דערבײ‬ ַ ‫וואס קומען ־ אויף‬ ָ ,‫ציאציעס‬ ַ ‫סא‬ ָ ‫ַאלע ַא‬ ,6000000 ‫ארשטעלונג ַארום דעם זעקס ון די רויטע ציערן‬ ָ ‫מײן‬ ַ ‫צענטרירט אין‬ ‫צואל ווירקט‬ ַ ‫ ָאבער דער‬.‫צואל‬ ַ ‫ ַאוודאי איז עס ַא‬.‫טאוולען‬ ָ ‫וואס אויף ַאלע יזכּור ־‬ ָ ‫מיליאן מחותּנים — זעקס חופּה ־‬ ָ ‫ זעקס‬.‫זײד‬ ַ ‫ווײסער‬ ַ — ‫ רויטע ציער און‬.‫אויף מיר‬ .‫קלײדער‬ 41 Leyvik 1947 a : 61. 42 Ibid. : 215. 43 Ibid. : 216. 558 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Im dramatischen Poem in elf Szenen sind es diese verstorbenen Verwandten, die schließlich aus ihren Massengräbern in Dachau steigen, um der Hochzeit des ersten Brautpaares im dp-Lager Föhrenwald beizuwohnen. In einem Prolog fordert der Dichter den Lagerchronisten, der gleichzeitig auch der Seher genannt wird, dazu auf, über die ‫שארית ־ הפּליטה‬ zu berichten. In dieser Person bündeln sich zahlreiche visionäre und realistische Aspekte – der Chronist ist ein rückwärtsgewandter Engel der Geschichte und Prophet zugleich, er ist Zeitzeuge, Historiker und beliebiges Mitglied der ‫שארית ־ הפּליטה‬.44 Als Chronist steht er in der Tradition von Nathan Neta Hanover, dem Verfasser des Berichtes über die Chmielnicki-Pogrome ‫יון מצולה‬, und bezeichnet sich als dessen » letzten Enkel «.45 Als letzten, weil durch die Schoa die Kette jüdischen Leidens einen Punkt erreicht hat, nach dem keine Fortführung mehr möglich ist. Pessimistisch erteilt der Chronist der Welt eine Absage, indem nicht nur die Nationalsozialisten, sondern die moderne Gesellschaft, das » Menschengeschlecht «,46 für den Massenmord zur Verantwortung gezogen wird.47 Vergangenheit und Zukunft scheinen sich in seiner Wahrnehmung zu überlagern, sind nicht voneinander zu trennen : 48 ,‫שפּאן ַארונטער — און איך בין צוריק אין גיהנום‬ ַ ‫אײן‬ ‫ איך בין צוריק‬,‫לאגערן‬ ַ ‫געטא און אין אומקום ־‬ ָ ‫אין‬ .‫נײנצן הונדערט יר און ערציק‬ ַ ‫יאר ון‬ ָ ‫אין‬ ,‫ארברענט‬ ַ ,‫אומגעבראכט‬ ַ ‫מיליאנען זע איך ווערן‬ ָ ‫ארויס‬ ַ ‫און אין דער זעלבער רגע זע איך אויף‬ — ‫ַא רעשטל ייִ דן גרײטן־צו ַא חופּה‬ .‫לאגער ון די ־ פּי‬ ַ ‫ַאן ערשטע חופּה אין ַא‬ ‫ארברענטן ייִ ד‬ ַ ‫איך מוז דעם טויט ון ַא‬ ,‫צוזאמענבינדן מיט דער שׂמחה ון ַא חתונה‬ ַ .‫טאריע‬ ָ ‫קרעמא‬ ַ ‫ַא חופּה שטעלן אויף ַא‬ ? ‫ארצײכענען‬ ַ ‫טאן ? און — ווי‬ ָ ‫זאל איך עס‬ ָ ‫איז — ווי‬ Wie der Chronist sind auch die übrigen Personen, die im Stück auftreten, durch mehrfache Bezüge an jüdische Traditionen gebunden und verweisen motivisch auf die jüdische Geschichte. So verwundert es nicht, dass der Vater der Familie, die im Zentrum der Erzählung steht 44 Leyvik 1949 a : 7 f. 45 Ibid. : 10. 46 Diese Form der Kollektivschuld formulierte Leyvik auch an anderer Stelle. In seiner Einleitung zu Mordkhe Shtriglers ‫דאנעק‬ ַ ‫מײ‬ ַ heißt es : ‫סאמע גיהנום‬ ַ ‫„ און שטריגלער איז געווען אין‬ ,‫נאר מיט היטלערן‬ ָ ‫טאן נישט‬ ָ ‫האט צו‬ ָ ‫וואס‬ ָ ‫דארט געזען עפּעס ַאזוינס‬ ָ ‫האט‬ ָ ‫— אין היטלערס גיהנום ; ער‬ .” ‫סאמע מין מענטש‬ ַ ‫נאר מיטן‬ ָ ,‫דײטש‬ ַ ‫נאצי ־‬ ַ ‫נאר מיטן‬ ָ ‫ נישט‬Vgl. : Leyvik 1947 b : o. S. 47 Leyvik 1949 a : 11. 48 Ibid. : 11 f. Tamar Lewinsky : H. Leyvik und die Sheyres-hapleyte 559 und deren Fäden zwischen Vergangenheit und Zukunft, zwischen Tod und Leben gespannt sind, Avrom heißt, seine ermordete Frau Sore und sein ermordeter Sohn Yitskhok. Und es scheint folgerichtig, dass Avrom sich in Föhrenwald mit Sore der Zweiten, einer Überlebenden, die ihre eigene Familie verloren hat, trauen lässt. Auch die anderen dps, die namentlich auftreten, sind nach den biblischen Urmüttern und Urvätern benannt. Wie Leyvik diese zahlreichen Bezüge spinnt, soll hier exemplarisch an der Darstellung der Geschichte Avroms gezeigt werden : Wie durch ein Wunder überlebt Avrom mit seiner Familie unbehelligt in seinem Zuhause unweit Dachaus bis zum Frühjahr 1944. Avrom, Sore und Yitskhok feiern gemeinsam den Sederabend, als ss-Männer die Wohnung stürmen und Sore und Yitskhok mitnehmen. Die Figuren von Heines Rabbi Abraham mit seiner Frau Sara, die an Pessach wegen einer Ritualmordbeschuldigung aus Bacharach flüchten müssen, drängen sich dem Leser hier ebenso auf, wie die vielfältigen Assoziationen des biblischen Exodusmotivs, von dem in der Haggada erzählt wird. Kaum haben die ss-Leute das Haus betreten, folgen ihnen die deutschen Nachbarn, um den Besitz der jüdischen Familie an sich zu nehmen. Fritz Wagner, Gretchen und ihre Tochter Brunhilde machen es sich ohne jedes Mitgefühl bequem und kleiden sich in die Kleider von Avroms Familie. Beendet wird diese Szene, die Rückschau auf die Ereignisse während des Krieges hält, durch einen Dialog zwischen Zicklein, Katze und Hund aus den Versen des ‫חד ־ גדיא‬.49 Anhand des Zickleins, das der Vater im aramäischen Abzähllied aus der Haggada seinem Sohn kauft, wird die Scham Avroms, seinen eigenen Sohn nicht gerettet und selbst überlebt zu haben, in der folgenden Szene aufgegriffen. Der Vater kehrt nach der Befreiung nach Hause zurück und ĳindet das Spielzeug seines Sohnes : ein Zicklein.50 Er hält es in den Händen, als eine mysteriöse Gestalt auftaucht und ihn beschuldigt, nicht auf das Zicklein und auf seinen Sohn aufgepasst zu haben, weder auf das ‫ חד ־ גדיהלע‬noch auf das ‫ חד ־ יצחקל‬.51 Was als Abzählreim aus der Haggada begonnen hatte, wird jetzt zur blutigen Realität : 52 ‫בארעכן‬ ַ ‫באקוק און‬ ַ ,‫ [ זע‬. . . ] — ‫ווי שנעל און ווי לינק ס’איז געשען די הריגה‬ .‫די העסלעכע ווילדע חד ־ גדיא‬ 49 50 51 52 Ibid. : 19 – 35. Ibid. : 42. Ibid. : 44. Leyvik 1949 a : 48 f. 560 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ ,‫האלדז ונעם ציגעלע‬ ַ ‫צאן אינעם‬ ָ ‫אײן קעצישער‬ ; ‫קאץ‬ ַ ‫גארגל די‬ ָ ‫ארן‬ ַ ‫רײסט דער הונט‬ ַ ‫און שוין‬ [...] ‫ריאגן‬ ָ ‫א‬ ַ ‫טרײבן ־‬ ַ ‫צײטנס צו‬ ַ ‫בא‬ ַ ‫האסט‬ ָ ‫ארעלט‬ ַ .‫דײן שוועל‬ ַ ‫קאץ און ַא הונט ון‬ ַ ‫ַא‬ Neben dieser mysteriösen Gestalt treten in ‫ערנוואלד‬ ַ ‫ די חתונה אין‬auch der Prophet Elias in der Gestalt eines alten Flüchtlings und der Messias auf. Der Messias wurde mit tausenden Juden in die Krematorien geführt und liegt zusammen mit allen Ermordeten in einem Massengrab in Dachau.53 Seine Aufgabe sieht er nach Dachau nicht länger darin, als Erlöser zu den Juden zu kommen, sondern mit ihnen zu leiden.54 Erst durch den Prophet Elias lässt er sich dazu bringen, gemeinsam mit den Toten, in der Gestalt eines jungen Flüchtlings, das Grab zu verlassen, der Hochzeit beizuwohnen und dem Brautpaar seinen Segen zu geben.55 Damit wird die Grenze zwischen Leben und Tod, zwischen Zerstörung und Neubeginn, zwischen Verzweiflung und Hoffnung, die in ‫די חתונה‬ ‫ערנוואלד‬ ַ ‫ אין‬ständig verhandelt wird, verwischt. Im Laufe des Stückes verdichten sich die Bezüge zunehmend. Den Höhepunkt schließlich bildet die Hochzeitszeremonie. Die Bilder, die Leyvik in ‫ערנוואלד‬ ַ ‫ די חתונה אין‬evoziert, verweisen aber nicht nur auf jüdische Geschichte und Literatur, sondern verbinden sich durch das Motiv von Leid und Erlösung auch mit früheren Werken Leyviks wie etwa ‫ראטנבורג‬ ָ ‫ ( דער מהר”ם ון‬1945 ), ‫קאמעדיע‬ ָ ‫ ( די גאולה ־‬1934 ), ‫דער גולם‬ ( 1921 ) oder ‫ ( די קייטן ון משיח‬1908 ). Laut Shmuel Niger ist ‫ערנוואלד‬ ַ ‫ די חתונה אין‬ein moderner Mythos – eine Form, die, so Niger, gut in die apokalyptische Entstehungszeit passe.56 Das Erlösungsmotiv sieht Niger in ‫ערנוואלד‬ ַ ‫ די חתונה אין‬dramatisch symbolisiert als innerlichen Prozess, der bei der ‫ שארית ־ הפּליטה‬stattĳindet, der sich nicht als plötzliches Wunder manifestiere, sondern als natürlicher Prozess, der sich in der langsamen Rückkehr der Überlebenden zum Leben ausdrücke : 57 ‫האבן‬ ָ ‫דארף מען‬ ַ ‫אר איר‬ ַ ‫ אויך‬... ‫ט־דאס איז די אתחלתּא ־ דגאולה‬ ָ ‫ [ און ָא‬. . . ] ,‫וואס קומט צו די ייִ דן ון דער שארית־הפּליטה‬ ָ ,‫דאס איז ניט משיח‬ ָ ‫ ָאבער‬,‫משיחן‬ ,‫דאס איז ַא תּחית ־ הלעבעדיקע מתים‬ ָ ... ‫ אין ז‬,‫וואס איז מיט זײ‬ ָ ,‫דאס איז משיח‬ ָ . . . ‫ ווי תּחית ־ מתים‬,‫וואס איז ניט קײן קלענערער נס‬ ָ 53 54 55 56 57 Leyvik 1949 a : 52 und 89. Ibid. : 90. Ibid. : 109. Niger 1951 : 478. Niger 1951 : 486 [ Hervorhebung im Original ]. Tamar Lewinsky : H. Leyvik und die Sheyres-hapleyte 561 Der eigentümliche und mit zahllosen Allusionen aufgeladene danse macabre, den Leyvik inszenierte, wurde von der ‫ שארית ־ הפּליטה‬mit Lob aufgenommen. Der dp-Schriftsteller Meylekh Tshemni formulierte in einem Brief an H. Leyvik beeindruckt : 58 ‫ געלײענט און איבערגעלײענט און‬.‫דאס בוך [ געלײענט מיט אײן ָאטעם‬ ָ ] ‫האב‬ ָ ‫איך‬ ‫ מיטגע־‬.” ‫ ַאלע זענען מיר געווען אויף דער „ חתונה‬.‫געגעבן ַאנדערע צו לײענען‬ . . . ‫טרויערט מיט דער ערשטער שורה אין טרויער‬ Und er fügt an, dass die Schauspieler des jiddischen Theaters, die das Buch gelesen hätten, sich einer Sache sicher gewesen seien : Dass nur ein Mitglied der ‫ שארית ־ הפּליטה‬fähig sein könne, ein solches Werk zu verfassen. Einmal mehr zeigt sich hier, wie sehr sich in Leyviks poetischen Leid- und Erlösungsvisionen die Sicht der jüdischen Displaced Persons auf ihre eigene Situation spiegelte. Leyviks Bedeutung für die ‫שארית ־ הפּליטה‬, diese besondere Übergangsgesellschaft in Deutschland nach der Schoa, war eminent. Er setzte sich direkt mit den Überlebenden auseinander und gab sich nicht damit zufrieden, sie durch Hilfsorganisationen betreut zu wissen. Durch den direkten Kontakt während seines Besuches im Frühjahr 1946, durch seine literarische und publizistische Auseinandersetzung mit ihrem Schicksal gab er ihnen das Gefühl, dass man sie nicht vergessen hatte. Für Leyvik wiederum war der Besuch in Deutschland und der Kontakt mit der ‫ שארית ־ הפּליטה‬zentral, um aus der Perspektive der Opfer schreiben zu können, sich mit ihnen zu identiĳizieren und damit sein Schuldgefühl, als amerikanischer Jude nicht an ihrer Seite Verfolgung und Leid erfahren zu haben, überwinden zu können. Oder wie es Leyvik 1947 in einem Gedicht formulierte : ‫כאו אויך שוין געזען‬ ַ ‫דא‬ ַ ‫האב‬ ָ ‘ ‫כ‬.59 Zitierte Literatur Efros, Israel, 1947 : Heymloze yidn. A bazukh in di yidishe lagern in Daytshland. Buenos Aires : Tsentralfarband fun poylishe yidn in Argentine. Goldkorn, Yitskhok, 1949 : Literarishe siluetn. München : Farlag fun kulturamt baym tsentral-komitet. 58 yivo 315, Meylekh Tshemni an H. Leyvik, 4. 9. 1949. 59 Leyvik 1947 c. 562 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Goldsmith, Emanuel S., 1992 : » Der tsunoyftref fun gaystike un dikhterishe zukhungen. « In : Gershon Winer, Hg., Shtudyes in Leyvik. Forshungen vegn zayn leben un shafn. Geleyent af dem simpozyum in Bar-Ilan universitet tsum dikhters hundertyorikn geboyrntog. Ramat Gan : Yidishkatedre u. n. fun Rena Costa, 18 – 33. Graetz, Heinrich, 1907 : Geschichte der Juden von den ältesten Zeiten bis auf die Gegenwart. 11 Vols. Leipzig : Oskar Leiner. Kaplan, Israel, 1946 : » Gest fun der vayt, un hertser azoy noente. « In : Undzer veg, 29. 4. 1946. Leksikon = Leksikon fun der nayer yidisher literatur, 1956 – 1981. 8 Vols. New York : Altveltlekher yidisher kultur-kongres. Lewinsky, Tamar, 2008 : Displaced Poets. Jiddische Schriftsteller im Nachkriegsdeutschland, 1945 – 1951. Göttingen : Vandenhoeck & Ruprecht. Leyvik, H., 1946 : » Mir torn nit farshvekhn undzere kedoyshim. « In : Undzer veg, 22.3.1946 – 1947 a : Mit der sheyres-hapleyte. New York : tsiko. – [ hier : Lejwik, H. ], 1947 b : » Undzer cugang cu der Szejrit-Haplejta. « In : Ibergang, 31. 8. 1947. – 1947 c : » Kh ’ hob Dakhau oykh shoyn gezen. « In : Undzer veg, 21.2.1947 – 1949 a : Di khasene in Fernvald. Dramatishe poeme in elf stsenes. New York : tsiko. – 1949 b : » Oysgeloshene likht tsindn zikh vayter on. « In: Mordkhe Shtrigler, Maydanek. Bukh fun tsikl » Oysgebrente likht «. Buenos Aires: Tsentral-farband fun poylishe yidn in Argentine, o. S. – 1952 : » Tsvey dokumentn. « In : Naye yidishe tsaytung 17 ( 9. 4. 1952 ) : 2. Myers Feinstein, Margarete, 2010 : Holocaust Survivors in Postwar Germany, 1945 – 1957. Cambridge : Cambridge University Press. Niger, Shmuel, 1951 : H. Leyvik 1888 – 1948. Toronto : Gershon Pomerants. Roskies, David G., 2005 : » What is Holocaust Literature ? « In : Studies in Contemporary Jewry 21 : 157 – 212. Rousset, David, 1946 : L’univers concentrationnaire. Paris : Éditions du Pavois. Shalit, Levi, 1949 : Azoy zaynen mir geshtorbn. München : Farband fun litvishe yidn in Daytshland. – 1992 : » Leyvik bay der sheyres-hapleyte in Daytshland. « In : Gershon Winer, Hg., Shtudyes in Leyvik. Forshungen vegn zayn lebn un shafn. Geleyent af dem simpozyum in Bar-Ilan universitet tsum dikhters hundertyorikn geboyrntog. Ramat Gan : Yidish-katedre u. n. fun Rena Costa, 124 – 130. Shalitan, Levi [ Levi Shalit ], 1945 a : » Un az ikh bin in Treblinke yo geven iz vos ? « In : Undzer veg, 30. 11. 1945. Tamar Lewinsky : H. Leyvik und die Sheyres-hapleyte 563 – 1945 b : » Shures shtile. « In : Undzer veg, 7. 12. 1945. – 1946 : » Fun undzer seyder-hayom. a ) Brukhim haboim « In : Undzer veg, 29. 4. 1946. Shayver-Lazorov, Emma, 1948 : Mir zenen do ! Ayndrukn un batrakhtungen fun a bazukh bay der sheyres-hapleyte. New York : Aroysgegebn durkh der Yitskhok un Hendele faundeyshon, Detroit. Shtrigler, Mordkhe, 1949 : Maydanek. Bukh fun tsikl » Oysgebrente likht «. Buenos Aires : Tsentral-farband fun poylishe yidn in Argentine. Volpe, Dovid, 1946 : » Tsu H. Leyvikn. « In : Undzer veg, 29. 4. 1946. – 1997 : Ikh un mayn velt. Oytobiograĳishe bleter. Bd. 1. Johannesburg : DovTov. Winer, Gershon, 1992 : » Shtrikhn tsu der geshtalt. « In : Ders., Hg., Shtudyes in Leyvik. Forshungen vegn zayn lebn un shafn. Geleyent af dem simpozyum in Bar-Ilan universitet tsum dikhters hundertyorikn geboyrntog. Ramat Gan : Yidish-katedre u. n. fun Rena Costa, 13 – 17. Barry Trachtenberg Bridging the “ Great and Tragic Mekhitse ” Pre-war European Yiddish Serials and the Transition to PostKhurbn America In a 1931 speech given in Berlin to a group of Eastern European Jewish intellectuals who had gathered together to establish the ĳirst ever comprehensive Yiddish language encyclopedia, the historian Simon Dubnow spoke of the potential audience for such an important undertaking. As Dubnow saw it, the encyclopedia, which was to commemorate the milestone of his seventieth birthday a year earlier, had the potential to unify and enlighten the vast Yiddish-speaking world. Dubnow optimistically remarked on that February day : 1 ‫וואס‬ ָ ,‫אלקס־בוך‬ ָ ‫ענציקלאפּעדיע איז ַא‬ ָ ‫ַאן‬ 10 ‫וואס‬ ָ ,‫אלק‬ ָ ‫ א‬.‫האבן‬ ָ ‫דארף אים‬ ַ ‫יעדער‬ ‫האבן ַאן‬ ָ ‫ מוז‬,‫מיליאן מענטשן ריידן אויף ייִ דיש‬ ָ .‫שפּראך‬ ַ ‫זײן אייגענער‬ ַ ‫ענציקלאפּעדיע אויף‬ ָ An encyclopedia is a people ’ s-book, and each nation must have one. A people, 10 million of whom speak in Yiddish, must have an encyclopedia in their own language By contrast, nearly three dozen years later, in 1966, the Polish-born cultural activist Iser Goldberg wrote in much more modest and subdued terms in the Foreword of the twelfth and ĳinal Yiddish volume of the encyclopedia that was now housed in New York : 2 ‫באנד צו די טויזנטער ליי־‬ ַ ‫מיר ברענגען דעם‬ ‫באנענטן אין ַאלע ייִ דישע ייִ שוים‬ ָ ‫ענערס און ַא‬ ‫ ַאז דורך‬,‫האן‬ ָ ‫גארער וועלט און מיר‬ ָ ‫איבער דער‬ We bring this volume to the thousands of readers and subscribers in Jewish communities all over the whole world and This paper originally began as a talk given at the conference “ Transforming a Culture between Soft Covers : Yiddish Journals in the New World, ” held at the University of California, Los Angeles in 2009. I am grateful to Professors Jeremy Dauber and David N. Myers, as well as the ucla Center for Jewish Studies, for the opportunity to participate in that conference. I also thank Jeffrey Shandler, Barbara Schmutzler, and Marisa Elana James for their suggestions and assistance, and the University at Albany ’ s Center for Jewish Studies for its support. 1 Simon Dubnow, ‫ענציקלאפּעדיע אין‬ ָ ‫ענציקלאפּעדיע צו ַאן‬ ָ ‫זײנען מיר געקומען ון ייִ דישע‬ ַ ‫ווי ַאזוי‬ ‫ ייִ דיש‬Central Archives of the History of the Jewish People ( Simon Dubnow Papers, folder 1 ). All translations are the author ’ s unless otherwise noted. 2 Goldberg 1966 : ( unpaginated ). 566 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ! ‫לקט‬ ‫צושטײער‬ ַ ‫געמאכט ַא וויכטיקן‬ ַ ‫האבן מיר‬ ָ ‫דעם‬ .‫ליטעראטור‬ ַ ‫רצווײגטער חורבן ־‬ ַ ‫א‬ ַ ‫צו דער‬ we hope that with it, we have made an important contribution to the growing khurbn literature. The vast gulf that separates these two statements about the anticipated audiences for ‫ענציקלאפּעדיע‬ ָ ‫ די ַאלגעמיינע‬is more than simply geographic and chronological. It is a chasm that is marked by rupture and previously unimaginable violence. Any accounting of the loss that was endured by European Jewry must not only include the number of lives destroyed, but must acknowledge that the Nazi Holocaust broke almost fully the historical continuity of a people with thousands of years of cultural creativity on the continent. Indeed, it is almost impossible to conceive of twentieth-century European Jewish history without it being entirely overshadowed by the breach that occurred. In terms of Yiddish print culture, Europe between the two world wars was home to a vast array of popular, literary, artistic, and scholarly journals in the Yiddish language. Although in some regions the use of Yiddish was declining owing to its speakers’ linguistic acculturation, the years 1919 – 1939 marked the pinnacle of Yiddish cultural creativity. In Poland, for example, there were more than 1,700 Yiddish periodicals published in this time.3 With very few exceptions – and these were mostly within the Soviet sphere or among Displaced Persons – the Yiddish press on the European continent came to a near-end during World War ii and the Nazi Holocaust. For a period of time, the magnitude of this loss dissuaded many historians of the Jews from engaging with the Holocaust, and, conversely, deterred historians of the Holocaust from contending with the contours of those civilizations that were destroyed. A consequence of this is that Jewish history itself has at times been represented as an containing interregnum that brackets off the years 1939 – 1945 as if they existed outside of normal historical development.4 Given that it is nearly impossible to represent this period in ways other than through the language of loss and annihilation, it is worthwhile to note the presence of the very few frayed threads of continuity that do bind the pre-war and postwar periods together, and to examine those cultural projects that began in Europe in the optimistic years following World War i and continued through World War ii and after in the United States. This essay highlights two cases of pre-war Yiddish serials that were able to continue publishing during and after World War ii by transitioning to the United 3 Bacon 2008 : 1402. 4 In this regard, the history of the Jews in this period parallels some of the issues raised in the 1980s during the Historikerstreit among German historians over the issue of whether the Nazi period marks a rupture within the German past. Also see Engel 2010. Barry Trachtenberg : Bridging the “ Great and Tragic Mekhitse ” 567 States at the start of the war : the ‫ווא ־ בלעטער‬ ָ ִ‫ ( יי‬yivo Journal, Vilna and New York, 1931 – 1980 ) and ‫ענציקלאפּעדיע‬ ָ ‫ ( די ַאלגעמיינע‬The General Encyclopedia, Berlin, Paris, and New York, 1932 – 1966 ). Although their paths quickly diverged, both the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬and ‫ענציקלאפּעדיע‬ ָ ‫די ַאלגעמיינע‬ began through the efforts of the Yiddish Scientiĳic Institute ( yivo ) that was housed in Vilna, Poland. Both serials began in the early 1930s and, taken together, mirrored yivo ’ s dual mission of being the home for the most sophisticated and current scientiĳic research in the Yiddish language, while simultaneously providing a base from which to educate and improve the conditions of Eastern European Jewry. The yivo-bleter ’ s mission was to be the premier venue for scholarly research on Eastern European Jewry, while Di algemeyne entsiklopedye ’ s was to bring methodically researched general knowledge to the masses of Yiddish speakers. The existence of these two Yiddish serials – that were among the only ones to have existed before, during, and after the war – allows for the possibility of understanding this period through a chain of tradition that links the world that was destroyed to the one that remained. It furthermore serves as a way to conceive of Jewish history in this period with an eye towards its continuity, and a realization that wartime and post-war Yiddish culture in the United States was shaped in part by the presence of those few refugee scholars and institutions that were able to relocate there.5 An examination of these two serials in relation to one another may also be able to inform some of the current conversations about the ways in which Jewish communities in general and Yiddish scholars in particular responded to the Nazi onslaught.6 Finally, the mere fact that the serials continued to be published, despite all the historical forces working against them ( including the near total loss of the editors, writers, and readers that supported them ), is worthy of note and study. The ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬and ‫ענציקלאפּעדיע‬ ָ ‫ די ַאלגעמיינע‬were among many signiĳicant projects to be launched in the post-World War i burst of Yiddish-language activity in Europe. In this time of optimism and expan5 For a discussion of this question regarding the extent to which post-war Yiddish literature is a continuation of pre-war, see Estraikh 1999. Also see Anita Norich ’ s ( 2007 ) elegant discussion of the ‘ fallacy ’ of understanding Yiddish and English in America on a historical continuum in which one replaces the other. 6 Two such valuable discussions at present are those raised most recently by historians considering the questions of Jewish ‘ silence ’ after the Holocaust ( particularly in the United States ), and by historians discussing the ĳinal days of the ideologies of Diaspora Nationalism in Europe. In terms of the debates on the so-called “ myth of silence, ” see Diner 2009 and Cesarani and Sundquist 2012. On Territorialists’ reconsideration of Jewish Diasporist ideologies in the late 1930s, see, most notably, Karlip 2005 and Weiser 2011 : 226 – 259. 568 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ! ‫לקט‬ sion, these two publishing ventures were viewed by their initiators as marking a new era in both the Yiddish language and the national community that supported it. As projects of yivo, they were tied to an institute that, on the one hand, was widely recognized as the preeminent center for Yiddish cultural research ( notwithstanding being only in its ĳifth year ), and on the other, was facing a moment of deep ĳiscal crisis. As the historian Cecile Kuznitz has described it, the early 1930s, in particular, marked a period of “ Scholarship under Pressure, ” during which scholarly productivity abruptly slowed as attention had to be increasingly directed toward fund-raising.7 The gap between the organization ’ s ambitions and ĳinancial resources was growing wider. In spite of a lack of much-needed funds, the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬ĳirst appeared in early 1931, and from the ĳirst issue, it set a new standard for Yiddish scholarly research. As the realization of a vision articulated by Zalmen Reyzen at yivo ’ s 1929 conference, during which much of the institute ’ s agenda was decided, the journal is notable not only for the high quality of its articles and stature of its contributors, but, in keeping with Max Weinreich ’ s oft-repeated insistence on yivo ’ s non-partisanship, there is a total absence of articles that directly consider contemporary politics.8 In the Introduction to the ĳirst issue, the yivo-bleter ’ s editors articulated the tension between their lofty aspirations and ĳinancial capacity, and, rather than providing a full programmatic statement stating the journal ’ s aims and standards, they were frank about their doubts as to whether yivo would be able to sustain this “ new burden. ” 9 In spite of these fears, the Central Committee remained committed to the project as it would ĳill a large void in yivo ’ s publications, which, up to then, had consisted of either compendiums of articles from several of its key research areas or shorter articles in its newsletter, ‫ידיעות‬. At the same time, the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬was envisioned as a tool not only for the Yiddish-speaking Jewish intelligentsia, but its editors optimistically hoped that it might ĳind a popular audience as well, and ‫ראן אין אונדזער ברייטער‬ ַ ‫א‬ ַ ‫וואס איז‬ ָ ,‫דארשט צו וויסן‬ ָ ‫ [ קענען שטילן דעם גרויסן‬. . . ] „ ” .‫ ( מאסע‬help satisfy the great thirst for knowledge that exists among our broad masses ). The journal was to correspond to the four sections of yivo itself : Philology, History, Economics and Statistics, and Psychology and Pedagogy. In addition, it would provide information about yivo ’ s program and accomplishments, and archival materials, and would be a “ central tribune for all Yiddish scholarly work. ” 10 7 Kuznitz 2000 : 221 – 269 ; Kuznitz 2008 : 2090 – 2093. 8 See yivo 1930 ; on yivo and founder Max Weinreich ’ s ‘ neutrality, ’ see Kuznitz 2000 : 242 f, 253 – 257. 9 Di tsentral-farvaltung fun yidishn visnshaftlekhn institut 1931 : 1. 10 Ibid. : 3. Barry Trachtenberg : Bridging the “ Great and Tragic Mekhitse ” 569 Over the course of the 1930s, the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬released a steady stream of volumes ( although the numbering system often varied and there were occasional gaps in publication ). Its contributors included most of the luminaries of the Yiddish intellectual world, such as Simon Dubnow, Max Weinreich, Alexander Harkavy, Avrom Menes, Noyekh Prilutski ( Noah Prylucki ), Jacob Lestschinsky, Elias Tcherikower, Zelig Kalmanovitsh, Nachman Meisel, Emanuel Ringelblum, Zalmen Reyzen, Jacob Shatzky, Solomon Birnbaum, Shmuel Niger, and Raphael Mahler. The topics were equally vast, and included articles on subjects such as Jewish demography, history, literature, arts, culture, folklore, linguistics, philosophy, philology, Jewish communal life, and scholarly reviews of works in Yiddish, English, Polish, and Spanish. Given the location of yivo, there were a signiĳicant number of articles on Polish Jewish history. Throughout the 1930s, the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬stuck to its decision to avoid contemporary politics, yet touched on some ongoing issues obliquely by historicizing them, such as with Menes’ investigation of Jewish political autonomy in the biblical period.11 However, the calm “ exterior ” of the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬did not adequately represent the often ĳierce debates occurring within the institute as to the extent to which its research should respond to the growing emergency.12 It was only in 1939 that the increasingly hostile situation faced by Polish Jewry was reflected ( albeit indirectly as well ) in the pages of the ‫ווא ־ בלעטער‬ ָ ִ‫יי‬, as the question of historical anti-Semitism was addressed by several contributions. The January – February edition ( vol. xiv, no. 1 ), for example, contains a historical study by Joseph Lifshits of the anti-Jewish Hep ! Hep ! riots of 1819 that took place in German lands, as well as an examination by Zosa Szajkowski of French anti-Jewish activity in the eighteenth and nineteenth centuries. The ĳinal volume from Vilna ( May 1939 ) opened with an article by Joseph Mirkin on “ Jewish and anti-Jewish themes in Christian religious art in Medieval France. ” Another debate that arose among the editors and contributors in the yivo-bleter ’ s early years concerned the extent to which the journal should focus on scholarly issues that speciĳically addressed issues relevant to Jewish studies or whether non-Jewish topics should be likewise considered.13 The discussion resulted in a compromise that would maintain the journal ’ s thematic coherency, yet allow a measure of freedom among its contributors to explore “ non-Jewish ” themes if they could be shown to be germane to Jewish-related subjects. As the editors wrote in 1932 : 14 11 12 13 14 For example, Menes 1931. See Kuznitz 2000 : 264 – 267. See yivo-bleter 1932 : 3. Ibid. : 3. 570 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ! ‫לקט‬ ‫ארש־‬ ָ ‫דארן ָאפּשפּיגלען די‬ ַ ‫ווא־בלעטער‬ ָ ִ‫די יי‬ ‫אר־‬ ַ ‫זײנען‬ ַ ‫וואס‬ ָ ,‫וויסנשאטלער‬ ַ ‫ַארבעט ון די‬ ‫אלן ָאפּ‬ ַ ‫ ממילא‬.‫ווא‬ ָ ִ‫אייניקט אין און ַארום יי‬ ‫האבן ניט קיין‬ ָ ‫אר וועלכע מיר‬ ַ ,‫יענע געביטן‬ ‫ טעכניק אד ׳׳גל‬,‫טור־וויסנשאט‬ ַ ‫נא‬ ַ ‫סעקציעס ׃‬ ‫וואס עס איז שייך צו ַאלגעמיינע‬ ָ .‫בלײבן אויסן‬ ַ ,‫סטאטיסטיק‬ ַ ,‫נאמיק‬ ָ ‫עקא‬ ָ ‫פּראבלעמען ון‬ ָ ‫בא־‬ ַ ‫יא‬ ָ ‫ קענען זיי‬,‫אא ׳׳ וו‬ ַ ‫וויסנשאט‬ ַ ‫פּראך ־‬ ַ ‫ש‬ ‫ אויב די‬,‫ווא־בלעטער‬ ָ ִ‫האנדלט ווערן אין די יי‬ ַ ‫וויסנשאטלעכע‬ ַ ‫מיטגלידער ון אונדזערע‬ ‫זאגן עפּעס‬ ָ ‫האבן וועגן דעם צו‬ ָ ‫קאלעגיעס‬ ָ ‫סײ אין‬ ַ ‫ ַאז‬,‫ בכּל־און איז געוווּנטשן‬.‫אייגנס‬ ‫בײם‬ ַ ‫סײ‬ ַ ,‫די ַארטיקלען אויף ייִ דישע טעמעס‬ ‫ווײט מיגלעך געוויזן‬ ַ ‫זאל ווי‬ ָ ‫רעצענזירן ביכער‬ ‫ראן‬ ַ ‫א‬ ַ ‫וואס איז‬ ָ ,‫צוזאמענבונד‬ ַ ‫ווערן דער‬ ‫סײ‬ ַ ,‫ראבלעמען‬ ָ ‫צווישן ייִ דישע און ַאלגעמיינע פּ‬ .‫סײ אין תּוך‬ ַ ,‫מעטאדיש‬ ָ The yivo bleter must reflect the research work of the scholars that are united in and around yivo. As a matter of course those areas that do not have sections : natural sciences, technology, and the like remain out of consideration. That which is pertinent to general problems of economics, statistics, language-studies, etc., can be treated in the yivo bleter, if the members of our scholarly committees have anything to say about them. In any case, it is hoped that to the extent possible, both in the articles on Jewish themes and in book reviews the connection between Jewish and general problems should be demonstrated, that is among Jewish and general problems, both in method and in content. At the same time as the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬was being launched, a second initiative with ties to yivo was getting underway : the ĳirst comprehensive Yiddish-language encyclopedia. Although beset by similar ĳiscal constraints and ideological debates as the ‫ווא ־ בלעטער‬ ָ ִ‫יי‬, ‫די ַאלגעמיינע‬ ‫ענציקלאפּ עדיע‬ ָ was to a much greater degree at the mercy of historical events in the 1930s. Unlike the ‫ווא ־ בלעטער‬ ָ ִ‫יי‬, which was based in Vilna and could therefore beneĳit more easily from the institutional support of yivo itself, ‫ענציקלאפּעדיע‬ ָ ‫ די ַאלגעמיינע‬was established in Berlin, which left the project vulnerable when the situation in Germany began to turn dire. At the same time, each project can be seen as a reflection of the milieu in which it was founded. The ‫ווא ־ בלעטער‬ ָ ִ‫יי‬, based as it was in the capital of the Yiddish cultural world and in a thriving Jewish center, was created to showcase and promote the best intellectual work produced on the subject of Jewish studies. By contrast, Berlin was host to a community of Eastern European Jewish émigrés, who were not in the same sense ‘ home, ’ but who were exposed to a much more cosmopolitan city in which exiles from many parts of Europe had congregated. This may account in part for what was a highly contentious decision to produce an encyclopedia of general knowledge that focused on the larger world rather than one restricted to Jewish topics. The ĳigures who gathered in early February 1931 to organize the encyclopedia were made up of those Eastern European Jews who had been drawn to Berlin in the early 1920s, when it was a magnet for Yid- Barry Trachtenberg : Bridging the “ Great and Tragic Mekhitse ” 571 dish and Hebrew writers, scholars, and journalists, attracted to the city ’ s vibrancy, affordability, and cosmopolitanism.15 Although there was a signiĳicant exodus of this community following the stabilization of the German currency and the subsequent decline in Yiddish and Hebrew publishing, many still remained, including Dubnow, the historian and head of yivo ’ s History Section Elias Tcherikower, the Menshevik leader Raphael Abramovitch, the demographer Jacob Lestschinsky, the head of the ort ( the Society for Handicraft and Agricultural Work among the Jews of Russia ) Leon Bramson, and the Territorialist leader Abraham Rozin ( pseud. Ben-Adir ). By the time of the February meeting, planning work on the encyclopedia had been underway for several months, and a publishing arm – named the Dubnow Fund – was established to oversee the project ’ s administration.16 Like the ‫ווא ־ בלעטער‬ ָ ִ‫יי‬, from the very beginning there were debates among the founders about the content of the encyclopedia – speciĳically, whether it would be scholarly or popular in format, whether it could discuss political topics with the necessary objectivity, and to what extent it would contain general or speciĳically Jewish knowledge. It was only after several tense discussions – at times played out in the Yiddish press ( including the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬itself ) – that a compromise 17 was reached. At a meeting in late 1931, it was decided that the volumes of encyclopedia would contain a ratio of 70 percent general knowledge to 30 percent Jewish, but most of the speciĳically Jewish content would be relegated to a supplement dedicated to Jewish life and culture. Thus, the decisions reached were nearly the reverse of those concerning the ‫ווא ־ בלעטער‬ ָ ִ‫יי‬. Whereas the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬would be scholarly in tone, openended, and largely focused on Jewish themes, ‫ענציקלאפּעדיע‬ ָ ‫די ַאלגעמיינע‬ would be for a mass readership, have a deĳinitive end, and be heavily weighted towards general knowledge ( ten volumes of general knowledge and one dedicated to Jewish topics ). This settlement, however, was not sufĳicient to fend off a split between the Berlin and Vilna camps, and by the end of 1931, yivo – primarily citing ĳinancial difĳiculties – ofĳicially dropped its ties and the encyclopedia became a project of the now-independent Dubnow Fund alone. In spite of these setbacks and the growing crisis in Germany, in April 1932, a ‫פּראבעהעט‬ ָ ( sample volume ) of the encyclopedia was released to great fanfare and was signiĳicant enough to warrant critical 15 Estraikh and Krutikov 2010. For a comprehensive overview of Yiddish in Weimar-era Berlin, see Estraikh 2006. On Hebrew in Weimar-era Berlin, see Pinsker 2011 : 105 – 140. 16 yivo 1931. 17 Yashunsky 1932. For more on Yashunsky ’ s concerns about the extent to which the Dubnow Fund could maintain the necessary scholarly objectivity, see Kuznitz 2000 : 261. 572 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ! ‫לקט‬ reviews.18 In between its covers, readers were shown a wide variety of entries on subject matters modeled on those found in the German Brockhaus, the British Britannica, and the French Larousse, such as ( following the Yiddish alphabet ) the Amarna Period in ancient Egyptian history, unemployment, the author William James, President Abraham Lincoln, motors, empirical criticism, Esperanto, and radium. The speciĳically Jewish content included entries on Hasidism, reprints of portraits of religious Jews by Marc Chagall, Jewish demography, and the Zionist leader Max Nordau. Its contributors included not only the organizers, but comprised a “ who ’ s who ” among the Yiddish intelligentsia. Even those most intimately tied to the yivo circle, such as Weinreich, are listed. Less than a year after the release of the ‫פּראבעהעט‬ ָ , however, the Dubnow Fund faced its ĳirst major crisis with the Nazi takeover of power on 30 January 1933. The editors and contributors of the encyclopedia who were based in Berlin were forced to flee the country. Although Dubnow ended up in Riga, Abramovitch, Ben-Adir, Bramson, Tcherikower, and others resettled in Paris and were forced to rebuild their organization almost entirely from scratch. This was the ĳirst of many challenges that forced reconsiderations in the plans for the project. Unlike the ‫ווא ־ בלעטער‬ ָ ִ‫יי‬, which saw only comparatively modest interruptions in its publishing schedule on account of economic or political challenges in the 1930s, and responded to the worsening situation for Jews throughout Europe only in 1939, changes in ‫ענציקלאפּעדיע‬ ָ ‫די ַאלגעמיינע‬ appeared almost from the outset. Immediately, the publication schedule was adjusted so that rather than publishing ten volumes of general knowledge, twenty smaller ones were planned. Despite the highly enthusiastic reception that greeted the ĳirst volume ( 1934 ), a publishing pace of approximately one volume a year could be sustained, and none were released in 1938.19 In addition, volumes released in the middle of the decade ( all of which were on the letter alef ) augur a conceptual change in which the focus on general knowledge began to shift toward the particular. Each of these volumes ends on a surprising note, with multi-authored, journal-length entries on the decidedly Jewish topics of “ antisemitism ” ( 1936 ) and the “ land of Israel ” ( 1937 ).20 18 Tsentral-komitet fun “ dubnov-fond ” 1932. For examples of reviews, see Klinov 1932 and Svet 1932. 19 For a fuller account of the volumes in Di algemeyne entsiklopedye, see Trachtenberg 2006. 20 Ben-Adir, Tcherikower, and Abramovitch 1936 ; Ben-Adir and Menes 1937. Barry Trachtenberg : Bridging the “ Great and Tragic Mekhitse ” 573 A much more dramatic shift in the publishing schedule of ‫די‬ ‫ענציקלאפּעדיע‬ ָ ‫ ַאלג עמיינע‬occurred on what was the eve of war in the spring of 1939, where, in an unexpected move, the editors decided to release the long-promised supplement, entitled ‫ ייִ דן‬, well ahead of schedule. Unlike the volumes on general knowledge, ‫ ייִ דן‬contains journal-length essays on Jewish history and social science, such as essays on anthropology, archaeology, history and historiography, demography, economics, emigration, and colonization. Although this special volume seems to have been a response to the deteriorating situation, the editors explicitly refrained from discussing it. Instead, they focused the Introduction on the immediate challenges facing the project, such as the death of two of their colleagues. They did, however, announce the ĳirst major change in plans : a second ‫ ייִ דן‬volume to serve as a companion to the ĳirst. With the outbreak of war in September 1939, the greatest part of Yiddish print culture in Europe came to an end. By a combination of fortune and determination, both the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬and ‫די ַאלגעמיינע‬ ‫ענציקלאפּ עדיע‬ ָ were able to be reestablished in the United States and continue for decades. The United States at this time, as Anita Norich has noted, became, by default, “ unquestionably the center for Yiddish culture, ” and the war years were deĳined by a period of profound transformation within both American Yiddish and Jewish culture.21 In order to maintain their projects, the surviving editors and contributors had to negotiate between remaining true to the scholarly missions on which they were ĳirst launched and the new circumstances in which they found themselves. In keeping with prior experience, the transition ( administratively speaking ) from Europe to the United States for the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬was somewhat smoother than it was for ‫די ַאלגעמיינע‬ ‫ענציקלאפּעדיע‬ ָ . In the case of the former, Max Weinreich and his son Uriel were in Denmark en route to Belgium. When war broke out in September, Weinreich stayed in Western Europe and made his way to the United States, arriving in March 1940. Even before his arrival, however, he had given permission to yivo ’ s ‫מאפּטייל‬ ָ ‫ ( ַא‬American Section ) to take temporary responsibility for publishing the ‫ווא ־ בלעטער‬ ָ ִ‫יי‬, and by October, New York was declared the organization ’ s new headquarters. The ĳirst New York-based volume to appear was issued in February of 1940, less than a year after the publication of the last Vilna volume.22 By contrast, the onset of war brought a much more dramatic interruption to ‫ענציקלאפּעדיע‬ ָ ‫ די ַאלגעמיינע‬. Weeks after releasing the second ‫ ייִ דן‬volume, 21 Norich 2007 : 12. 22 For a discussion of how yivo reconstituted itself in 1940 in New York, see Soyer 2008. 574 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ! ‫לקט‬ its editors were forced to flee Paris ahead of the German invasion. After heading ĳirst to Toulouse and then Marseilles, Abramovitch and others reached Lisbon by August. With the help of the Hebrew Immigrant Aid Society, the Jewish Labor Committee, the Bund, and the Emergency Rescue Committee, they were able to obtain visas that allowed them entry into the United States in September 1940.23 Lestschinsky had arrived prior to the war in 1938. Copies of the second ‫ ייִ דן‬volume, which had been sent to the United States ( since Poland was no longer accessible ), were lost at sea, but a few volumes survived and were reprinted through the auspices of the New York-based Central Yiddish Cultural Organization ( cyco ), which agreed to oversee the project ’ s remaining volumes. However, most of the ĳigures associated with the two serials did not survive the war years. Zalmen Reyzen was executed by Soviet forces. Simon Dubnow was murdered in a mass killing of inhabitants of the Riga Ghetto. Bramson, having fled Paris with Abramovitch, remained in Marseilles and died in early 1941. Noyekh Prilutski was murdered by the Gestapo. Zelig Kalmanovitsh was conĳined to the Vilna Ghetto and perished in Estonia. Emanuel Ringelblum was killed in Warsaw in 1944. Written in March 1940, the Foreword of the second ‫ ייִ דן‬volume at last made direct reference to the now unavoidable crisis.24 Recognizing that the chief institutions of Eastern European Jewish cultural life were fully under German or Soviet control, the editors saw ‫די ַאלגעמיינע‬ ‫ענציקלאפּעדיע‬ ָ as acting in the role of surrogate and revised their task accordingly. With no understanding of the totality of the destruction that was to come, they set about the task of creating a catalog of their history, society, and culture, as if attempting a snapshot of the Yiddish world on the eve of war. The second ‫ ייִ דן‬volume followed the model of the ĳirst, and was based on Jewish arts, culture, and language. With the announcement of a third ‫ ייִ דן‬volume, the mission of the encyclopedia began a radical shift, in which the knowledge that was originally thought of as supplementary came to overshadow the entire project, and the relationship between general and Jewish knowledge was inverted. Now housed in the United States and with little sense of when or if they might return to Europe, the two serials continued to publish through the war years and to adjust to their new circumstances. Both had bases of support in the United States ( ‫מאפּטייל‬ ָ ‫ ַא‬for ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬and cyco for ‫ענציקלאפּעדיע‬ ָ ‫) די ַאלגעמיינע‬, so publishing continued, although at a more sporadic rate. As the war raged in Europe, the ĳigures associated with the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬and ‫ענציקלאפּעדיע‬ ָ ‫ די ַאלגעמיינע‬watched powerlessly while the people and organizations associated with their re23 See the Jewish Labor Committee Archives, Box 32, Folder 7 and Box 38, Folder 23. 24 “ Di redaktsye ” 1940. Barry Trachtenberg : Bridging the “ Great and Tragic Mekhitse ” 575 spective projects were being annihilated. In the wartime pages of the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬and ‫ענציקלאפּעדיע‬ ָ ‫ די ַאלגעמיינע‬, it is clear that the editors struggled with the burdens of taking responsibility for preserving the memory of the Yiddish world that was under assault, and for identifying ways to support its surviving members in the United States. In particular, this combination of mourning on the one hand and determination on the other permeates the pages of the ‫ווא ־ בלעטער‬ ָ ִ‫יי‬ during the war years. For example, in the January – February 1940 volume, which appeared prior to Weinreich ’ s arrival in the United States, there is a note stating that, with great regret, temporary responsibility for publishing the journal was to be taken over by the ‫מאפּטייל‬ ָ ‫ ַא‬, but only with the consent of the Vilna community. The editors and contributors included many of those who had been associated with yivo since its inception, but who had migrated earlier, such as Lestschinsky, Mahler, Niger, and Jacob Shatzky. This issue begins a shift in the journal ’ s attention to Jewish life in the United States, with the inclusion of two articles : Nathan Goldberg ’ s “ Data on the Condition of the Jewish Writer in New York City ” and Herman Frank ’ s “ Economic Organization of the Jewish Middle Class in the United States. ” 25 A year later, in the January – February 1941 volume, Weinreich addressed the crisis head-on for the ĳirst time. Beginning what would become a tradition lasting several years, he used the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬as a forum to assess the state of Jewish scholarship, and the threat to it posed by the war. He afĳirmed yivo ’ s commitment to Jewish scholarship by discussing how, during its Vilna period, yivo served as a center for both academic and cultural pursuits. With the connection to Europe now lost, the ‫פּטײל‬ ַ ‫מא‬ ָ ‫ ַא‬had to serve the basic functions of the yivo and he insisted that the role of Jewish scholarship was important, not only to serve as a ‘ weapon ’ against those who would seek to oppress the Jews, but also to provide a means to liberate Jews from their own ignorance about the Jewish past, present, and future.26 With this, the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬became an instrument to provide not only a forum for scholarship, but a vehicle for activism. For the next several years, the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬reprinted Weinreich ’ s addresses to yivo ’ s annual conventions. In 1943, for example, his speech, ‫ווא אין ַא ָיאר‬ ָ ִ‫דער יי‬ ‫ ( ון אומקום‬yivo in a year of death ) was a defense both of yivo and of scholarship itself, and was very expansive in its understanding of its mission in America.27 He expressed his anguish at sitting in a “ blessed land ” when so many were being “ devoured ” on the other side of the ocean. He spoke of the need not to sink into despair, but to push on25 Goldberg 1940 ; Frank 1940. 26 Weinreich 1941. 27 Weinreich 1943. 576 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ! ‫לקט‬ ward and to recognize that yivo had an “ obligation to the entire future of the Jewish folk. ” Likewise, he insisted on maintaining yivo ’ s high standards and not giving in to the temptation to popularize its work. He pointed to yivo ’ s future task of reorienting its research toward the problems faced by Jews in the United States. At the same time, work on ‫ענציקלאפּעדיע‬ ָ ‫ די ַאלגעמיינע‬continued. In 1942, the third of the ‫ ייִ דן‬volumes was released. The volume contains long, multi-authored essays on vast swaths of Jewish history and culture, with essays on Jewish literature, the press, Jewish communal and national life, and the Jewish socialist and labor movement around the world. For the editors, even as they continued with a cultural project they had created before the war, they understood that an era had come to a close. As they wrote in the foreword : 28 ‫באמיט אונ־‬ ַ ‫האבן מיר זיך‬ ָ ‫מיט די בענד „ ייִ דן ״‬ ‫עריאד‬ ָ ‫טערצוירן ַא מין סך ־ הכּל ון יענעם פּ‬ ‫ארענדיקט אין‬ ַ ‫האט זיך‬ ָ ‫וואס‬ ָ ,‫ייִ דישע געשיכטע‬ ‫ליטערארישער‬ ַ ‫דאס איז ַא מין‬ ָ .1939 ‫הארבסט‬ ַ ‫אריקסירט ווערן‬ ַ ‫זאלן‬ ָ ‫ וווּ עס‬,‫מאנומענט‬ ָ ‫רעזולטאטן ון דער‬ ַ ‫]ד[ערארונגען און‬ ַ ‫די‬ ‫גײסטיקער ַאנטוויקלונג‬ ַ ‫מאטעריעלער און‬ ַ ‫אלק ביז צום ָאנהייב ון דעם‬ ָ ‫ון ייִ דישן‬ ‫איבערבראך ון דער צווייטער‬ ָ ‫היסטארישן‬ ָ .‫וועלט ־מלחמה‬ With the Yidn volumes we have taken pains to provide a sort of accounting of that period in Jewish history that came to an end in autumn 1939. This is a form of literary monument that should make permanent the experiences and achievements of the material and intellectual development of Jewish people up to the beginning of the historical rupture of World War ii. Given this recognition of the fact that the large majority of their original audience was no longer alive, it is somewhat surprising to ĳind that, in 1944, the editors released a ĳifth ( and what would be the ĳinal ) volume of general knowledge. In the introduction, the editors spoke of the many difĳiculties in bringing the volume to fruition.29 Most immediate was that two of its chief editors in New York had passed away, BenAdir in 1942 and Tcherikower in 1943. Worse was the attempt to write an encyclopedia with the knowledge that their audience of European Yiddish-speakers was being annihilated and that their project no longer had the same sort of relevance in its new home. The editors thus made no mention of any future volumes of general knowledge, but instead announced a continuation of the ‫ ייִ דן‬series on the topics of the “ organization of internal Jewish life and of Jewish folk culture. ” With the war ’ s end and the two serials now permanently based in the United States, and with an American (ized ) audience possessed of profoundly different economic, political, and religious concerns, and 28 “ Hakdome, ” Di algemeyne entsiklopedye 1934 – 1966 ( yidn : gimel ) : ( unpaginated ). 29 “ Hakdome, ” Di algemeyne entsiklopedye 1934 – 1966 ( 5 ) : ( unpaginated ). Barry Trachtenberg : Bridging the “ Great and Tragic Mekhitse ” 577 which spoke a different language from the Yiddish-speaking Jews of pre-war Europe, each publication was forced to undergo a reassessment of its mission. Rather than start anew, the editors of the ‫ווא ־ בלעטער‬ ָ ִ‫יי‬ and ‫ענציקלאפּעדיע‬ ָ ‫ די ַאלגעמיינע‬insisted on the continuing need for their projects, but recognized that they had to adapt them for the diminished Yiddish-speaking community in North America and its distinct needs. Three changes in particular stand out : ( 1 ) both serials display an increased level of self-reflection about their projects, in which the editors discuss their uncertain ĳinancial status and the need to adapt the missions of the serials themselves ; ( 2 ) there is a very discernible shift toward essays on Jewish history in general and a marked increase in subjects related to the United States and the Holocaust ; and ( 3 ) the publication of English-language versions of their work. Furthermore, the pre-war patterns established by both serials continued in the postwar era, in that the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬maintained a relatively stable and reliable publication schedule, whereas ‫ענציקלאפּעדיע‬ ָ ‫ די ַאלגעמיינע‬ended up entirely abandoning its original mission of creating a general encyclopedia and instead became a miscellany that was focused on issues of Jewish history and the Holocaust. For the dozen years after World War ii, the ‫ווא ־ בלעטער‬ ָ ִ‫ יי‬maintained a steady publishing schedule of ( typically ) one volume a year. In the post-war years, it became notable for research into the current and past conditions of Jewish life in North America ( in addition to Jewish history in other periods and regions ), and for writing some of the earliest historical investigations into aspects of the Holocaust. In this, the ‫ווא ־ בל עטער‬ ָ ִ‫ יי‬had to walk a ĳine line between remaining relevant to a rapidly dwindling audience and avoiding turning Yiddish into what was called in another – albeit related – context, a ‫רצײט־קולטור‬ ַ ‫יא‬ ָ ( culture of commemoration ), in which it might become over-identiĳied with mourning and loss and a metonym for the Holocaust.30 By 1948, however, yivo stopped reprinting addresses by Weinreich and resumed volumes that, in form, largely resembled those prior to the war. The articles in this period on Jewish life in North America are often expansive and ambitious. Volume xxxi – xxxii ( 1948 ), for example, was dedicated to questions of education and the psychology of Jewish families and youth. Later issues contained a variety of articles on topics such as Jewish religious life, Jewish agriculture in Canada, the New York Jewish literary scene, records of Jews in the Los Angeles Police Department, the participation of Jews in the American labor movement, and the New York school system. Volume xxxviii ( 1954 ) is dedicated entirely to the topic of Jewish life and culture in the United States, and offered articles 30 On the use of this term, see Norich 2007 : 26 f, 109. 578 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ! ‫לקט‬ on Yiddish literature, Jewish migration, Jewish education, and the extent to which Jews identiĳied with American society. In addition to the increase in essays related to American subjects, not surprisingly, a substantial number of articles also address aspects of the Holocaust, including Weinreich ’ s own Hitler ’ s Professors, a monograph-length condemnation of the German scientists and scholars who lent their support to the Nazi regime. Other contributions concerned the Lodz ghetto, the impact of the war on the psychology of Jewish youth, the relevance of Jewish national ideologies in the post-war period, obituaries of those yivo members killed during the war, the effect of the Nazi occupation on Jewish family relations in Poland, and Zelig Kalmanovitch ’ s diaries of the Vilna ghetto. The entirety of volume xxxvii ( 1953 ) is concerned with the Holocaust and focuses almost exclusively on the experiences of victims, including articles on social differentiation in concentration camps, rescue efforts, Jewish resistance, and the Madagascar plan. Following the 1944 release of the ĳifth volume of general knowledge, ‫ענציקלאפּעדיע‬ ָ ‫ די ַאלגעמיינע‬experienced a hiatus of half a dozen years. In 1950, the promised fourth volume of the Yidn series was released. The editors announced their intentions that the volume would be the ĳirst of a new three-part series. The initial three ‫ ייִ דן‬volumes, they wrote, existed on the other side of a vast divide that signiĳied the end of an era : 31 ‫רטראכט און‬ ַ ‫א‬ ַ ‫ ג [ איז‬,‫ ב‬,‫די ערשטע סעריע ] א‬ ,1941 — 1938 ‫יארן‬ ָ ‫געווארן אין די‬ ָ ‫דורכגעירט‬ ‫טראגישע‬ ַ ‫געווארן די גרויסע און‬ ָ ‫זײנען‬ ַ ‫וואס‬ ָ ‫נסיפּאציע‬ ַ ‫עמא‬ ַ ‫עפּאכע ון‬ ָ ‫מחיצה צווישן דער‬ .‫און דעם חורבן תּש ׳׳ א — תּש ׳׳ ה‬ ‫קא־‬ ַ ‫נאך דעם צווייטן וועלט ־ קריג און דער‬ ָ ‫האט זיך‬ ָ ‫אייראפּעיִ שן ייִ דנטום‬ ָ ‫סטראע ון‬ ָ ‫טא‬ ַ ‫נײע תּקוה ון ייִ דישער געשיכ־‬ ַ ‫ָאנגעהויבן ַא‬ ‫עפּאכע ון‬ ָ ‫פּעריאד — די‬ ָ ‫אייראפּעיִ שער‬ ָ ‫ דער‬.‫טע‬ ‫ירערשאט‬ ַ ‫גײסטיקער‬ ַ ‫פּאליטישער און‬ ָ ‫דער‬ ‫מיזרח־אייראפּעיִ שן ייִ דנטום אין דער ייִ די־‬ ָ ‫ון‬ ‫ארענדיקט אין איינעם‬ ַ ‫האט זיך‬ ָ — ‫שער וועלט‬ ‫מיט דעם כּמעט ולשטענדיקן חורבן ון די‬ .‫גרויסע ייִ דישע קיבוצים אין דער ַאלטער היים‬ The ĳirst series [of three] was conceived and carried out in the years 1938 – 1942, which were a great and tragic mekhitse between the epochs of emancipation and khurbn 1941 – 1945. After World War ii and the catastrophe of European Jewry, there began a new period in Jewish history. The European period – that epoch of the political and intellectual leadership of Eastern European Jewry in the Jewish world – has ended together with the near total khurbn of the great Jewish communities in the old world. 31 “ Hakdome, ” Di algemeyne entsiklopedye 1934 – 1966 ( yidn : daled ) : ( unpaginated ). Barry Trachtenberg : Bridging the “ Great and Tragic Mekhitse ” 579 However, in deciding to continue with their project, the editors of ‫די‬ like those of the ‫ווא ־ בלעטער‬ ָ ִ‫יי‬, provided one of the very few links between the world that was destroyed and the one that lay ahead. They saw the encyclopedia ’ s task as providing a means with which to help the new Jewish communities in the United States and Israel assume their positions of leadership in the Jewish world : 32 ‫ענציקלאפּעדיע‬ ָ ‫ ַאלגעמיינע‬, ‫נײער‬ ַ ‫אוישטײגנדיקע ייִ שוים אין דער‬ ַ ‫ [ די‬. . . ] ‫געבורטלאנד‬ ַ ‫וועלט און די יונגע מלוכה אינ]ע[ם‬ ‫נזאג אוין‬ ָ ‫זײנען ַאן ָא‬ ַ ‫אלק‬ ָ ‫ון ייִ דישן‬ ‫בלײבנדיקן לעבנס־כּוח ון אונדזער „ אייביקן‬ ַ ‫האט שוין איבערגעלעבט ַאזוי יל‬ ָ ‫וואס‬ ָ ,‫אלק ״‬ ָ .‫סטראעס און חורבנות‬ ָ ‫טא‬ ַ ‫קא‬ ַ [ … ] the emerging communities in the new world and the young state in the birthplace of the Jewish people are an omen of the ever-lasting living strength of our ‘ eternal people ’ that has experienced so many catastrophes and khurbones. In what can best be described as a type of scholarly ‫ יזכּור־בוך‬for European Jewry, the fourth ‫ ייִ דן‬volume provided a comprehensive overview of European Jewish history, country by country, with a particular focus on the period prior to the war. With richly illustrated essays by many of the surviving original editors and contributors to the project, such as Abramovitch, Lestschinsky, Menes, and Shatzky, this volume is a comprehensive catalog of the world they once knew and was their last opportunity to memorialize it. Seven years later, volume 5 of the ‫ ייִ דן‬series appeared and it was dedicated to Jewish life in the Americas, divided among the United States, Canada, and Latin America.33 By this time, most of the original editors had passed away or were no longer actively involved. As others rose to assume responsibility for the project, they expressed their wish to reinvigorate the encyclopedia ( restricting it to the ‫ ייִ דן‬volumes only ) and to restore it to a regular printing schedule. They anticipated publishing a volume on the destruction of European Jewry and another on the state of Israel. The ĳinal two volumes of ‫ענציקלאפּעדיע‬ ָ ‫ די ַאלגעמיינע‬appeared only several years later, in 1964 and 1966, and both are accounts of the Holocaust, discussing the assault on Jewish communities in the various European states. By the mid-1960s, both serials had largely reached their ends. After the yivo-bleter ’ s volume xli ( 1957 – 1958 ), which was dedicated to the recently deceased Shmuel Niger, publishing became much more er32 Ibid. 33 Ibid. ( yidn : hey ). 580 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ! ‫לקט‬ ratic, and the ĳinal volume was published in 1980.34 Nevertheless, both serials managed to reach wider audiences by creating English-language versions immediately after the war. In 1946, yivo released the ĳirst Annual of Jewish Social Science and cyco published the ĳirst of three ( later expanded to four ) volumes of The Jewish People : Past and Present. In their initial period, both serials largely consisted of translations of the Yiddish volumes, with the yivo Annual mostly comprising articles from the 1940s onward, with the goal of presenting a comprehensive view of “ every major Jewish settlement, and in time they cover signiĳicant phases of two thousand years of Jewish life, with accent on the present. ”35 The Jewish People : Past and Present was largely a translation of articles found in the ĳirst three ‫ ייִ דן‬volumes. In the introduction to the yivo Annual volume ii – iii ( 1948 ), Weinreich dramatically redeĳined yivo ’ s task to his English readers as : “ to study Jewish life present and past, near and distant with the tools of modern social science and to interpret Jewish life to the non-Jewish academic world. ” 36 With this, Weinreich announced what might be viewed as a radically new vision for yivo. With the linguistic shift to English and the relocation of yivo to a country that was largely welcoming to Jews, yivo ’ s scholarship would no longer be restricted to Yiddishspeaking Jewry alone, but would now be accessible to the wider world. He further made the case that what set yivo apart was its unique ability to study “ Jewish life from within ” [ original emphasis ], on account of its particular frame of reference and intimate ties to the community. The following year, yivo exempliĳied this shift by holding a symposium on the state of Jewish social scientiĳic research. With nearly sixty contributions from leading scholars, including William Foxwell Albright, Hannah Arendt, Daniel Bell, Nathan Glazer, Harry Lurie, Shmuel Niger, and Max Weinreich, the participants sought to lay the groundwork for future academic work. The issues debated among the participants included the extent to which future research should be dispassionate and inattentive to utilitarian concerns or whether it should have a practical application ; a reemergence of the debate as to whether yivo ’ s research should be on Jewish or general topics ; the overall signiĳicance of Jewish studies as a discipline ; whether there would exist adequate research personnel to carry out the work ; and to what extent yivo could be viewed as being “ sufĳiciently American in character ”.37 Subsequent volumes tended to follow the yivo-bleter ’ s publishing schedule and 34 Since volume xlvi ( 1980 ), four volumes in a “ new series ” appeared, between 1991 and 2003. 35 Weinreich 1946. 36 Weinreich 1948. 37 Lurie and Weinreich 1949. Barry Trachtenberg : Bridging the “ Great and Tragic Mekhitse ” 581 contain almost entirely English translations of its articles. Volume vii ( 1952 ) is a tribute to Peretz on the centenary of his birth. Publication slowed dramatically in the 1960s and had ceased by 1983.38 The Jewish People : Past and Present, true to the form of ‫די ַאלגעמיינע‬ ‫ענציקלאפּעדיע‬ ָ , was published much more erratically than the yivo Annual, the ĳirst three volumes appearing in 1946, 1948, and 1952. It was, in many respects, a much more prestigious work than the Yiddish encyclopedia. Although its editors were many of the same ĳigures who were responsible for the Yiddish volumes, others, such as Salo Baron ( Columbia University ), Mordecai Kaplan ( Jewish Theological Seminar ), Jacob Marcus ( Hebrew Union College ), and Abram Leon Sachar ( Brandeis ) lent their names to the Editorial Advisory Board. Contributions from scholars whose work did not appear in the Yiddish volumes ( and for whom such a choice may have been unimaginable ), such as William Foxwell Albright, M. F. Ashley Montagu, and Gershom Scholem, were also included.39 With the completion of the third volume, the editors expressed their intention to produce another three, but only one more volume appeared, in 1955, which was a commemoration of the tercentenary of Jewish life in what became the United States. The volume was dedicated to the Jewish Labor Committee, headed by Abramovitch, for having “ saved the lives of many of our editors and contributors by bringing them to this country in the years 1940 – 42, and which enabled us to achieve this work. ” 40 By successfully transitioning to the United States, both the ‫ווא ־ בל עטער‬ ָ ִ‫ יי‬and ‫ענציקלאפּעדיע‬ ָ ‫ די ַאלגעמיינע‬stand out from nearly every other Yiddish serial begun in Europe between the two world wars. Their presence in the historical record can provide a way to understand this period other than as a complete rupture ; instead, it allows us to view it as one that contains lines of continuity between the two epochs and continents. In making the move to their new location, however, the serials were located in a land that was simultaneously welcoming to Yiddish-speaking Jews, but comprised a Jewish community that was less invested in Yiddish or the ideologies that had once supported its development. With potential audiences numbering in the thousands, as opposed to the millions that Dubnow once imagined, the projects struggled to locate their readership, yet continued to make scholarly contributions for decades after the war. 38 In 1990, Deborah Dash Moore edited a volume, East European Jews in Two Worlds : Studies from the yivo Annual, which reprinted articles from the yivo Annual. The following year, volume 20 of the Annual appeared, also edited by Deborah Dash Moore, and contains new research as well as earlier work translated from Yiddish. 39 Although Scholem was less than enthusiastic about his inclusion in the volume. See his letter to Menes dated 5 June 1945 : yivo Archives, Papers of Abraham Kin ( rg 554 ) : Box 5. 40 Abramovitch et al. 1955 : ( unpaginated preface ). 582 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ! ‫לקט‬ General Encyclopedia, Sample Volume, Dubnow Fund, Berlin 1932 yivo Journal xvii, yivo, New York 1941. Bibliotheca Rosenthaliana, University Library of Amsterdam Bibliography Abramovitch, Raphael, et al., 1946 – 1955 : The Jewish People : Past and Present. 4 vols. New York : Jewish Encyclopedic Handbooks, Inc. Algemeyne entsiklopedye, Di, 1934 – 1966 : Raphael Abramovitch et al., eds., Di algemeyne entsiklopedye, Vols. 1 – 5 and yidn : alef – zayen. Paris : Dubnov fond, New York : n.p., and New York : Jewish Encyclopedic Handbooks. Bacon, Gershon, 2008 : “ Poland from 1795 to 1939. ” In : Gershon David Hundert, ed., The yivo Encyclopedia of Jews in Eastern Europe. New Haven : Yale University Press, 1390 – 1403. Barry Trachtenberg : Bridging the “ Great and Tragic Mekhitse ” 583 Ben-Adir and Menes, Avrom, 1937 : “ Erets-yisroel. ” In : Di algemeyne entsiklopedye 4, Paris : Dubnov-fond, 489 – 528. Ben-Adir and Tcherikower, Elias, and Abramovitch, Raphael, 1936 : “ Antisemitizm. ” In : Di algemeyne entsiklopedye 3. Paris : Dubnov-fond, 453 – 510. Cesarani, David and Sundquist, Eric J., eds., 2012 : After the Holocaust : Challenging the Myth of Silence. London – New York : Routledge. Diner, Hasia, 2009 : We Remember with Reverence and Love : American Jews and the Myth of Silence After the Holocaust, 1945 – 1962. New York : New York University Press. Engel, David, 2010 : Historians of the Jews and the Holocaust. Stanford : Stanford University Press. Estraikh, Gennady, 1999 : “ Has the ‘Golden Chain’ Ended ? Problems of Continuity in Yiddish Writing. ” In : Gennady Estraikh and Mikhail Krutikov, eds., Yiddish in the Contemporary World : Papers of the First Mendel Friedman International Conference on Yiddish. Oxford : Legenda, 119 – 132. – 2006 : “ Vilna on the Spree : Yiddish in Weimar Berlin. ” In : Aschkenas – Zeitschrift für Geschichte und Kultur der Juden 16 : 103 – 127. – and Krutikov, Mikhail, eds., 2010 : Yiddish in Weimar Berlin : At the Crossroads of Diaspora Politics and Culture. Oxford : Legenda. Frank, Herman, 1940 : “ Ekonomishe organizatsyes fun yidishn mitlshtand in di Fareynikte Shtatn. ” In : yivo-bleter xv : 103 – 123. Goldberg, Iser, 1966 : “ Hakdome. ” In : Di algemeyne entsiklopedye, Yidn : zayen, Dubnow-fond un entsiklopedye-komitet, ed., New York, Jewish Encyclopedic Handbooks, Inc. Goldberg, Nathan, 1940 : “ Materyaln tsum matsev fun yidishn shrayber in Nyu-York. ” In : yivo-bleter xv : 39 – 61. Karlip, Joshua M., 2005 : “ At the Crossroads Between War and Genocide : A Reassessment of Jewish Ideology in 1940. ” In : Jewish Social Studies 11 ( 2 ) : 170 – 201. Klinov, Yeshayahu, 1932 : “ Shekheyonu. ” In : Haynt, 2 May. Kuznitz, Cecile Esther, 2000 : “ The Origins of Yiddish Scholarship and the yivo Institute for Jewish Research. ” Ph.D. diss. Stanford University. – 2008 : “ yivo. ” In : Gershon David Hundert, ed., The yivo Encyclopedia of Jews in Eastern Europe. New Haven : Yale University Press, 2090 – 2096. Lurie, Harry L. and Weinreich, Max, eds., 1949 : “ Jewish Social Research in America : Status and Prospects. ” In : yivo Annual of Jewish Social Science iv : 147 – 312. Menes, Avrom, 1931 : “ Tsu der frage vegn onheyb fun der yidisher oytonomye in der biblisher tsayt. ” In : yivo-bleter i ( 2 ) ( February ) : 130 – 137. 584 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ! ‫לקט‬ Moore, Deborah Dash, ed., 1990 : East European Jews in Two World Wars : Studies from the yivo Annual. Evanston, il : Northwestern University Press and the yivo Institute for Jewish Research. – 1991 : yivo Annual 20. Evanston, il : Northwestern University Press and the yivo Institute for Jewish Research. Norich, Anita, 2007 : Discovering Exile : Yiddish and Jewish American Culture During the Holocaust. Stanford : Stanford University Press. Pinsker, Shachar M., 2011 : Literary Passports : The Making of Modern Hebrew Fiction in Europe. Stanford : Stanford University Press. “ Di redaktsye, ” 1940 : “ Hakdome. ” In : Di algemeyne entsiklopedye, Yidn : beys ( repr. ). New York : Central Yiddish Cultural Organization, ( unpaginated ). Soyer, Daniel, 2008 : “ Yiddish Scholars Meet the Yiddish-Speaking Masses : Language, the Americanization of yivo, and the Autobiography Contest of 1942. ” In : Edward S. Shapiro, ed., Yiddish in America : Essays on Yiddish Culture in the Golden Land, Scranton, pa : University of Scranton Press, 55 – 79. Svet, Herman, 1932 : “ Der ershter aroysfor fun der Dubnov-entsiklopedye. ” In : Moment, 13 May. Trachtenberg, Barry, 2006 : “ From Ediĳication to Commemoration : Di Algemeyne Entsiklopedye, the Holocaust, and the Collapse of Eastern European Jewish Life. ” In : Journal of Modern Jewish Studies 5 ( 3 ) ( November ), 285 – 300. Di tsentral-farvaltung fun yidishn visnshaftlekhn institut 1931 : “ Aroyslozndik di yivo-bleter. ” In : yivo-bleter i ( 1, Jan. ) : 1 – 3. Tsentral-komitet fun “ Dubnov-fond ” 1932. Algemeyne entsiklopedye : probeheft. Berlin : Dubnow Fund. Weinreich, Max, 1941 : “ Di yidishe visnshaft in der hayntiker tsayt. ” In : yivo-bleter xvii : 1 – 13. – 1943 : “ Der yivo in a yor fun umkum. ” In : yivo-bleter xxi : 86 – 99. – 1946 : In : yivo Annual of Jewish Social Science i : ( unpaginated ). – 1948 : In : yivo Annual of Jewish Social Science ii – iii : ( unpaginated ). Weiser, Kalman, 2011 : Jewish People, Yiddish Nation : Noah Prylucki and the Folkists in Poland. Toronto : University of Toronto Press. Yashunsky, Yosef, 1932 : “ Tsu der diskusye vegn an algemeyner entsiklopedye af yidish. ” In : yivo-bleter iii : 121 – 139. yivo, 1930 : Barikht fun der konferents fun dem yidishn visnshaftlekhn institut. Vilna : yivo. – 1931 : Yedies fun yivo 34 ( 3 July ). yivo bleter, 1932 : “ Tsum tsveytn yorgang ‘ yivo-bleter ’ . ” In : yivo-bleter iii ( 1, Jan. ) : 1 – 4. Rachel Rojanski Yiddish Journals for Women in Israel Immigrant Press and Gender Construction ( 1948 – 1952 ) Women have played an important role in the development and distribution of Yiddish literature since its early days as a written culture. They were active as writers, typesetters, printers, and owners of printing houses. Most importantly, however, women influenced the development of Yiddish by being a very signiĳicant part of its readership. Well-known in this regard is the excerpt from the introduction to the 17th-century Seyfer brant-shpigl that states : ‫דאש בוך ווערט גימט טויטש‬ ‫ ( דען ווייברין אונ ‘ מאנן דיא דא זיין אז ווייבר אונ ‘ קוינן ניט יל לערנן‬This book was written in Yiddish for women and for men who are like women and cannot study much ).1 No wonder then, that for many years, pre-modern, and even modern Yiddish literature has been perceived as “ literature for women. ” 2 Though this was never an accurate description, it did emphasize strongly the close connection between Yiddish literature and Jewish women, and even deĳined Yiddish literature as a feminine sphere aimed at the uneducated.3 This paper will return to the question of the connection between written Yiddish culture and women as readers in modern Yiddish culture by examining journals written specially for women in the nascent State of Israel. The focus on the press is not accidental. The Yiddish press that emerged in the 1860s played a most crucial and leading role in the development of modern Yiddish culture. Most of the signiĳicant Yiddish writers from Mendele Moykher Sforim 4 and Sholem Aleichem to Isaac Bashevis Singer 5 had a lifelong relationship with the Yiddish press, where they published many of their literary works. In both places – Eastern Europe and the United States – the Yiddish newspapers also played a crucial role in the Jewish public arena. Moreover, in the countries of immigration – especially the US, but also Israel – Yiddish newspapers played an important role in the processes of acculturation and social integration, and were an important factor in shaping the lives of the East European Jewish immigrants there. 1 2 3 4 5 Seyfer brant-shpigl 1596 : f 12 v, trsl. J. Frakes in: Baumgarten 2005 : 208. Turniansky 1994 : 46 – 57 ; Weissler 1998 : 39 – 52. Ibid. Miron 1973 : 159 – 161. Zamir 1994 : 30 – 40. 586 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ The Yiddish press never framed itself as a gender-oriented sphere. Although all the editors and almost all the writers were men, women were a signiĳicant part of its readership from its earliest days. They also played an active role as contributors to the correspondence section, and even published some literary work.6 Nonetheless, as early as the beginning of the twentieth century, special periodicals for women started to come out in Eastern Europe, focusing less on literature, news, and other ĳields of interest to the general public, and instead dealing with domestic and educational affairs.7 In addition, while the Yiddish dailies in Eastern Europe did not have regular women ’ s sections,8 those published in the us did, often devoting a signiĳicant amount of space to them.9 It did not take long for special women ’ s magazines to be issued.10 So while modern Yiddish culture – and especially the Yiddish press – brought the era of Yiddish written culture as ‘ women ’ s literature ’ to an end, the phenomenon of the Yiddish press for women did recreate a gendered deĳined arena. But while pre-modern Yiddish literature has often been perceived as women ’ s literature ( as opposed to Hebrew literature, which was meant for men ), the Yiddish press for women was deĳined as a separate female sphere within Yiddish written culture. The term “ women ’ s press ” relates typically to newspapers whose audience is clearly deĳined as mainly, or even only, women. This deĳinition excludes women ’ s sections in general newspapers, which are deĳined by some scholars as a separate genre where a struggle takes place to deĳine the borders between the ‘ general ’ and the ‘ feminine. ’ 11 It is also worth noting that the genre of ‘ women ’ s press ’ or ‘ women ’ s magazines ’ had developed long before the Yiddish press. In England it emerged as early as the end of the 17th century,12 and in the us about a hundred years later.13 6 7 Orchan 2012 : 29 – 49. Examples include ‫די ייִ דישע רויען ־ וועלט‬, Cracow, 1902 ; ‫טאג‬ ָ ‫ רויען ־‬, Moscow, 1921 ; ‫ רויען ־ שטים‬, Warsaw 1925. 8 The Warsaw daily ‫הײנט‬ ַ had an occasional women ’ s section ; other dailies did not have such sections at all. 9 Rojanski 2007 : 329 – 348. 10 The ĳirst one, ‫ די רויען וועלט‬, which deĳined itself as “ a monthly for the Jewish home and the Jewish family, ” was followed by the monthly ‫זשורנאל‬ ַ ‫ ( דער רויען‬1922 – 1923 ). While the ĳirst magazine focused mainly on domestic and educational affairs, the later one expanded its interests to include fashion, romantic literature and news of interest to women. The Yiddish press for women offered, then, a separate feminine sphere, deĳined by speciĳic ĳields of interest less serious and sophisticated than those of the general Yiddish press. 11 Herzog 2000 : 43 12 Braithwaite 2012 : 29 – 49. 13 Ibid. Rachel Rojanski : Yiddish Journals for Women in Israel 587 The long-time existence of a separate press for women has raised questions about the reasons for its creation as well as the causes of its success. Scholars of communications tend to regard the women ’ s press as a highly important social institution. However, although some see these papers as promoting women ’ s literacy, most scholars elaborate on their repressive influence. In her comprehensive study on 275 years of women ’ s press, Cynthia White has argued that it was written in simple language and limited itself to dealing with household matters, fashion and general information on women ’ s rights ( though not necessarily their rights as women ).14 She and other scholars like Gaye Tuchman15 and Marjorie Ferguson 16 have also argued that, since these papers deal with the world of women, they also frame the contents of this world and restrict it to areas which are secondary to the public arena. However, in her pioneering article on women ’ s journals in Israel, Hanna Herzog has pointed out the underlying dichotomy reflected by this view, namely that the “ female world ” is secondary to the public and rational male world, which is characterized by progress and modernity.17 There is a strong tendency for scholars of gender to deĳine the female world as a separate sphere.18 In the context of this paper, this raises an interesting issue. Because it served a minority, the Yiddish press was already a separate sphere. This poses the question whether Yiddish journals for women were, in fact, a separate sphere within a separate sphere – in other words, were these journals characterized by a double separation from the public sphere ? This question is even more valid in the Israeli context. It should be said that Hebrew journals for women existed in preState Israel as early as 1926.19 Their publishers were women ’ s organizations and they were strong advocates for women ’ s rights. The ĳirst commercial women ’ s magazine in Hebrew came out in 1940, under the title, ‫ ( עולם האשה‬Woman ’ s World ), and appeared until 1948. In 1947, the journal ‫ ( לאשה‬For the Woman ) began to be published and has continued to appear to this day. Both were popular, light journals that focused mainly on housekeeping, fashion and beauty issues. Lā-’ iššāh even sponsored the “ Miss Israel ” and “ Ideal Housewife ” contests starting as early as 1950.20 14 15 16 17 18 19 20 White 1987. Tuchman 1978 : 3 – 38. Ferguson 1983 : 184 – 193. Herzog 2000 : 43. For example : Mitchell 2000 : 140 – 169 ; Karber 1997 : 159 – 199. Herzog 2000 : 48 f. Ibid. 588 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ This even strengthens the question : did Israeli Yiddish journals for women really form a separate sphere ? Did they reflect the world of Yiddish culture or were they a phenomenon of immigrant societies ? What were the gender images that this press presented, and what can we learn from these images about the press itself ? The Yiddish Press in Israel and the Representation of Women The ĳirst Yiddish newspapers to be founded in Israel immediately following the establishment of the state were naturally aimed at the Yiddish reading public in general rather than at any speciĳic group within it. Nonetheless, women were very well represented in this press and this fact merits some attention. The ĳirst Yiddish newspaper founded in the state of Israel was the illustrated weekly ‫כנבלאט‬ ַ ‫ווא‬ ָ ‫ ( אילוסטרירטער‬Illustrated Weekly ), edited and published by Mordkhe Tsanin, later to become the legendary editor of the most important Israeli Yiddish newspaper, ‫נײעס‬ ַ ‫ ( לעצטע‬Latest News ).21 The Ilustrirter vokhnblat ’ s ĳirst issue, published on July 1, 1948, already had a special women ’ s section with a Hebrew name : ‫האשה‬ ‫ ( בארצנו‬The Woman in Our Land ).22 This section is of great interest because it was not a section for women, but a section on women, which dealt extensively with the contributions of women to the building of the new state in the realms of economy and security. As its name suggests, Ilustrirter vokhnblat, was a photo-magazine, so its illustrations deserve special attention. Every week the journal published photographs of women in different professions, especially in the army, agriculture, and industry. Particularly frequent were photographs of women soldiers and women in military uniform. Photos of this kind were often used for the weekly ’ s cover. During the year of its existence, about half of the issues featured photographs of women on the cover, the inside pages, or both. And the Ilustrirter vokhnblat was not the only journal to depict women in this way. Illustrated magazines ( in both Hebrew and Yiddish ) were very popular in those days, and in the same year, another illustrated Yiddish periodical , this time a bi-weekly, appeared in Israel. Its name was ‫ייִ דישע‬ ‫ ( בילדער‬Jewish Photographs ), and it was the continuation of a weekly of the same name that had appeared in Riga ( Latvia ) before 1939. Towards the end of 1946, a group of Holocaust survivors who had worked on it 21 On the ‫כנבלאט‬ ַ ‫ווא‬ ָ ‫ אילוסטרירטער‬see Rojanski 2008 : 141 – 148. 22 On the reasons for using Hebrew in the ĳirst issues of ‫כנבלאט‬ ַ ‫ווא‬ ָ ‫ אילוסטרירטער‬, see ibid. : 143 f. Rachel Rojanski : Yiddish Journals for Women in Israel 589 before the war began to republish it in the Displaced Persons camp in Landsberg under the leadership of Dr. Shmuel Gringhouse.23 In 1948, some of the group moved to Israel and started publishing the journal there with Salomon Frank as editor.24 Like Ilustrirter vokhnblat , Yidishe bilder printed photographs of women soldiers on its cover, and reported widely and enthusiastically – mainly through photographs and captions – on women ’ s contributions to Israel ’ s economy, agriculture, and security. However, this kind of gloriĳication did not last long, and was soon replaced by a more complex presentation. In November 1949, Ilustrirter vokhnblat shut down to be replaced by a newspaper, ‫ ( לעצטע נײַעס‬Latest News ), that later became the most important Yiddish daily in Israel. Like Ilustrirter vokhnblat, Letste nayes dealt with women in Israel a great deal, but in a different and more nuanced way. One of its ĳirst issues contained an article that depicted the life of the Israeli woman as divided between raising children and running the household.25 However, soon after that a special section for women began appearing under the name : ‫אר דער רוי‬ ַ ( For the Woman ). Almost all the articles in the section were written by one author, Shoshana Khisin, and dealt with matters that scholars have deĳined as ‘ feminine. ’ These included discussions of how a woman should dress, how she should treat her husband, and so on.26 But the women ’ s section of Letste nayes also had an additional angle : it devoted space to questions of women ’ s rights,27 and the nature of women ’ s political roles in the world.28 The broad – and quite progressive – treatment of women in these Yiddish publications raises the question whether it reflected a general and uniĳied attitude towards gender issues and the status of women in the new Israeli society. The answer to this question is not a simple one. It would seem that the very prominent use of photographs of women as heroic ĳigures, and especially of women in military uniform, was probably not part of a gender-related view, but rather a part of the general view of the nature and characteristics of the Israeli as opposed to the Diaspora Jew. This was because the ĳirst Yiddish newspapers that appeared in the state of Israel – and especially the Ilustrirter vokhnblat – were very strongly influenced by the Zionist ethos. In that spirit, they presented a narrative – written or pictorial – that described the 23 24 25 26 27 28 Yidishe bilder, December 4, 1946. This information appears in the ĳirst issue that came out in Israel in 1948. Tsanin 1949. Devora bat Miriam 1950. Khisin 1949 : 7. Khisin 1950 : 6. 590 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Israeli Jew, whether born in Israel or an immigrant, as superior to the Diaspora Jew. They were presented as more sophisticated and especially more productive.29 Following what Gershon Shaked has deĳined as “ the Zionist meta-narrative, ” 30 the army and national defense were presented as if they were the ultimate values. The large amount of space in these papers dedicated to the women ’ s contribution to the defense of the state was part of this narrative and was meant to strengthen it. In another way, the women ’ s section of Letste nayes was largely modeled on the American Yiddish newspapers in their heyday. Thus, the depiction of women in these Israeli Yiddish publications was a kind of combination of images from the Yiddish press in the countries of immigration and new images popular in the State of Israel. Yiddish Journals for Women Two Yiddish journals for women appeared in Israel, both in the 1950s : ‫ די היים‬and ‫דער רויען ־ בולעטין‬. Both journals were highly ideological, and although both were published by political movements, and were probably meant to act as ideological mouthpieces, they could not but present a range of images of, and opinions about, women. In this way, these journals also contributed to the construction of gender images within the community of East European Jewish immigrants in Israel. It is therefore worth examining each of them individually. A. Di heym In June 1950, the ĳirst issue of the monthly ‫ווארט ון דער‬ ָ ‫דאס‬ ָ : ‫די היים‬ ‫ ( ַארבעטנדיקער רוי אין ישׂראל‬The Home : the Word of the Working Woman in Israel ) came out in Tel Aviv. It was published by Mō ‘ eẓet ha-pō ‘alōt, a women ’ s organization afĳiliated with the Israeli Labor movement, which was founded in 1921 and continues to exist today, though under a different name. The editor of Di heym was Kadya Molodowsky, a well-known Yiddish writer. Born in Poland in 1894, Molodowsky received a traditional Jewish and a secular Hebrew education, becoming a teacher in a Yiddish school in Warsaw. In 1935 she migrated to the us and lived in New York. She moved to Israel in 1950, staying there for two years. At that time she was already a popular author with a number of published col29 Rojanski 2008 : 141 – 148. 30 Shaked 1993 : 70 f. Rachel Rojanski : Yiddish Journals for Women in Israel 591 lections of poems and short stories. She was especially known as a children ’ s writer.31 It seems that the reasons for appointing Kadya Molodowsky as editor of Di heym were connected with both her writing and editing skills and her political views. Though Molodowsky never belonged to any political organization, she became close to Labor Zionist circles in America, mainly through her writings. She was a fairly regular contributor to the Labor Zionist weeklies ‫ ( דער ייִ דישער ַארבעטער‬The Jewish Worker ) and ‫ ( דער ייִ דישער קעמער‬The Jewish Militant ), mostly on matters concerning relations between American Jewry and the State of Israel. However, though Molodowsky never wrote anything theoretical on gender issues, Di heym under her editorship became a quality journal for women. The opening article of the ĳirst issue, written by Molodowsky herself, was a kind of editorial manifesto. While it did not spell out the journal ’ s goals, the article did describe it as a journal for and about the working woman in Israel. “ The Jewish working woman, ” it said, “ is a full partner in the building of the State of Israel and has to cope with the same problems as the entire Jewish people. ” 32 For that reason, stated Molodowsky, she needs information about working women in general. Molodowsky concluded the article by saying, “ The title of the journal is ‘Home’ ( ‫) היים‬. It comes out in Israel and brings good news to the Jewish house in the Jewish Home like a message sent from the home of all the Jews ” ( emphasis in the original ).33 It was Molodowsky ’ s view that this information should also be sent to the Jewish working woman abroad. The general description of the journal and especially its Zionist emphasis invites a comparison with the ‫פּיאנירן ־ רוי‬ ָ ( Pioneer Woman ), the journal of the American Pioneer Woman organization, a sister organization of the Israeli Mō ‘ eẓet ha-pō ‘alōt. However, Di heym was a completely different kind of publication. Pionirn-froy was a political tool of the Pioneer Women, which Di heym never was. Unlike Pionirnfroy, Di heym rarely reported on the organization ’ s activities or tried to promote them. It was a quality journal that discussed many aspects of Israeli life, while focusing mainly on the experience of women or on issues that women traditionally had to cope with. For the Yiddish female reader of the early 1950s, this was the only place to learn about these matters. The goal of the new journal was also discussed, more or less directly, in two other articles in the ĳirst issue, written by prominent lead31 Cohen 1986 : 355 – 360. 32 Molodowsky 1950 : 4. 33 Ibid. 592 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ers of working women in Israel : Beba Idlson 34 and Rachel KatsenelsonShazar.35 Idlson ’ s article, “ ‫וואס איז מועצת הפועלות‬ ָ „ ,36 did not directly address the question of the need for a women ’ s journal, focusing instead on the role working women played in Israel ’ s economy and on the importance of maintaining regular connections between working women in Israel and Jewish working women abroad, particularly in the us. That was how she actually deĳined the journal ’ s goal. When she wrote “ working women, ” Idlson actually meant women who were afĳiliated with the labor movement or at least subscribed to its values. As far as she was concerned, Di heym was supposed to be a vehicle for promoting those values among its readers. Katzenelson-Shazar ’ s article, on the other hand, directly addressed the issue of the need for a women ’ s journal.37 The role of the journal, she wrote, is to showcase the whole range of activities of the Israeli working woman to readers abroad – and, no less importantly, to Yiddish readers in Israel. Di heym ’ s goal, she added, is to strengthen loyalty to the Jewish people among female Yiddish readers and to encourage them to give their children a Zionist education. In fact, Di heym became a journal not just about Israeli women, but for them. Most issues had three sections. One, usually published at the end of each issue, brought news from working women ’ s organizations in Israel and around the world. Another was dedicated to literature and culture, including pieces by Yiddish writers like H. Leyvik, Avrom Sutzkever, Tsvi Ayznman, and Joseph Papiernikov, alongside works by Hebrew writers, including Jacob Fichman, S. Yizhar, and Devorah Baron. However, the opening section of most issues dealt with working women in Israel. It printed articles about women in Israeli industry,38 women in the labor market,39 and female equality.40 There were also articles on the contributions of women who were already long-time residents of 34 Beba Idlson, the leader of Mō ‘ eẓet ha-pō ‘alōt, one of the organization ’ s founders and a member of the Israeli parliament ( the Knesset ), was very active in the ĳield of women ’ s rights. As a Knesset member, she was active in passing laws for women : three laws she championed dealt with equal rights, equal pay, and military service for women. 35 Rachel Katsenelson-Shazar was also one of the founders of Mō ‘ eẓet ha-pō ‘alōt and the editor of ‫ ( דבר הפועלת‬The Word of the Working Woman ), the organization ’ s Hebrew-language monthly. 36 Idlson 1950 : 5 – 8. 37 Katsenelson-Shazar 1950 : 9. 38 Di heym 1951 ; Filniak 1951. 39 Lamdan 1951 : 21 f. 40 Meirson 1952 : 9 f. Rachel Rojanski : Yiddish Journals for Women in Israel 593 Israel to life in the temporary immigrant camps ( ma ’ bārōt ).41 Perhaps most interesting, however, were articles encouraging women to go back to school and acquire a profession.42 These articles described with great appreciation working women and mothers who had studied to become school and kindergarten teachers. In the summer of 1952, Kadya Molodowsky returned to America and Di heym closed. The journal itself never published any explanation for the closure and there seems to be no archival source that sheds any light on it. We may assume that as a Yiddish journal for women, Di heym did not have a wide distribution, and with the resignation of Molodowsky, Mō ‘ eẓet ha-pō ‘alōt simply did not make an effort to keep it alive. One might also assume that, during the time of the austerity regime in Israel, with its accompanying serious shortage of printing paper, the leaders of the organization did not want to use their limited resources on a small journal whose influence was unclear.43 Nonetheless, in the course of its short life, Di heym managed to present some very interesting images of women. In quite a naïve way, it supplied its readers with the Israeli cultural stereotypes of the 1950s, but alongside them gave a clear feminist message that encouraged them to aspire to women ’ s equality in Israel. This message was quite neatly summed up in a fascinating article by Rachel Katsenelson-Shazar,44 which described three generations of Jewish women. The ĳirst was Puah Rakovsky, a Polish Jewish woman who, after refusing an arranged marriage, becoming a teacher and divorcing her husband, immigrated to Palestine in the 1930 ’ s ; the second was the Hebrew poet and kibbutz member Fanya Bergstein ; the third, Zohara Levitov, who was trained as a pilot and was killed in Israel ’ s War of Independence. This sequence of strong women showed Israeli women breaking traditional gender stereotypes, while at the same time making a major contribution to what were considered Jewish values : education, literature, and above all – at least as far as 1950s Israel was concerned – Israel ’ s security. Interestingly enough, Di heym did not publish stories about women in the home, and had no cooking, education or fashion sections or any of the other domestic-related sections typical of women ’ s journals. The second Yiddish journal for women, Froyen-buletin, was very different. 41 A. Y. 1951 ; Di heym 1952 : 16 f. 42 Karl-Amitay 1952 : 18 f. 43 On the attitude of the Israeli political parties toward Yiddish, see my forthcoming book : A Jewish Culture in the Land of Hebrew : Yiddish in Israel 1948 – 2008. 44 Katzenelson-Shazar 1952 : 34 f. 594 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ B. Der froyen-buletin ‫ ( דער רויען ־ בולעטין‬Women ’ s Bulletin ), also called in Hebrew ‫עלונך‬ ( Your Bulletin ), began to appear in Tel Aviv in October 1950. Its publisher was The Organization of Democratic Women, an organization afĳiliated with the Israeli Communist party, and it came out on an irregular basis for nine years. It was a ĳine, high quality journal that encouraged women to take an active part in the public arena, even though it was clearly created as a propaganda tool for the organization that published it. Among its editors were prominent leftists, including the former partisan and ghetto ĳighter Batia Berman 45 and the physician Dr. Hanna Sneh,46 both wives of Knesset members : Sneh from the Israeli Communist Party, and Berman from the leftist-Zionist Mapam. Unlike Di heym, this journal did have a credo, which was published on the cover of its ĳirst issue in the following terms : Among the publications for women that come out in Israel, there is not one that really serves the woman who works in the factory, the woman who takes care of the family at home, or the new immigrant. There is no journal that expresses the true joys and concerns of the Israeli woman, and ĳights for her rights in Israel. This manifesto conformed completely to the principles of the Communist Party, and it is tempting to see the journal as simply another Party mouthpiece. I would argue, however, that whatever the original intentions may have been, the result was an exceptional and openly feminist journal. The very ĳirst issue of Der froyen-buletin presented an interesting and even sophisticated combination of feminism and traditional feminine content. The two main topics of the issue were the black market and the opening of the academic year in the public schools.47 Ostensibly, these were the general issues of the day in Israeli society, but both were also connected with the traditional feminine world – the world of keeping house and bringing up children. The articles themselves did not only deal with the details of daily life at home, but had broader horizons, discussing the teachers’ strike, tuition for preschools, and so forth. The issue also contained pieces on female peace activists, condemnations of nuclear proliferation from a women ’ s standpoint and so on. 45 Temkin-Berman 2008. 46 Hana Sneh was a family doctor and one of the founders of the organization of women doctors. Conversation with her son, Dr. Ephraim Sneh, October, 2011. 47 Der froyen-buletin 1950 a, 1950 b. Rachel Rojanski : Yiddish Journals for Women in Israel 595 The journal ’ s ideological and feminist nature became much more pronounced from its second issue on. This issue included a lengthy section on the Russian revolution of October 1917,48 as well as a discussion of the Democratic Women ’ s Organization, women in the Soviet Union, and world peace. Special attention was paid to Jewish women who had reached high positions in the public arena in Israel and around the world. These included Anna Pauker, the Jewish woman who became vice prime minister in Romania ;49 Tzila Eyram, who was appointed a member of Haifa city council,50 and various women peace activists.51 Unlike Di heym, Der froyen-buletin did not have a formal structure. Each issue had its own central topic, which was related to a current or historical event. Of particular interest is issue 4, which came out in March 1951 to mark International Women ’ s Day, but devoted signiĳicant space to the Korean War. The issue opened with a poem by the Yiddish writer Dora Teitlbaum, then in Paris, about the mothers of the Korean soldiers. It was entitled, ‫באגעגנט‬ ַ ‫מאמע‬ ַ ‫רעאנישע‬ ַ ‫קא‬ ָ ‫האב ַא‬ ָ ‫ ( איך‬I Have Met 52 a Korean Mother ). The poem was followed by an article on the sufferings of Korean women during the war.53 The nexus of women and world peace was very prominent, almost central, in Der froyen-buletin and was dealt with in a variety of ways.54 The journal dealt widely with motherhood in much the same fashion. In March 1955 it published impressions from a congress of mothers that took place in Lausanne ( Switzerland ), which about 1,060 women from seventy countries attended to discuss the love of mothers for their children.55 From this point the journal developed the idea of ĳighting for peace as a part of good motherhood. Some articles called for supporting peace as a way of defending children,56 and others focused on protesting against nuclear proliferation for the same reason.57 As well as covering the general situation in Israel, Der froyen-buletin also dedicated signiĳicant space to issues of women ’ s rights and women ’ s equality there. ” 58 One article protested ĳirmly against the absence 48 Der froyen-buletin 1950 d. 49 Der froyen-buletin 1951 b. 50 Der froyen-buletin 1951 a. 51 Der froyen-buletin 1950 c. 52 Der froyen-buletin 1951 e : “ I met a Korean Mother / …… / With fever on her lips / Over villages and cities / She was talking peace. ” 53 Der froyen-buletin 1951 d. 54 Der froyen-buletin 1955 d. 55 Lubitsh 1955. 56 Der froyen-buletin 1955 d. 57 Der froyen-buletin 1958. 58 Der froyen-buletin 1959. 596 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ of civil marriage in Israel, and its implications for the status of women ; 59 another provided information about women in Israeli politics.60 Another topic covered by Der froyen-buletin, not at all typical for the Israeli Yiddish press, was the situation of Arab women.61 Der froyenbuletin presented them as an example for solidarity between women of different nationalities regardless of political tension and conflicts. Another issue dealt with widely in Der froyen-buletin was women ’ s everyday life. Articles tended to focus on two topics : children ’ s education and household management. Of course, both topics were treated very extensively in most women ’ s magazines, not just those in Yiddish. One might expect that a very ideological publication would consider education as an ideological issue involving passing on progressive ideas to the next generation. However, Der froyen-buletin did not discuss education from an ideological point of view. Articles dealt with issues such as helping children with their homework,62 keeping them busy during the summertime,63 and children ’ s experience in kindergarten.64 Even more interesting than that was the choice to publish articles which dealt with everyday housekeeping matters and women ’ s fashion. As early as 1951, regular sections began to appear on sewing and knitting, cooking, and fashion. aimed at helping women save money from the family budget.65 They were thus rather at variance with the highly ideological nature of the rest of the magazine. The journal also had a humor section,66 anecdotes from women ’ s lives,67 and articles about health care 68 and the role of the home in children ’ s education,69 alongside stories on everyday life in the ma ’ bārāh ( the temporary immigrant camp ).70 Thus, while Di heym followed the tradition of the Yiddish press by offering its readers Yiddish literature, Der froyen-buletin tried to attract the working woman not just with ideological material, but with simple practical information. This may well have helped broaden its readership and perhaps its popularity, too. 59 60 61 62 63 64 65 66 67 68 69 70 Der froyen-buletin 1955 a. Der froyen-buletin 1955 c, 1955 d. Der froyen-buletin 1952 a ; Lubitsh 1959. Der froyen-buletin 1956 a. Der froyen-buletin 1956 b. Der froyen-buletin 1957. Der froyen-buletin 1951 c, 1953 b. Der froyen-buletin 1951 g, 1951 f, 1953 a. Der froyen-buletin 1952 b, 1951 i. Der froyen-buletin 1953 c. Der froyen-buletin 1953 d. Der froyen-buletin 1952 c, 1951 h. Rachel Rojanski : Yiddish Journals for Women in Israel 597 Yiddish Press, Women ’ s Literature and Gender Images Though the Yiddish press in Israel ’ s ĳirst years had a clearly ideological aspect, it was ĳirst and foremost an immigrant press, the vast majority of whose readership consisted of Yiddish-speaking newcomers. This raises important questions when examining the gender images to be found in it. Were these the same images traditionally to be found in Jewish culture or were they influenced by Israel ’ s new Zionist ethos ? To put this in Hannah Herzog ’ s formulation, were these journals “ a sphere for the duplicating of female images or a sphere for challenging them ” ?71 As mentioned before, Hebrew journals for women have come out in Israel since the second quarter of the twentieth century. The ĳirst commercial women ’ s magazine came out in 1940, and since then the genre of commercial light journals that focus mainly on housekeeping, fashion and beauty issues has become very popular. It is very clear that Yiddish journals for women did not follow this route. In a way, they were more similar to some of the journals published by women ’ s organizations, such as ‫ ( האשה‬The Woman ),72 and especially ‫ דבר הפועלת‬, that focused on women in the family and at work. However, the Yiddish journals differed not only from the Hebrew-language publications which preceded them but also from each other. Di heym, which was published by the same organization as Děvar ha-pō ‘ elet, was ĳirst and foremost a classic product of Yiddish newspaper culture. Like many Yiddish journals and newspapers, it had a regular section on Yiddish literature that had almost nothing to do with women or gender. Der froyen-buletin, on the other hand, did not follow the tradition of the Yiddish press. It rarely published Yiddish literature, and when it did so, the texts were by women and harnessed directly to the journal ’ s political goals. Di heym had a very Jewish – and even more Israeli – orientation. All the articles dealing with Jewish women ’ s issues dealt mainly with the situation in Israel. Der froyen-buletin, on the other hand, had an international point of departure, dictated by its Communist agenda, and heavily promoted the Party ’ s agenda on peace. Thus, while Di heym published articles on women in Israel, Der froyen-buletin dealt with Israeli women in the context of the international female labor force. Both journals advocated equality between the genders and the struggle for women ’ s rights, and encouraged women to participate in the public - and especially the political - arena. However, while Di heym 71 Herzog 2000 : 51 f. 72 Keren 2000 : 28 – 35. 598 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ focused more on women ’ s activity as a separate sphere, Der froyen-buletin supported both separate activities in women ’ s organizations and striving for leadership roles in general ones. While Di heym tended to print stories about leaders of women ’ s organizations, Der froyen buletin emphasized, for example, the election of a woman to the Haifa city council. Also interesting were the different attitudes toward the individual and the collective. Di heym encouraged women, as individuals, to improve their education, as in the story about women who went back to school in order to get a teacher ’ s diploma. Der froyen-buletin preferred to present women ’ s achievements from the point of view of general society. Women were encouraged to ensure that their children grew up to be well-educated members of society, and especially supporters of peace for the beneĳit of all. In other words, while Di heym focused more on women developing themselves in order to contribute to Israeli and Jewish society, Der froyen-buletin focused on women ’ s integrative role in contributing to the collective through their educational and political activities. However, despite the differences of approach, it seems that both journals had very similar images of women and their gender roles, which, in Hanna Herzog ’ s deĳinition, made them both spheres for challenging accepted images of women. These images differed from the traditional portrayal of women in Yiddish culture, but coincided with common Zionist rhetoric and images of 1950s Israel, though not always with reality. Both journals presented as models for their readership images of progressive women who contributed to the public sphere. The Zionist Di heym showed this directly by emphasizing women ’ s roles in ĳields such as absorbing new immigrants, promoting Israeli industry and agriculture, and above all Israeli education. The Communist Der froyen-buletin preferred to present it through a much more cosmopolitan prism. Nonetheless, it was the same image of a progressive and active woman. This leads to the conclusion that Yiddish journals for women in Israel did not relate to women as a separate sphere within immigrant society ( i. e., a separate sphere within a separate sphere ) but tried to bring to new immigrants the same gender images that were considered desirable in general, Israeli society. Di heym existed for two years. The reasons for its closure are not known, but since political organizations in 1950s Israel were interested in putting out as many Yiddish publications as possible as a means of reaching the Yiddish speaking population, this seems to have been simply conjunctural. Der froyen-buletin, however, came out for almost Rachel Rojanski : Yiddish Journals for Women in Israel 599 a decade, which meant that it had a longer life than many of the other Yiddish publications in Israel. As far as gender issues were concerned, it should be noted that these were the only Yiddish women ’ s journals ever published in the state of Israel. Some of the general Yiddish newspapers, especially the daily Letste nayes and the weekly Ilustrirte veltvokh ( Illustrated World Weekly ) which was also published by Tsanin in the late 1950s, did include sections on housekeeping, fashion and cooking. Though these were not always deĳined as women ’ s sections, they still presented traditional ‘ feminine ’ gender images. Only the two women ’ s journals transcended these traditional images. Three hundred years after the Brant-shpigl was ĳirst published, they created a new form of written Yiddish culture, one aimed not at “ women and men who are like women, ” but at women who wanted equality with men in every respect. Bibliography A. Y., 1951 : “ Di shtilste bazorgerin – di merakezet. ” In : Di heym 7, August : 25 – 27. Baumgarten, Jean, 2005 : Introduction to Old Yiddish Literature. Oxford : Oxford University Press. Beetham, Margaret, 1996 : A Magazine of Her Own ? Domesticity and Desire in the Woman ’ s Magazine 1800 – 1914. London – New York : Routledge. Braithwaite, Brain, 1995 : Women ’ s Magazines, the First 300 Years. London : Peter Owen. Cahn [ Kagan ], Berl, 1986 : Leksikon fun yidish-shraybers, New-York : [ unpaginated ]. Devora bat Miriam, 1950 : “ Tsi darfn zikh froyen putsn. ” In : Letste nayes, January 13 : 6. Ferguson, Marjorie, 1983 : Women ’ s Magazines and the Cult of Femininity. London : Heinemann. Filniak, Zhenye, 1951 : “ Di arbeterin in fabrik. ” In : Di heym 7, August : 21. Froyen-buletin,73 Der, 1950 a : “ Vi azoy kemft men kegn shvartsn mark ? ” In : Der froyen-buletin 1, October : 1. – 1950 b : “ In onheyb fun nayem shulyor. ” In : Der froyen-buletin 1, October : 2. – 1950 c : “ Uzheny Koton di dreyste sholem-kemferin. ” In : Der froyen-buletin 1, 12. 10. 1950 : 4. 73 The issues of Der froyen-buletin were not provided with numbers or dates systematically and not all issues have page numbers. 600 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ – 1950 d : “ Lekoved dem yontef fun der oktober-revolutsye shikn mir di sovetishe froyen di varemste grusn. ” In : Der froyen-buletin 2, 10. 11. 1950 : 3. – 1951 a : [ No title ]. 3. 1. 1951 : 2. – 1951 b : [ No title : article about Anna Pouker ]. In : Der froyen-buletin 3. 1. 1951 : 3. – 1951 c : “ In shtub. ” In : Der froyen-buletin 3, January : [ unpaginated ]. – 1951 d : “ Ikh hob a Koreanishe mame bagegnt. ” In : Der froyen-buletin 4, March : 1. – 1951 e : [ No title : article on the sufferings of Korean women during the Korean War ]. In : Der froyen-buletin 4, March : 3. – 1951 f : “ Dos hant-baytl – felyeton. ” In : Der froyen-buletin 8, September : 2. – 1951 g : “ Lomir lakhn. ” In : Der froyen-buletin, September : 3. – 1951 h : “ A dakh ibern kop fun maabara-aynvoyner. ” In : Der froyen-buletin 9, November : 1. – 1951 i : “ A shmues mit zamlerins fun untershriftn. ” In : Der froyen-buletin 10, October : 2 f. – 1952 a : “ Dos lebn fun arabishe froy un kind. ” In : Der froyen-buletin 2 – 3, March : 4. – 1952 b : “ Tsvishn undz geredt. ” In : Der froyen-buletin 2 – 3, March : 4. – 1952 c : “ In a maabara. ” In : Der froyen-buletin 3, March : 2. – 1953 a : “ A pekl fun Amerike – felyeton. ” In : Der froyen-buletin 8 : 4. – 1953 b : [ No title ]. In : Der froyen-buletin 9, August : [ unpaginated ]. – 1953 c : “ Vi optsuhitn dos gezunt. ” In : Der froyen-buletin [ no number or date ] : 8. – 1953 d : “ Di rol fun der heym in der dertsiung fun kind. ” In : Der froyenbuletin [ no number or date ] : 8. – 1955 a : “ Harey at mekudeshes li : in tsvang fun mitlaltlekhe dinim. ” In : Der froyen-buletin 2 : [ unpaginated ]. – 1955 b : “ Froyen in politishn lebn. ” In : Der froyen-buletin 3 : 5. – 1955 c : “ Ester Vilenska vegn ire oyfgabn. ” In : Der froyen-buletin 3 : 5. – 1955d : “ Lomir bashitsn undzere kinder, lomir farteydikn dem sholem. ” In : Der froyen-bulletin, July : 4. – 1956 a : “ Notitsn fun a dertsierin : Dani geyt nisht tsu di lektsyes. ” In : Der froyen-buletin, March : 7. – 1956 : “ Vuhin zol ikh geyn mit mayne kinder in di zumer-monatn ? ” In : Der froyen-buletin 3. – 1957 : “ Vu iz der yam fun Tusker ? ” In : Der froyen-buletin 1 : 5. – 1958 : “ 20 toyznt untershriftn kegn eksperimentn mit atom-bombe-vofn. ” In : Der froyen-buletin 3 : 8. – 1959 : “ Vegn di rekht fun der froy in Yisroel. ” In : Der froyen-buletin 1 : 1. Rachel Rojanski : Yiddish Journals for Women in Israel 601 Herzog, Hanna, 2000 : “ ‘ Ittōnūt nāšīm : merḥāv měša‘atēq ’ ō merḥāv liqěrī ’at tiggār. ” In : Kesher 28 : 43 – 52. Heym, Di, 1951 : “ Arbeterins in industrye. ” In : Di heym 5, February : 21. – 1952 : “ Vi me zorgt far froyen in maabarot. ” In : Di heym 9, April : 16 f. Idlson, Beba, 1950 : “ Vos iz moetset hapoalot. ” In : Di heym 1, June : 5 – 8. Karber, Linda K., 1997 : Toward an Intellectual History of Women : Essays. Chapel Hill : University of North Carolina Press. Karl-Amitay, Shulamit, 1952 : “ Mames seminaristkes. ” In : Di heym 9, April : 18 f. Katsenelson-Shazar, Rachel, 1950 : “ Tsu undzer monatshrift ‘ heym ’ . ” In : Di heym 1, June : 9. – 1952 : “ Dray doyres yidishe froyen. ” In : Di heym 9, April : 34 f. Keren, Michael, 2000, “ ‘ Hā-’iššāh’ wě-haḥevrāh ha-’ezrāḥīt bě-’ereẓ-Yiśrāél bi-šěnōt ha-‘eśrīm. ” In : Kesher 28 : 28 – 35. Khisin, Shoshana, 1949 : “ Iz di froy glaykhbarekhtikt ? ” In : Letste nayes, December 30 : 7. – 1950 : “ Di froy ken rateven di velt. ” In : Letste nayes, February 10 : 6. Lamdan, Hana, 1951, “ Der gerangl fun der arbetendiker froy far glaykhhayt in aynkunft-shtayer. ” In : Di heym 5, ( January ) : 21 – 23. Lubitsh, Rut [ Ruth Lubitz ], 1955 : “ Ayndrukn fun muters-kongres. ” In : Der froyen-buletin 3 : [ unpaginated ]. – 1959 : “ Di ershte froyen-farzamlung in Um el fahem. ” In : Der froyen-buletin 1 : 6. Meirson, Golda, 1952 : “ Gezets vegn froyen-arbet. ” In : Di heym 12, October : 9 f. Miron, Dan, 1973 : A Traveler Disguised : The Rise of Modern Yiddish Fiction in the Nineteenth Century. Syracuse : Syracuse University Press. Mitchell, Rosemary, 2000 : Picturing the Past : English History in Text and Image, 1830 – 1870. New York : Oxford University Press. Molodowsky, K[ adya ], 1950 : “ Heym. ” In : Di heym 1, June : 2 – 4. Orchan, Nurit, 2012 : “ Shtetl, Metropolis and In Between : Women ’ s Writing on Life in an Age of Transition, 1881 – 1914. ” In : Shlomo Berger, ed., From the Shtetl to the Metropolis ( Amsterdam Yiddish Symposium 6 ). Amsterdam : Menasseh ben Israel Instituut, 29 – 49. Rojanski, Rachel, 2007 : “ Socialist Ideology, Traditional Rhetoric : Images of East European Jewish Immigrant Women in the Yiddish Socialist Dailies in the United States, 1918 – 1922. ” In : American Jewish History 93 ( 3 ) : 329 – 348. – 2008 : “ The Beginnings of the Yiddish Press in Israel : Ilustrirter vokhnblat. ” In : Zutot : Perspectives on Jewish Culture 5 : 141 – 148. 602 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Shaked, Gershon, 1993 : Ha-sippōret ha-‘ivrīt 1880 – 1980, Vol. 4. Tel Aviv : Hakibbutz Hameuchad. Temkin-Berman, 2008 : ‘ Īr bě-tōkh ‘ īr. Tel Aviv – Jerusalem : Am Oved & Yad Va-shem. Tuchman, Gaye, 1978 : “ Introduction : The Symbolic Annihilation of Women by the Mass Media. ” In : Gaye Tuchman & A. Kaplan Daniels, eds., Hearth and Home, Images of Women in the Mass Media. New York : Oxford University Press, 3 – 38. Tsanin, Mordkhe, 1949 : “ Eyn tog inem lebn fun a froy in Yisroel. ” In : Letste nayes, December 30 : 4. Turniansky, Chava, 1994 : Lāšōn ḥinnūkh wě-haśkālāh bě-mizraḥ ’Ēyrōpāh. Tel Aviv : The Open University. Weissler, Chava, 1998 : Voices of the Matriarchs : Listening to the Prayers of Early Modern Women. Boston : Beacon Press. White, Cynthia, 1970 : Women ’ s Magazines, 1696 – 1968. London : Michael Joseph. Zamir, Israel, 1994 : ’Avī. Yiẓḥāq Baševīs-Zīnger. Tel Aviv : Sifriyat ha-poalim. Aya Elyada Deutsche Übersetzungen jiddischer Literatur Fünf Jahrhunderte interkultureller Austausch und Kontakt In seinem Buch Adventures in Yiddishland ( 2006 ) diskutiert der Kulturwissenschaftler Jeffrey Shandler die besondere – und zugleich etwas widersprüchliche – Situation der jiddischen Sprache und Literatur in den Jahrzehnten seit Ende des Zweiten Weltkriegs. Trotz des dramatischen Rückgangs der Anzahl der Jiddisch-Muttersprachler infolge des Holocausts und aufgrund der beschleunigten Vorgänge sprachlicher Assimilation unter den Überlebenden, spielt diese Sprache auch heute noch eine wichtige Rolle in der kulturellen Welt von Juden und NichtJuden. Beispielhaft sei an dieser Stelle auf die populären Anwendungen des Jiddischen in kulturellen Veranstaltungen, in Volksliteratursammlungen und sogar in Form von ‫צאצקעס‬ ַ ( Schnickschnack ) verwiesen. Die Diskrepanz zwischen einem reduzierten Gebrauch des Jiddischen als gesprochener Sprache auf der einen Seite, und der Zunahme anderer Arten von Beschäftigung mit der Sprache auf der anderen Seite, bezeichnet Shandler mit dem Begriff des Postvernakularen. Zwar beherrschen die an der postvernakularen jiddischen Kultur Beteiligten, laut Shandler, die jiddische Sprache normalerweise nicht ; dennoch haben sie eine emotionale oder ideologische Beziehung zu der Sprache. In den Ausdrucksformen dieser kulturellen Formation hat das Jiddische vor allem eine symbolische Funktion, die eigentlich wichtiger ist als die primäre, kommunikative Funktion der Sprache.1 Obwohl Shandler sich hauptsächlich auf den nordamerikanischen Kontext konzentriert, lassen sich wichtige Charakteristika des postvernakularen Jiddischen auch im Deutschland der letzten sechs Jahrzehnte feststellen. Die Tatsache, dass eine lebendige jiddische Kultur wie sie vor dem Krieg in Osteuropa und in früheren Jahrhunderten auch in Ich bedanke mich bei Dr. Andrea Sinn von der lmu in München für ihre hilfreichen sprachlichen Kommentare. 1 In Shandlers Worten : » What most distinguishes postvernacular Yiddish is its semiotic hierarchy ; unlike vernacular language use, in the postvernacular mode the language’s secondary, symbolic level of meaning is always privileged over its primary level. In other words, in postvernacular Yiddish the very fact that something is said ( or written or sung ) in Yiddish is at least as meaningful as the meaning of the words being uttered – if not more so « ( Shandler 2006 : 22 ). 604 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ den deutschen Ländern existiert hatte, nicht mehr besteht, reduziert auch in diesem Fall in keiner Weise das Interesse von Deutschen – vor allem Nicht-Juden, die die jiddische Sprache nicht beherrschen – an dieser Kultur. Ganz im Gegenteil : Es scheint, als würde dieser Zustand die Nostalgie für eine verlorene Welt wachrufen und die Beschäftigung eines breiten Publikums mit unterschiedlichen Äußerungen des postvernakularen Jiddischen fördern. Zu solcherart Darbietungen gehören u. a. Klezmer-Konzerte und Aufführungen jiddischer Volkslieder, die Publikation populärer Schriften über das Jiddische ( wie die Sammlungen jiddischer Witze und Sprichwörter von Salcia Landmann, die jahrzehntelang großen Erfolg hatten ), Fernseh- und Radiosendungen über osteuropäisch-jüdische Themen, und – nicht zuletzt – das Erscheinen von Werken jiddischer Literatur in deutscher Übersetzung. Während der letzten Jahrzehnte kommt gerade den literarischen Übersetzungen aus dem Jiddischen eine entscheidende Rolle für das › Fortleben ‹ der jiddischen Kultur in Deutschland zu, wo deutsche Fassungen von Yitskhok Leybush Peretz, Sholem Aleichem oder dem älteren ‫ – מעשׂה ־בוך‬um nur ein paar Beispiele zu nennen – die Schätze einer ehemaligen aschkenasischen Kultur für gegenwärtige deutsche Leser zugänglich machen.2 Das Erscheinen solcher Übersetzungen erfährt gerade im heutigen Deutschland zusätzliche Bedeutung, und zwar nicht nur wegen der fehlenden Sprachkompetenz unter den meisten Anhängern des Jiddischen. Ebenso wie andere Manifestationen des postvernakularen Jiddischen sind die Übersetzungen jiddischer Literatur in der zweiten Hälfte des 20. Jahrhunderts mit symbolischen Untertönen gefärbt, die hauptsächlich mit der wechselvollen Geschichte der Sprache und ihrer Sprecher zusammenhängen.3 Drei neue Einflüsse treten in diesem Zusammenhang besonders deutlich hervor : Die Empĳindung von Verlust und Krise, die auf den Holocaust zurückgehen ; das Bewusstsein von Übersetzern und der potentiellen Leserschaft, dass diese Literatur ein Denkmal einer einst blühenden Kultur darstellt ; und das Verspüren einer Notwendigkeit, dieses Denkmal zu bewahren. Alle diese außerliterarischen Bedenken prägen die Veröffentlichung und die Rezeption übersetzter jiddischer Literatur, und beladen die übersetzten Werke mit neuen symbolischen und emotionalen Interpretationen, 2 Hier sind beispielsweise die Übersetzungen von Gernot Jonas und Armin Eidherr zu erwähnen, die in den letzten dreißig Jahren veröffentlicht wurden, sowie die von Ulf Diederichs herausgegebene hochdeutsche Textausgabe vom Mayse-bukh ( 2003 ). 3 So z. B. behauptet Leslie Morris in Bezug auf die Veröffentlichung der deutschen Übersetzung von Bashevis-Singers Gimpel der Narr in 1968, dass der Holocaust eine entscheidende Rolle in der Rezeption dieses Werkes in Deutschland spielte, obwohl Singers Werk eigentlich nicht als › Holocaust literature ‹ klassiĳiziert werden könne. Siehe Morris 1997 : 742. Aya Elyada : Deutsche Übersetzungen jiddischer Literatur 605 die von den ursprünglichen Bedeutungen, welche die Werken einst auf Jiddisch transportierten, gravierend abweichen.4 Neben den eher populären Übersetzungen, die für das allgemeine Publikum bestimmt sind, erschienen in Deutschland seit dem Ende des Zweiten Weltkriegs auch kommentierte Übersetzungen jiddischer Literatur, die sich vor allem an deutsche Sprach- und Literaturwissenschaftler richten. Bei diesen Publikationen handelt es sich vor allem um Werke der altjiddischen Literatur, die ihre Ursprünge im mittelalterlichen und frühneuzeitlichen Aschkenas hatten. Dank der engen sprachlichen Verwandtschaft zwischen dem Altjiddischen und den mittelhochdeutschen Dialekten und nicht zuletzt aufgrund der Tatsache, dass manche dieser aschkenasischen Texte eigentlich Adaptionen mittelalterlicher deutscher Literatur darstellen, erregten diese altjiddischen Werke großes Interesse unter Germanisten. Um die altjiddischen Manuskripte, die im hebräischen Alphabet und nach den Schreibkonventionen des Altjiddischen verfasst sind, für die ( vor allem deutschen ) Germanisten leichter zugänglich zu machen, haben Jiddischforscher in den letzten Jahrzehnten mehrere kritische Textausgaben angefertigt, die von z.T. stark germanisierenden Transkriptionen bis hin zu vollständigen Übersetzungen reichen.5 Das beachtliche Interesse deutscher Germanisten an der älteren jiddischen Sprache und Literatur und das wissenschaftliche Verlangen nach kritischen und doch, aus einer germanistisch-orientierten Perspektive, lesbaren Editionen altjiddischer Texte, haben in den letzten sechzig Jahren entscheidend zur Förderung der Jiddischforschung in Deutschland und zur Etablierung des Faches Jiddistik an deutschen Universitäten beigetragen.6 Wie bereits einleitend argumentiert, können moderne wissenschaftliche und populäre Übersetzungen aus dem Jiddischen ins Deutsche nur unter Berücksichtigung der historischen Gegebenheiten im heutigen Deutschland analysiert werden. In diesem Kontext verdienen der Untergang des Jiddischen als einer lebendigen Sprache, der Beitrag von Germanisten zur Jiddistik in Deutschland, und der lange Schatten des Holocausts als neue Einflussfaktoren besondere Beachtung. Diese Übersetzungen müssen jedoch zugleich auch aus einer diachronischen bzw. geschichtlichen Perspektive betrachtet werden, nämlich als der 4 Für eine ausführliche Diskussion von Übersetzungen jiddischer Literatur ( hauptsächlich ins Englische ) im Rahmen des postvernakularen Kontexts siehe Shandler 2006, Kap. 3. Die Analyse einer Fallstudie im deutschen Kontext bietet Morris 1997 an. 5 Das berühmteste Beispiel ist die 1957 erfolgte Veröffentlichung des sogenannten Cambridge Kodex aus dem Jahre 1382, die auch ein » Dukus Horant « betiteltes Gedicht beinhaltet. Für diese und andere Beispiele, wie auch eine interessante, jedoch polemische Diskussion von solchen Ausgaben vgl. Frakes 1989, Kap. 3 – 4. 6 Siehe Althaus 1968 : 257 – 262 ; sowie auch Aptroot 2001 : 217 – 220. 606 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ jüngste Abschnitt einer jahrhundertenlangen kulturellen Tradition, die mindestens bis in das 16. Jahrhundert zurückreicht. Im Folgenden werden die verschiedenen Kapitel der Geschichte deutscher Übersetzungen jiddischer Literatur in ihrem jeweiligen historischen Kontext kurz vorgestellt, und die Grundlinien der geschichtlichen Entwicklung dieser Tradition nachgezeichnet. Wie schon bei der Diskussion von gegenwärtigen Übersetzungen ist der Begriff der › Übersetzung ‹ auch im folgenden Teil im weitesten Sinne zu verstehen. Er umfasst von Transkriptionen im lateinischen Alphabet über wörtliche Übersetzungen alles bis hin zu freien Bearbeitungen, wie auch alle anderen Formen von Übertragung, die das Ziel hatten, jiddische Literatur für eine deutschsprachige Leserschaft zugänglich zu machen. Die lange Geschichte deutscher Übersetzungen aus dem Jiddischen von der frühen Neuzeit bis zum Ausbruch des Zweiten Weltkriegs lässt sich in drei Abschnitte einteilen. Der erste Abschnitt beginnt in der Mitte des 16. Jahrhunderts mit den ersten gedruckten deutschen Übersetzungen jiddischer Literatur und erstreckt sich bis in die 70er Jahre des 18. Jahrhunderts. In diesem Zeitraum wurde sowohl in Westals auch in Osteuropa ein umfangreiches Korpus jiddischer Literatur veröffentlicht. Dieses Korpus, das heutzutage als die › altjiddische Literatur ‹ bekannt ist, erfasst sowohl religiöse als auch weltliche Schriften, wie zum Beispiel Bibelübersetzungen und -paraphrasen, ethische Bücher zur Sittlichkeit ( ‫ ) מוסר ־ סרים‬und Bücher über Brauchtum und Wohlverhalten ( ‫) מנהגים‬, sowie mittelalterliche Heldengedichte und Ritterromane, Märchen, Sagen und Legenden ( ‫) מעשׂיות‬, historische Erzählungen, Fabeln und Drama.7 Die Werke wurden im › alten literarischen Jiddisch ‹ verfasst, einer überregionalen literarischen Gemeinsprache, die auf dem Westjiddischen basierte. Da sie Dialekteinflüsse ebenso wie den slawischen Bestandteil des Ostjiddischen zum großen Teil vermied, stand diese literarische Sprache, aus linguistischer Sicht, in engerer Verwandtschaft zum Deutschen als das moderne Jiddische, welches aus den osteuropäischen Dialekten entstand. Während der ganzen Epoche der Frühneuzeit trennte der zwischen dem Jiddischen und dem Deutschen existierende sprachliche Unterschied in der Hauptsache die jüdische Minderheit von ihrer christlichen Umgebung. Dementsprechend haben die deutschen Übersetzungen jener Zeit in erster Linie als Brücke über die religiöse Kluft 7 Zur älteren jiddischen Literatur siehe u. a. Shmeruk 1978 und Baumgarten 2005. Aya Elyada : Deutsche Übersetzungen jiddischer Literatur 607 gedient : Sie wurden ausschließlich von christlichen Übersetzern angefertigt und richteten sich an eine christliche Leserschaft. Das beachtliche Korpus frühneuzeitlicher Übersetzungen aus dem Jiddischen, das hauptsächlich von christlichen Theologen, Hebraisten und Orientalisten zusammengetragen wurde, erfasst unterschiedliche Typen von Übersetzungen. Das früheste bekannte Beispiel für eine eigenständige Publikation einer solchen Übertragung stellt die deutsche Fassung des jiddischen Heldengedichts ‫ שמואל ־ בוך‬dar, die von dem Konvertiten Paulus Aemilius im Jahre 1562 veröffentlicht wurde.8 In anderen Fällen handelt es sich um die Aufnahme übersetzter Texte in Anthologien und in literarische Zeitschriften, wie z. B. in Johann Christoph Wagenseils Belehrung der jüdisch-teutschen Red- und Schreibart ( 1699 ) oder in Johann Christian Schöttgens Zeitschrift Der Rabbiner ( 1742 ),9 oder auch um die Einfügung von kürzeren übersetzten Texten oder Textpassagen in eine deutsche Abhandlung, beispielsweise in Johann Jacob Schudts chronistisch-historiographischen und ethnographischen Werk Jüdische Merckwürdigkeiten ( 1714 ). Die christlichen Übersetzungen vom Jiddischen ins Deutsche stellen ein ungewöhnliches Phänomen in der allgemeinen Landschaft frühneuzeitlicher Übersetzungen dar. Während der Wunsch, die eigene Sprache und Kultur durch die › Übernahme ‹ einer hochangesehenen fremden Literatur zu veredeln und zu fördern, die verbreitete Motivation für die Übersetzung aus einer anderen Sprache darstellte, wurde die jiddische Sprache und Literatur von deutschen Gelehrten üblicherweise als geringwertig eingeschätzt, ja sogar verachtet. Das Jiddische wurde als › verdorbenes Deutsch ‹ und seine Literatur als › rabbinischer Aberglaube ‹ stigmatisiert. Obwohl man hier und da positive Äußerungen über die jiddische Literatur ĳinden kann, sind sie eher die Ausnahme. Die Adjektive » lächerlich «, » albern « und » abgeschmackt « ĳinden sich zahlreich und ebenso häuĳig in christlichen Darstellungen jiddischer Literatur wie die Behauptung, dass jiddische Texte vor allem Lachen und Verachtung unter christlichen Lesern erwecken würden. In der Tat war es nicht ungewöhnlich, dass christliche Übersetzer in den Vorreden zu ihren Werken zugaben, dass der Leser sich wahrscheinlich wundere, 8 Der Titel lautet : Die zway ersten Bücher der Künig / wölche Samuelis genandt werden [ … ] auß dem Hebraischen buchstaben mit fleiß / in unser Hochteütsch gebracht / durch Paulum Aemilium Romanum, der Hebraischen sprach Professorn zu Ingolstat. 9 Für eine interessante Diskussion von Schöttgens Zeitschrift, und insbesondere von seiner Übertragung von fünf Erzählungen aus dem Mayse-bukh, siehe Riemer 2007. Auf S. 15 – 23 gibt es einen Nachdruck der übersetzten Texte. Schon 1934 hat Jacob Shatzky auf Schöttgens Übertragungen hingewiesen, jedoch ohne eine weiterführende Diskussion oder Textanalyse anzubieten. Siehe Shatzky 1934. 608 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ warum sie die Mühe überhaupt auf sich genommen hatten, solche offenbar nutzlosen Texte zu übersetzen.10 Schenkt man den Äußerungen der Übersetzern selbst Glauben, die auf den Titelblättern ihrer Werke, in Widmungen oder in den Vorreden festgehalten sind, erfolgten die Übersetzungen jiddischer Texte aus einer Vielzahl von Gründen : Ihrer Meinung nach könnten die Texte nicht nur zur schlichten Unterhaltung, sondern auch zum Unterrichten der jiddischen Sprache oder gar als Hilfsmittel für Theologie-Studenten dienen, um deren Beschäftigung mit dem Hebräischen und der heiligen Schrift zu erleichtern.11 Vor allem jedoch wurden die Übersetzungen jiddischer Literatur als ein wichtiges und nützliches Mittel für Christen angesehen, um die geistliche und kulturelle Welt der zeitgenössischen aschkenasischen Juden besser kennenzulernen. Zum einen, so wurde behauptet, könnten sich Informationen über den Glauben und die Gebräuche der Juden, die in ihrer Literatur zu ĳinden seien, als durchaus nützliches Hilfsmittel für eine professionelle und gut fundierte Missionsarbeit unter den Juden erweisen. Indem man die Schriften der Juden selbst für anti-jüdische Polemik benutze, könnte diese ferner einen wichtigen Beitrag zur Wiederlegung des Judentums beisteuern. Zum anderen, so glaubte man, würde das Lesen jiddischer Literatur es den Christen ermöglichen, in die abgeschlossene jüdische Welt einzudringen und ihre Geheimnisse zu enthüllen, um so eine bessere Kontrolle über diese Minderheit zu gewinnen. Die verbreitete Meinung, dass tiefliegender Hass der christlichen Religion und ihren Anhängern gegenüber den Kern des jüdischen Glaubens und Rituals darstellte, regte christliche Theologen an, nach effektiven Mitteln zur Verteidigung des Christentums vor der angeblichen jüdischen Gefahr zu suchen. Aus ihrer Sicht bestand diese Gefahr vor allem in den Lästerungen und anti-christlichen Ausdrücken, die sich angeblich in der jüdischen Literatur versteckten. Die weit verbreitete Vorstellung, das Jiddische sei eine jüdische › Geheimsprache ‹, wie auch die Tatsache, dass die jiddische Literatur vor allem zur privaten Sphäre des jüdischen Heims gehörte, machten das Lesen jiddischer Texte, das durch die deutschen Übersetzungen ermöglicht wurde, zu einem wichtigen Mittel für Christen, um jüdische Lästerungen und anti-christliche Ausdrücke auf effektive Weise aufzudecken und zu bekämpfen.12 10 Für eine ausführliche Diskussion über die Einstellung christlicher Gelehrter zur jiddischen Literatur in der Frühneuzeit siehe Elyada 2012, v. a. Kap. 2. 11 Zu diesem Punkt siehe ebd., Kap. 4. 12 Für eine ausführliche Diskussion dieses Themas mit mehreren Beispielen siehe ebd., Kap. 1 – 3. Aya Elyada : Deutsche Übersetzungen jiddischer Literatur 609 Seit den letzten Jahrzehnten des 18. Jahrhunderts, als immer weitere Kreise deutscher Juden ihre jiddische Muttersprache durch die deutsche Sprache ersetzten, stellte der sprachliche Unterschied zwischen der jiddischen und der deutschen Sprache, der über Jahrhunderte die Trennung von Juden und Nicht-Juden zum Ausdruck gebracht hatte, schließlich auch Kennzeichen einer Spaltung innerhalb der jüdischaschkenasischen Welt dar. Zum einen wirkte die sprachliche Kluft als Trennlinie zwischen den deutschen Juden und den Juden Osteuropas, wo sich während des 19. Jahrhunderts eine neue, auf den osteuropäischen jiddischen Mundarten aufbauende literarische Sprache ( das › moderne ‹ literarische Jiddische ) entwickelte. Zum anderen wirkte sie als Trennlinie zwischen verschiedenen Gruppen innerhalb des deutschen Judentums, die sich die deutsche Kultur in unterschiedlichen Tempi und zu unterschiedlichen Graden angeeignet hatten. In dem folgenden Jahrhundert, von ca. 1780 bis etwa 1890, gab es unter nicht-jüdischen deutschen Gelehrten, vor allem Germanisten, zwar immer noch Interesse am Jiddischen und seiner Literatur. Nun waren jedoch literarische Übersetzungen aus dem Jiddischen hauptsächlich ein inner-jüdisches Phänomen, d. h. jüdische Autoren übersetzten Werke altjiddischer Literatur für ihre Religionsgenossen. Die Pioniere dieser literarischen Aktivität waren die Anhänger der Haskala. Wie zuvor die christlichen Hebraisten betrachteten auch die Maskilim die jiddische Sprache und Literatur als eine › korrupte ‹ und sogar › primitive ‹ kulturelle Erscheinung. Ihre Bemühungen zielten darauf ab, das Jiddische durch die deutsche Sprache zu ersetzen und die jiddische Literatur in ihrer traditionellen Form abzuschaffen. Um das zu erreichen, versuchten sie unter anderem, neue und › verbesserte ‹ Versionen jiddischer literarischer Werke anzufertigen. Die Autoren der maskilischen Fassungen altjiddischer Texte, wie z. B. das Purimspiel ‫ער רעטונג‬ ‫ ( דער יודן דורך אסתר אונד מרדכי‬1780 ) oder die schon zu jener Zeit als Klassiker bekannte ‫ צאינה ־ וראינה‬, von der einige Adaptionen während des 19. Jahrhunderts erschienen, gaben nicht nur vor, diese Texte ins » rein Deutsche « zu übersetzen ( wenn auch des Öfteren mit hebräischen Buchstaben ).13 Vielmehr änderten sie auch den Inhalt der jiddischen Werke entsprechend der maskilischen kulturellen und erzieherischen Weltanschauung ab.14 13 So z. B. behauptet der Herausgeber vom erwähnten Purimspiel das Werk sei ‫„ אין דער‬ ” ‫ ריינע אויף רי"טיגע טייטשי שרא"ע ] ! [ איבר גיזעציט אונד קוריגירהט‬. 14 Für eine ausführliche Diskussion von den maskilischen Fassungen und Umarbeitungen der Tsene-rene im 19. Jahrhundert siehe in erster Linie Turniansky 2009, wie auch Turniansky 1977. Zur Bearbeitung des Purimspiels von Esther und Mordechai aus dem Jahr 1780 siehe Shmeruk 1978 : 158 – 162. Über die Einstellung der Maskilim zum Jiddischen siehe hauptsächlich Römer 1995, und Grossman 2000 a, Kap. 2. 610 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Weitere wichtige Impulse zur Übersetzung jiddischer Literatur gingen auch vom neuen, während des 19. Jahrhunderts in Deutschland entstandenen Bereich der jüdischen Volkskunde aus. Beeinflusst von dem Programm der Wissenschaft des Judentums einerseits, das sich bereits in den ersten Jahrzehnten des Jahrhunderts für das Studium des Judentums im weitesten Sinne und mit Hilfe wissenschaftlicher Methodologie aussprach, und von dem Aufstieg der Volkskunde als wissenschaftlicher Disziplin andererseits, widmeten sich nun deutschjüdische Gelehrte der systematischen Erforschung der jüdischen geistig-kulturellen Überlieferung, der Alltagskultur und des Volksglaubens. Im Rahmen ihrer Bemühungen, bisher von Forschern übersehene oder vernachlässigte Gebiete jüdischer Geschichte und Kultur aufzudecken, richteten diese Gelehrten ihre Aufmerksamkeit auch auf das kulturelle Erbe und die Volkskultur des aschkenasischen Judentums. Dies schloss die Betrachtung jiddischer literarischer Werke, Volkslieder und Redewendungen ein. Ihren Höhepunkt erreichte diese wissenschaftliche Aktivität mit der Gründung der » Gesellschaft für jüdische Volkskunde « unter der Leitung des Hamburger Rabbiners Max Grünwald, am Ende des 19. Jahrhunderts. Die Zeitschrift der Gesellschaft, die Mitteilungen zur jüdischen Volkskunde ( erschien von 1898 bis 1929 ),15 enthielt umfangreiche Materialsammlungen auf Jiddisch, wobei die Texte fast durchweg in lateinischer Umschrift und mit stark normalisierter Schreibweise gedruckt wurden. Ein früheres renommiertes Beispiel für die Arbeit deutsch-jüdischer Volkskundler bildet das Werk von Abraham Moses Tendlau, in erster Linie seine Sprichwörter und Redensarten deutsch-jüdischer Vorzeit [ ... ] nach Wort und Sinn erläutert ( 1860 ) und Das Buch der Sagen und Legenden jüdischer Vorzeit ( 1842, mit späteren, erweiterten Auflagen ). Eine der populärsten Anthologien jüdischer Sagen im 19. Jahrhundert, enthält Das Buch der Sagen und Legenden auch mittelalterliche und frühneuzeitliche Sagenstoffe, samt Übersetzungen und Nachdichtungen von Geschichten aus dem ‫ מעשׂה ־בוך‬und anderen jiddischen Werken. Wie Tendlau in dem Vorwort klar macht, sei sein Ziel solche jüdischen Geschichten nicht nur » einer drohenden Vergessenheit zu entreißen «, sondern auch » in einer modernen Gestalt « dem Publikum anzubieten. Dementsprechend verfasste er neue Bearbeitungen alter Texte und erstellte einen wissenschaftlichen Apparat mit Anmerkungen und Quellenangaben. 15 1898 – 1905 erschien die Zeitschrift unter dem Titel Mitteilungen der Gesellschaft für Jüdische Volkskunde. Seit 1923 wurde sie als Jahrbuch für jüdische Volkskunde veröffentlicht. Aya Elyada : Deutsche Übersetzungen jiddischer Literatur 611 Die zweite Epoche in der Geschichte deutscher Übersetzungen aus dem Jiddischen ( ca. 1780 bis 1890 ) unterscheidet sich von der ersten, frühneuzeitlichen Epoche in zwei entscheidenden Punkten. Erstens, auch wenn die frühneuzeitlichen, christlichen Übersetzungen aus dem Jiddischen einen unkonventionellen Fall deutscher Übersetzungsaktivität darstellen, da sie die Literatur einer marginalisierten und sogar verachteten Kultur in die herrschende, und in mehrerlei Hinsichten konkurrierende Kultur importierten, sind sie dennoch dem gängigen Muster von Übersetzungstätigkeit, nämlich dem einer inter-groupÜbersetzung, gefolgt. Die Texte, welche die christlichen Übersetzer an ihre eigene Kultur heranführten, waren schließlich die literarischen Produkte einer kulturell und religiös anders ausgerichteten Gruppe. Mit der Verlagerung der Übersetzungstätigkeit von christlichen in jüdische Hände änderte sich die Intention deutscher Übersetzungen aus dem Jiddischen grundlegend, und stellte nun das eher unkonventionelle Phänomen von › Selbstübersetzung ‹ dar : In diesem Fall von intragroup-Übersetzung, haben die jüdischen Gelehrten in der Tat ihre eigene Kultur für eine jüdische Leserschaft übersetzt, und zwar aus dem herkömmlichen Jiddischen in die von ihnen kurz zuvor erworbene deutsche Sprache. Der zweite Unterschied zwischen der früheren und der späteren Epoche bezieht sich auf den historischen Zusammenhang, der sich um 1780 radikal änderte. Während die früheren Übersetzungen jiddischer Literatur hauptsächlich im Kontext des frühneuzeitlichen theologischen und polemischen Interesses an der jüdischen Kultur unter christlichen Gelehrten zu verstehen sind, müssen die späteren Übersetzungen im Zusammenhang mit den großen Transformationen analysiert werden, welche die deutsch-jüdische Gemeinschaft seit dem späteren 18. Jahrhundert und während des 19. Jahrhunderts erlebte.16 Die Entstehung der Haskala, Modernisierung und Säkularisierung, die Versuche, sich in die deutsche Gesellschaft und Kultur zu integrieren, und der Kampf um politische Emanzipation – all diese tiefgreifenden Entwicklungen haben jüdisches Leben in Deutschland grundlegend umgestaltet, und alle Aspekte der deutsch-jüdischen kulturellen Aktivität im › langen 19. Jahrhundert ‹, einschließlich der Beschäftigung mit und Übersetzungen von jiddischer Literatur, entscheidend geprägt. Ein zweiter Wendepunkt, um das Jahr 1890, markiert den Anfang des dritten Abschnitts in der Geschichte deutscher Übersetzungen aus dem Jiddischen, der bis 1938 andauerte. In diesem Zeitraum wurden 16 Über die tiefgreifenden Veränderungen der Lebenssituation der Juden in Deutschland seit dem späten 18. Jahrhundert gibt es eine umfangreiche Forschungsliteratur. Siehe u. a. Sorkin 1987, und Volkov 2006, v. a. Part iii. 612 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Übersetzungen jiddischer Literatur immer noch hauptsächlich von jüdischen Übersetzern angefertigt und waren für eine jüdische Leserschaft bestimmt, und müssen folglich im Rahmen der Bemühungen deutscher Juden verstanden werden, infolge der gewaltigen Transformationen des 19. Jahrhunderts für sich eine neue Identität als Deutsche und Juden zu schaffen. Dennoch stellt die Jahrhundertwende einen bedeutenden Wendepunkt dar, im Wesentlichen aus drei Gründen : das Erscheinen moderner jiddischer Literatur in deutscher Übersetzung ; das zunehmende Interesse deutscher Juden am osteuropäischen Judentum ; und die Neubewertung des Jiddischen durch deutsch-jüdische Intellektuelle. Obwohl auch noch zwischen 1890 und 1938 Werke der älteren jiddischen Literatur ins Deutsche übersetzt wurden,17 wurde diese Gattung schnell von derjenigen der Übersetzungen moderner jiddischer Literatur überholt. Diese umfangreiche säkulare Literatur, die während der letzten Jahrzehnte des 19. Jahrhunderts in Osteuropa entstanden war, erlangte insbesondere durch die Werke der drei › klassischen Autoren ‹ ( ‘ ‫קלאסיקער‬ ַ ‫ די‬, ), Mendele Moykher-Sforim, Sholem Aleichem, und Yitskhok Leybush Peretz Berühmtheit.18 Mit der wachsenden Beliebtheit dieser und anderer osteuropäisch-jüdischen Autoren unter deutschsprachigen Lesern erhielt die kulturelle Tradition deutscher Übersetzungen aus dem Jiddischen eine auffällige geographische Dimension, welche die durch die Übersetzungen altjiddischer Literatur erreichte geschichtliche Dimension ergänzte. Seither haben deutsche Übersetzungen aus dem Jiddischen nicht nur als eine Brücke zwischen der deutsch-jüdischen Vergangenheit und Gegenwart gedient, sondern in erster Linie eine Verbindung zwischen den aschkenasisch-jüdischen Kulturen in Ost- und Westeuropa hergestellt. Auf diese Weise leisteten sie einen wichtigen Beitrag zum transkulturellen Dialog, der sowohl eine zeitliche, als auch eine räumliche Kluft überbrückte. Die Nachfrage nach osteuropäischer jiddischer Literatur in deutscher Übersetzung muß als wesentlicher Bestandteil des allgemeinen ansteigenden Interesses deutscher Juden an den sogenannten Ostjuden, ihrer Kultur und ihren Lebensarten interpretiert werden. Dieses gesteigerte Interesse entsprang zum einen der persönlichen Begegnung deutscher Juden mit osteuropäischen jüdischen Einwanderern, die 17 Ein bekanntes Beispiel stellen die Übersetzungen von Bertha Pappenheim dar, die deutsche Fassungen von Glikls Memoiren ( Die Memoiren der Glückel von Hameln, 1910 ), dem Mayse-bukh ( Allerlei Geschichten, 1929 ), und der Tsene-rene ( Zeenah u-Reenah : Frauenbibel, 1930 ) veröffentlichte. Zum Thema Pappenheim und das Jiddische siehe die interessante Diskussion in Loentz 2007, Kap. 1. 18 Zur Entstehung moderner jiddischer Literatur im Allgemeinen und zu den drei Klassikern im Besonderen, siehe u. a. Frieden 1995 und Miron 1996. Aya Elyada : Deutsche Übersetzungen jiddischer Literatur 613 aufgrund von Not und infolge zahlreicher Pogrome nach Deutschland geflohen waren.19 Zum anderen aber war auch die Krise, in welche die alteingesessene, liberal-orientierte deutsch-jüdische Kultur um die Jahrhundertwende geraten war, für diese Entwicklung mitverantwortlich. Da die Symbiose einer deutschen kulturellen und nationalen mit einer distinkten jüdischen Identität, wie sie von liberalen Juden während des 19. Jahrhunderts gefördert worden war, sowohl durch den modernen Antisemitismus als auch den jüdischen Nationalismus zunehmend in Frage gestellt worden war, begannen deutsch-jüdische Intellektuelle, nach einer alternativen Identität zu suchen. Während dieses Prozesses richteten viele von ihnen ihren Blick nach Osten, wo sie bei den jiddischsprachigen Juden eine › authentische ‹ aschkenasische Kultur zu ĳinden glaubten.20 Durch die Übertragung osteuropäisch-jiddischer Literatur ins Deutsche beabsichtigten die Übersetzer, die kulturelle Welt der Ostjuden für deutsche Juden bekannter und verständlicher zu machen.21 Zugleich vermittelten sie ihren Lesern bestimmte Vorstellungen osteuropäischer jüdischer Kultur. Auf diese Weise boten sie ein alternatives Model jüdischer Identität an, von dem ausgehend die deutsch-jüdische Gemeinschaft, in einer Zeit zunehmender Unsicherheit hinsichtlich der eigenen Position innerhalb der deutschen Gesellschaft und Kultur, ihre eigene Identität und eigene Prioritäten gestalten konnte.22 Schließlich stellt der Zeitraum zwischen 1890 und 1938 ein neues Kapitel in der Geschichte deutscher Übersetzungen aus dem Jiddischen dar, da sich in diesem Zeitraum Veränderungen in der Bewertung der jiddischen Sprache von Seiten der deutschen Juden bemerkbar machten. Neben den negativen Beurteilungen der Sprache, die unter deutsch-jüdischen Intellektuellen spätestens seit den letzten Jahrzehnten des 18. Jahrhunderts verbreitet waren, meldeten sich seit 1890 auch andere Stimmen zu Wort, die eine ambivalentere Einstellung zum Jiddischen erkennen lassen. Manche Gelehrte, ein prominentes Beispiel ist Nathan Birnbaum, der mehrere Werke jiddischer Literatur ins Deutsche übersetzte, verteidigten das Jiddische als eine Kultursprache oder 19 Hier ist auch die Begegnung deutsch-jüdischer Soldaten mit jüdischen Gemeinden in Osteuropa während des Ersten Weltkriegs zu erwähnen. Siehe z. B. Midgley 2005. 20 Für eine grundlegende Studie zur Begegnung deutscher Juden mit den Juden Osteuropas s. Aschheim 1982. 21 So z. B. wurde es in der Zeitschrift Ost und West behauptet, in der auch Übersetzungen osteuropäischer jiddischer Literatur erschienen sind : » Es ist eine der wesentlichsten Aufgaben unserer Zeitschrift, zwischen dem jüdischen Osten und dem westlichen Judentum Brücken zu schlagen und dem einen das Verständnis für das Wesen der anderen zu erleichtern « ( B[ernfel]d 1901 : 673 f ). 22 Für interessante Analysen von speziĳischen Fallstudien siehe Grossman 2000 b, Grossman 2009 und Groiser 2005. 614 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ propagierten es sogar als eine jüdische Nationalsprache. Die Einstellung des individuellen Übersetzers zur jiddischen Sprache war meistens symptomatisch für seine Zugehörigkeit zu einer bestimmten ideologischen Partei – sei es der Neo-Orthodoxie, des liberal-orientierten Judentums, des Zionismus oder des Diaspora-Nationalismus, und übte einen grundlegenden Einfluß auf die Ziele der verschiedenen Übersetzungen und auf die von jedem Übersetzer angewandten Strategien aus.23 Die ersten Jahrzehnte des 20. Jahrhunderts haben in Deutschland eine bis dahin beispiellose Blüte jiddischer Kultur hervorgebracht. Das große Interesse deutscher Juden an der Kultur der Ostjuden, die Anwesenheit osteuropäischer jüdischer Intellektueller in Deutschland und die Entstehung des Jiddischen als ein prominentes literarisches Medium unter den Juden Osteuropas haben neue Impulse für eine intensive literarische und kulturelle Auseinandersetzung mit dem Jiddischen und seiner kulturellen Produktion gegeben. Diese fand ihren Ausdruck u. a. in der Erforschung des Jiddischen an deutschen Universitäten, in der Veröffentlichung jiddischer Literatur und in den jiddischen Theateraufführungen.24 Die zahlreichen deutschen Übersetzungen jiddischer Novellen, Erzählungen, Volkslieder und Theaterstücke, die zu dieser Zeit erschienen, stellten nicht nur eine deutliche Äußerung dieser kulturellen Blüte dar, sondern haben sie auch weitgehend unterstützt. Als Vermittler von alten und modernen jiddischen literarischen Produkten an eine deutschsprachige, hauptsächlich jüdische Leserschaft, bildeten die Übersetzungen einen wesentlichen Bestandteil der sogenannten › jüdischen Renaissance ‹ im Deutschland der Weimarer Republik. Noch bis zum Ende der dreißiger Jahre sollten diese Werke weiterhin die kulturelle Welt der deutschen Juden bereichern und ausformen.25 Als zwei Sprachen, die » fast dasselbe, aber nicht ganz « sind ( almost the same, but not quite ), um den bekannten Ausdruck Homi Bhabhas anzuwenden, stellen das Jiddische und das Deutsche wie auch die Wechselbeziehungen zwischen ihnen einen faszinierenden Fall hinsichtlich des interkulturellen Kontakts und Austausches dar. Die sprachliche 23 Für Beispiele siehe Grossman 2000 b und Grossman 2009. 24 Über die Blüte der jiddischen Kultur in Deutschland in den ersten Jahrzehnten des 20. Jahrhunderts siehe hauptsächlich Brenner 1996, v. a. Kap. 7, und Bechtel 1997. Zum damaligen Aufschwung der Jiddischforschung an deutschen Universitäten vgl. Althaus 1968 : 251 – 255 und Aptroot 2001 : 214 – 217. 25 Unter den Übersetzungen, die in Deutschland noch während der letzten Jahre vor Ausbruch des Zweiten Weltkriegs erschienen, sind beispielsweise die in Berlin veröffentlichten Sammlungen von Ludwig Strauss, Jüdische Volkslieder ( 1935 ) und Chassidische Erzählungen ( 1936 ) zu erwähnen. Aya Elyada : Deutsche Übersetzungen jiddischer Literatur 615 Verwandtschaft zwischen den beiden bildet allerdings nur einen Aspekt dieser komplexen Beziehung.26 Aufgrund ihrer territorialen Nähe und einer langen Geschichte wechselseitiger Beeinflussung hatte die Begegnung zwischen dem Jiddischen und dem Deutschen, die in den verschiedenen historischen Kontexten bedeutende Änderungen erlebte, weitreichende Auswirkungen für die Entwicklung und Ausformung beider Kulturen.27 Mit diesem Aufsatz hatte ich die Absicht, die Grundzüge der langen und abwechslungsreichen Geschichte deutscher Übersetzungen jiddischer Literatur nachzuzeichnen und die Kontinuitäten bzw. Veränderungen ihrer Entwicklung über den Zeitraum von fünf Jahrhunderten hervorzuheben. In dem genannten Zeitraum erwuchs aus der Arbeit jüdischer und nicht-jüdischer Übersetzer ein umfangreiches und vielfältiges literarisches Korpus, das sowohl die Leistungen der älteren als auch der modernen jiddischen Literatur in der deutschen Sprache umfasst. In allen ihren unterschiedlichen Ausformungen haben diese Übersetzungen deutschen Lesern zahlreiche Werke der jiddischen Literatur zugänglich gemacht und einen wichtigen Beitrag zum literarischen Austausch zwischen dem Jiddischen und anderen europäischen Sprachen und Kulturen geleistet. In gleicher Weise jedoch haben sie bestimmte Vorstellungen der in älteren Zeiten oder an entfernten Orten existenten jiddischen Kultur für deutsche Juden und Nicht-Juden konstruiert. Aus diesen Gründen stellen die deutschen Übersetzungen aus dem Jiddischen – von der Arbeit frühneuzeitlicher christlicher Hebraisten bis hin zu den › postvernakularen ‹ Textfassungen in Deutschland während der letzten Jahrzehnte – einen Angelpunkt der Jahrhunderte währenden jiddisch-deutschen Begegnung dar, die noch längst nicht an ihr Ende gelangt ist. 26 Wie der Sprach- und Literaturwissenschaftler Jerold C. Frakes feststellte : » [ T ]hough genetically the two [ languages ] could hardly be more closely aligned, linguistic afĳinity is a simple – and simply insufĳicient – marker of the complex historical, cultural, artistic, and even religious exchanges which have occurred over the last millennium. «, s. Frakes 2009 : 1. 27 In den letzten Jahren gab es in der Forschung ein zunehmendes Interesse an der Frage nach den literarischen und kulturellen Beziehungen zwischen dem Jiddischen und den anderen europäischen Sprachen, vor allem dem Deutschen. Siehe u. a. die Beiträge in Sherman und Robertson 2005 und in Frakes und Dauber 2009. 616 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Zitierte Literatur Althaus, Hans Peter, 1968 : » Die Erforschung der jiddischen Sprache. « In : Ludwig E. Schmitt, Hg., Germanische Dialektologie : Festschrift für Walther Mitzka. Zeitschrift für Mundartforschung nf 5 ( 1 ) : 224 – 263. Aptroot, Marion, 2001 : » Jiddischforschung – eine deutsche Tradition. « In : Jahrbuch der Heinrich-Heine-Universität 1994 – 1997 : 207 – 220. Aschheim, Steven E., 1982 : Brothers and Strangers : The East European Jew in German and German Jewish Consciousness, 1800 – 1923. Madison : University of Wisconsin Press. Baumgarten, Jean, 2005 : Introduction to Old Yiddish Literature. Edited and translated by Jerold C. Frakes. New York : Oxford University Press. Bechtel, Delphine, 1997 : » Cultural Transfers between › Ostjuden ‹ and › Westjuden ‹ : German-Jewish intellectuals and Yiddish Culture, 1897 – 1930. « In : Leo Baeck Institute Year Book 42 : 67 – 83. B[ernfel]d, [ Simon ], 1901 : » Die Transformation der russischen Juden. Vier Generationen. « In : Ost und West 1 ( 9 ) : 673 f. Brenner, Michael, 1996 : The Renaissance of Jewish Culture in Weimar Germany. New Haven : Yale University Press. Elyada, Aya, 2012 : A Goy Who Speaks Yiddish : Christians and the Jewish Language in Early Modern Germany. Stanford : Stanford University Press. Frakes, Jerold C., 1989 : The Politics of Interpretation : Alterity and Ideology in Old Yiddish Studies. Albany : State University of New York Press. – 2009 : » Introduction : Permeable Cultural Borders, Yiddish-German Encounters. « In : Jerold C. Frakes und Jeremy Dauber, Hg., Between Two Worlds : Yiddish-German Encounters. ( Studia Rosenthaliana 41. ) Leuven : Peeters, 1 – 12. Frieden, Ken, 1995 : Classic Yiddish Fiction : Abramovitsh, Sholem Aleichem, and Peretz. Albany : State University of New York Press. Groiser, David, 2005 : » Translating Yiddish : Martin Buber and David Pinski. « In : Joseph Sherman und Ritchie Robertson, Hg., The Yiddish Presence in European Literature : Inspiration and Interaction. London : Modern Humanities Research Association and Maney Publishing, 45 – 72. Grossman, Jeffrey A., 2000 a : The Discourse on Yiddish in Germany : From the Enlightenment to the Second Empire. Rochester, ny : Camden House. – 2000 b : » From East to West : Translating Y. L. Peretz in Early Twentieth-Century Germany. « In : Yaakov Elman und Israel Gershoni, Hg., Transmitting Jewish Traditions : Orality, Textuality, and Cultural Diffusion. New Haven – London : Yale University Press, 278 – 309. – 2009 : » Sholem Aleichem and the Politics of German-Jewish Identity : Translations and Transformations. « In : Jerold C. Frakes und Jeremy Dauber, Aya Elyada : Deutsche Übersetzungen jiddischer Literatur 617 Hg., Between Two Worlds : Yiddish-German Encounters. ( Studia Rosenthaliana 41. ) Leuven : Peeters, 81 – 110. Loentz, Elizabeth, 2007 : Let Me Continue to Speak the Truth : Bertha Pappenheim as Author and Activist. Cincinnati : Hebrew Union College Press. Midgley, David, 2005 : » The Romance of the East : Encounters of GermanJewish Writers with Yiddish-Speaking Communities, 1916 – 27. « In : Joseph Sherman und Ritchie Robertson, Hg., The Yiddish Presence in European Literature : Inspiration and Interaction. London : Modern Humanities Research Association and Maney Publishing, 87 – 98. Miron, Dan, 1996 : A Traveler Disguised : The Rise of Modern Yiddish Fiction in the Nineteenth Century. Syracuse : Syracuse University Press. Morris, Leslie, 1997 : » 1968 : The Translation of Isaac Bashevis Singer ’ s Gimpel der Narr Appears in the Federal Republic of Germany. « In : Sander L. Gilman und Jack Zipes, Hg., The Yale Companion to Jewish Writing and Thought in German Culture, 1096 – 1996. New Haven : Yale University Press, 742 – 748. Riemer, Nathanael, 2007 : » Unbekannte Bearbeitungen des Ma’assebuches. « In : Jiddistik-Mitteilungen 38 : 1 – 23. Römer, Nils, 1995 : Tradition und Akkulturation : Zum Sprachwandel der Juden in Deutschland zur Zeit der Haskalah. Münster – New York : Waxmann. Shandler, Jeffrey, 2006 : Adventures in Yiddishland : Postvernacular Language and Culture. Berkeley : University of California Press. Shatzky, Yankev, 1934 : » Dos Mayse-bukh in a daytsher tsaytshrift fun 18tn yorhundert. « In : yivo-bleter 6 ( 1 ) : 188. Sherman, Joseph und Robertson, Ritchie, Hg., 2005 : The Yiddish Presence in European Literature : Inspiration and Interaction. London : Modern Humanities Research Association and Maney Publishing. Shmeruk, Chone, 1978 : Sifrūt yīdīš : pěrāqīm lě-tōlědōteyhā. Tel Aviv : Tel Aviv University. Sorkin, David, 1987 : The Transformation of German Jewry, 1780 – 1840. New York : Oxford University Press. Turniansky, Chava, 1977 : » Iberzetsungen un baarbetungen fun der Tsenerene. « In : Shmuel Werses, Nathan Rotenstreich, und Chone Shmeruk, Hg., Sefer Dov Saddān : qōveẓ meḥqārīm mugāšīm lō bi-mělō’t lō 75 šānāh. Jerusalem – Tel Aviv : Hakibbutz Hameuchad, 165 – 190. – 2009 : » Yayin ḥādāš bě-qanqan yāšān : girsā ’ ōt maśkīliyyōt šel Tsene-rene. « In : David Assaf und Ada Rapoport-Albert, Hg., Yāšān mipnēy ḥādāš : šay lě-’ Immānū ’ ēl Etkes, vol. 2, Jerusalem : Zalman Shazar Center, 313 – 344. Volkov, Shulamit, 2006 : Germans, Jews, and Antisemites : Trials in Emancipation. New York : Cambridge University Press. Shlomo Berger Religion, Culture, Literature On Yehoyesh ’ s Preface to His Yiddish Bible Translation The publication of Yehoyesh ’ s Bible translation in 1926 is certainly a prominent moment in modern Yiddish culture. The Yiddish reading public was offered a version of the Bible that could serve as an exemplary text of modern Yiddish secular literature and culture. The translation of this holy ( or ‘ holy ’ ) text of Judaism could function as a storehouse of language conventions, a guidebook for questions of style, suggesting modes of usages which would enrich new and original Yiddish written texts and in general enhance the status of modern Yiddish. Essentially detached from overt religious connotations, Yehoyesh ’ s Yiddish Bible is a literary masterpiece that could also have served as a base text of a Yiddish national literature. 1. Vernacular Bibles and Their Cultural Roles Translations of the Bible have served as initiating texts of literatures and cultures in various European vernaculars. Indeed, in Protestant Europe translations of the Bible were important landmarks in the history of a language and its subsequent literature : Luther ’ s Bible is a famous and celebrated focal point of German literature ; the King James Bible is a celebrated moment of modern English letters, and the Dutch States ’ Bible is the ofĳicial text of the Dutch Republic, its Protestant churches and Dutch letters. Once these translations appeared, it was as if God has spoken in German, English and Dutch. Hebrew remained important, if at all, only to theologians wishing to pursue an academic study of the Bible. In all cases, the Bible in the vernacular performed a dual function : it served both as the authoritative religious text of the local culture, and, later on, as an exemplum for a nascent literature in these vernaculars.1 The idea of exploiting the Bible as a founding text of Yiddish culture had already been expressed by Y. L. Peretz in his speech delivered at the 1908 Czernowitz conference.2 He said : 3 1 2 3 See Burke 2004 : 102 – 106. On the conference, see Fishman 2008 : 384 – 385 ; Weiser and Fogel 2010. Peretz ’ s text was originally published in Nathan Birnboym ’ s Vokhnblat 2 ( Czernowitz 620 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ ‫לאגן די איבער־‬ ָ ‫ארש‬ ָ ‫אײך דעריבער‬ ַ ‫מיר ווילן‬ ‫זעצונג ון ַאלע ווירקלעכע קולטור ־ גיטער ון‬ ‫ איבער‬,‫רגאנגענהייט‬ ַ ‫פא‬ ַ ‫־רײער‬ ַ ‫גאלדן‬ ָ ‫אונדזער‬ .‫הויפּט ון דער ביבל‬ I, therefore, want to propose the translation into Yiddish of all our cultural treasures from our free, golden past, primarily the translation into Yiddish of the Bible. Peretz went on to declare : ‫שפּראך ווילן מיר אונדזער אוצר‬ ַ ‫און אין דער‬ ‫ אונדז ער‬,‫שאן‬ ַ ‫־בא‬ ַ ‫ אונדזער קולטור‬,‫זאמלען‬ ַ ‫ [ ַאזוי מוזן אין איר‬. . . ] ‫ווײטער וועקן‬ ַ ‫נשמה‬ ‫ערגעטראגן ווערן אונדזערע ַאלטע קול־‬ ָ ‫איב‬ ‫רגאנגענהייט‬ ַ ‫א‬ ַ ‫טור ־ גיטער ון דער גרויסער‬ [...] and in this language we want to assemble our treasures, to create our culture, to wake up our soul [ … ] and through her our old cultural achievements from the great past should be translated [ … ] Subsequently, he also implied another chronology of modern Yiddish literature : .‫אײזיק מאיר דיק‬ ַ ‫ייִ דיש הייבט זיך נישט ָאן מיט‬ ‫ ברא־‬, ‫דאס איז דער‬ ָ - ‫דאס חסידישע מעשׂהלע‬ ָ ‫ שבחי בעל שם און ַאנדערע וווּנדער ־ גע־‬.‘ ‫שית‬ ‫ דער ערשטער‬,‫אלקס ־ דיכטונגען‬ ָ ‫שיכטן זענען‬ ‫לאוו מיט‬ ַ ‫אָלקסדיכטער איז ר ‘ נחמן ון בראַצ‬ .‫זײנע זיבן בעטלער‬ ַ Yiddish does not begin with Ayzik-Meyer Dik. The Hasidic tale, that is the ‘ Genesis. ’ The tales in praise of the Baal-Shem and other wonder-tales are folk poetry. The ĳirst folk poet is Reb Nakhmen of Bratslav with his seven beggars. Peretz ’ s arguments aimed at demonstrating the primary position of the Bible as a Jewish text, that Yiddish culture is a Jewish culture, and the fact that Orthodox tales told in Yiddish are part and parcel of any modern Yiddish culture. How one should read the Bible when one does not believe in a revealed god anymore remains an open question. Intellectuals of the Wissenschaft des Judentums suggested the subsuming of religion within a larger system of culture, where belief is only one aspect and never the only deĳining one and should be examined in historical terms and perspectives.4 Another argument would insist that the Bible is a repository of ancient Jewish culture, a source of ideas and exemplary stories that can be reinterpreted in the modern world according to a contemporary 1908 ). I quote the text printed in yivo ’ s book on the conference ( ‫שפּראך ־‬ ַ ‫די ערשטע ייִ דישע‬ ‫קאנערענץ‬ ָ ‫טשערנאוויצער‬ ָ ‫פּקלאנגען ון דער‬ ַ ‫דאקומענטן און ָא‬ ָ ,‫באריכטן‬ ַ : ‫קאנערענץ‬ ָ ) published in Vilna 1931. On Peretz, Yiddish, and the conference, see also Schumacher-Brunhes 2010 and Caplan 2010. 4 See Schorsch 1994 ; Schulte 2003. Shlomo Berger : Religion, Culture, Literature 621 and progressive worldview. Indeed, editing ‫דווקא‬, a Yiddish philosophical journal in Buenos Aires, the editor Shlomo Suskovich believed that it was a legitimate procedure because a rational modern Jew knows that biblical books consist of myths ( which nobody is called upon to believe ), but also contain philosophical ideas that are relevant for any modern Jew and were and still are essential to Western philosophy. Divorcing biblical stories from their religious connotations was a possible and even necessary act for a modern enlightened Jew. Moreover, Suskovich argued, this procedure would better serve the Bible, adding to the ‘ holy ’ book intellections that progressive modes of thinking could unveil.5 The future of Jewish, mutatis mutandis Yiddish, culture also belongs to well-argued philosophy employing old religious ideas within a new and rational framework. Nothing is lost in modernity – on the contrary, everything gains a new and better philosophical understanding. 2. The Position of Yiddish as Language of High Literature and Culture This claim also ĳits Joshua A. Fishman ’ s appreciation of the Czernowitz conference.6 While Suskovich is preoccupied with philosophy, the Yiddish sociolinguist argues that the conference ’ s goal was the creation of a basis that would enhance Yiddish high-cultural enterprises. For centuries Yiddish operated as a vehicle of low literature, of folklore, a daily vernacular that did not aspire to challenge Hebrew ’ s hegemonic position within the Jewish cultural polysystem.7 The conference should have launched Yiddish in a new direction, toward conquering a position within the realm of high culture, thus enabling a modern Yiddish literature to occupy a position alongside Hebrew as a true vehicle of Jewish culture. The conference ’ s success should have resulted in the transfer of Yiddish literature from low to high status and not necessarily in an increase in the numbers of Yiddish speaking people. Whether he knew the article or not, Peretz ’ s call in 1908 could not fully answer the criticism of Yiddish and its supporters as formulated by Aḥad Ha ‘ am in his 1895 essay “ The Language Quarrel. ” 8 The cultural Zionist scoffed at the Eastern European Yiddish intellectuals who refused 5 Repeated discussions of the matter are found in Suskovich ’ s Yiddish articles about whether or not there is a Jewish philosophy, which appeared in the Journal Davke : Suskovich 1954 : 289 – 308 ; 1957 : 202 – 222 ; and 1974 : 1 – 17 as well as in two of his Spanish articles : Suskovich 1988 and 1992. On Davke, see Berger 2007 and 2009. 6 Fishman 1980. 7 On polysystem, see Even-Zohar 1990. 8 Aḥad Ha ‘ am 1956. 622 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ to acknowledge the ongoing role and importance of Hebrew and the cultural assets latent in this language. Employing a full dose of irony, Aḥad Ha ‘ am put words in the mouth of an imaginary Yiddishist : ‫יכולים אנו להתקיים כאומה מיוחדת גם בלי‬ ‫ ואין הדבר חסר‬,‫עזרת הקרן הלאומית העתיקה‬ ‫אלא שנעקור מלבנו את ’ הגאותנות האריסטו־‬ ‫קרטית ‘ של אומה בת תרבות מימי עולם ונצייר‬ ,‫ לפני ארבע מאות שנה‬,‫לעצמנו כאלו פתאום‬ ‫צמחה אומתנו מאדמת פולין וליטא ולשון‬ ‫ וכי מחוייבת אומה‬.‫יהודית ־ אשכנזית בפיה‬ ‫דוקא להביא כתב ־ יחס עד לתקופת הפירמידות‬ ,‫ בלי יגעה יתרה‬,‫ הרי לכם‬,‫של מצרים ? ובכן‬ ! ‫ לשון לאומית‬: ‫בסיס חדש לקיומנו הלאומי‬ ‫ ואם‬.‫ כי אם בפי העם‬,‫לשון החיה לא בספרים‬ ‫ לסלסלה ולרוממה ולה־‬,‫נקדיש כל כוחנו לזו‬ ‫ — נגיע ברבות הימים‬,‫גדיל רכושה הספרותי‬ ,‫לברוא בה ’ קרן לאומית ‘ חדשה ומחודשת‬ ‫ תחת העצמות היב־‬,‫שתפרנסנו בכבוד וברוח‬ ‫ שהורישו לנו ’ העברים ‘ ללקקן עד סוף כל‬,‫שות‬ ‫הדורות‬ We can go on and exist as a special nation without the assistance of the old national capital. We just have to uproot from our hearts this ‘ aristocratic pride ’ of an ancient nation, and picture ourselves as a nation that suddenly, four hundred years ago, arose in Poland and Lithuania while speaking the Jewish Ashkenazi language. Should a nation indeed present a genealogy going back to the age of the Pyramids in Egypt ? Here, without too much trouble, a new basis for our national existence [is born] : a national language ! It is a language that does not live in books but is spoken by the people. And if we dedicate all our efforts to this one, praising it, lifting it up and augmenting its literary assets, in the years to come we will be able to create it as a new and renewed ‘ national capital ’ which will nourish our honor and spirit instead of the dry bones that the ‘ Hebrews ’ left us to lick our ĳingers unto the end of time. Peretz wanted to translate the nation ’ s treasures and make them an integral part of modern Yiddish culture, and on the face of it he answered Aḥad Ha ‘ am ’ s criticism. But, in fact, he did not. Aḥad Ha ‘ am did not believe in translation. Firstly, why translate at all, when Jews should read the Bible in Hebrew ? Secondly, he did not believe that translations would be able to safeguard old Jewish treasures. Translating into Yiddish and subsequently forgetting the Hebrew would, at best, produce a second-rate culture. Even if spoken by millions, a spoken vernacular cannot produce ( high ) culture of its own accord. Moreover, Eastern European Ashkenazi history did not originate in Yiddish ; Hebrew had been and still remained the basis of this Ashkenazi culture.9 Throughout the centuries Ashkenazi culture was bilingual,10 and according to 9 Hebrew as an identity marker : Myhill 2004 : 13 – 57, 126 – 141. 10 Turniansky 1994 : esp. 81 – 87. Shlomo Berger : Religion, Culture, Literature 623 Aḥad Ha ‘ am the new modern Jewish culture should be monolingual and adopt Hebrew as its sole linguistic instrument.11 Opting for a new modern bilingualism that would include the use of Yiddish alongside a modern European vernacular would dilute the Jewish nature of Yiddish culture. Aḥad Ha ‘ am was no Orthodox Jew and therefore he aimed his darts at the language question and not questions of belief. In fact, he shared Peretz ’ , Yehoyesh ’ s, and Suskovich ’ s efforts to create a modern secular Jewish culture. Still, it would be too easy to do away with Aḥad Ha ’ am ’ s criticism as reflecting merely a Zionist point of view. Aḥad Ha ’ am felt that Yiddish could not simply be compared to German, English or Dutch. Yiddish was an internal Jewish linguistic instrument, and the distance between Hebrew and Yiddish culture was far smaller than that between Latin and the European vernaculars. Indeed, the proximity between Hebrew and Yiddish could be interpreted as problematic for the Ashkenazi vernacular. The continuous employment of Hebrew ( beginning with usage of the Hebrew alphabet ) might have been responsible for hindering the development of a Yiddish ( high ) culture, and neglecting the holy tongue in which its cultural treasures were written might “ dejudaize ” Yiddish and allow it to turn into a sterile vernacular that would never be able to create any ( high ) culture. 3. Yehoyesh ’ s Preface Yehoyesh ’ s preface to his integral Yiddish translation amounts to his ‫אני‬ a declaration of his method, aims and ideas about Yiddish culture. The Yiddish poet attempted to formulate another equation, which would include Hebrew, Yiddish and Jewish culture and serve modern Yiddish secular culture as a whole.12 Four points, however, should be mentioned at the outset. First, the page-long preface ( ‫ ) הקדמה‬includes two footnotes at the bottom of the text. The ĳirst reveals that, in fact, the preface is a crude version of a text that was left unĳinished at Yehoyesh ’ s death. The text as it stands may have been only a work in progress, but nevertheless it was deemed publishable by the editors of the 1941 volume, Yehoyesh ’ s widow and his son-in-law. Indeed, the Yehoyesh Bible ’ s ĳirst two editions ( 1926 and 1938 ) are unprefaced. Moreover, both include only the Yiddish text, while the 1941 edition ( in fact two editions ) also includes ‫ מאמין‬, 11 Bartal 1993 : 141 – 150. 12 On the study of prefaces as literary texts with profound book-historical meaning, see Genette 1997 and Kinser 2004. 624 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Yehoyes, Heores tsum Tanakh (1949) Shlomo Berger : Religion, Culture, Literature 625 the Bible ’ s Hebrew Masoretic text. Thus, the 1941 edition is an ambitious project that deserved the translator ’ s preface in whatever form.13 Second, the second footnote points out the fact that Yehoyesh left four volumes of notes and remarks on the process of translation, indicating problems he had confronted and choices he had made in translating. The editors promise to try to publish these volumes as well, and indeed they were later published, giving scholars of the Bible and translation theory a unique document to study. Together with the preface, they expose the project ’ s authorial point of view.14 Third, in the course of his translation project, Yehoyesh published a Yiddish version of the book of Isaiah15 and a volume including renditions of Job, Song of Songs, Ruth and Ecclesiastes ( ‫) קהלת‬16 in 1910. In the preface to the ĳirst book, the Yiddish translator argues that because it is a word-by-word and accurate translation of the original, the Yiddish version can help the public to read the Hebrew biblical text. Thus, he actually repeats an old justiĳication for the publication of Yiddish books from the sixteenth century on : a Yiddish text ĳirst and foremost has a utilitarian purpose. Thus, the traditional Ashkenazi Hebrew and Yiddish bilingualism is upheld. Moreover, Yehoyesh also argues that this translation of the biblical book can beneĳit readers of Yiddish who cannot follow the old and archaic Yiddish versions anymore ( ‫לטמאדישע‬ ָ ‫די ַא‬ ‫טײטשע איבערזעצונגען‬ ַ ‫) ייִ דיש ־‬. He is referring, of course, to the tradition of ‫טײטש‬ ַ ‫ חומש ־‬,17 a tradition that has been continuously employed in the ‫ חדר‬from the Middle Ages to the present day. Yehoyesh was apparently looking for potential readers from both groups : those who wanted to and could read the Bible in Hebrew, and those who do not read Hebrew anymore and also had problems reading ‫טײטש‬ ַ ‫ חומש ־‬.18 Fourth, the design of the 1941 edition of Yehoyesh ’ s Bible continues and espouses the bilingual tradition of Ashkenazi culture. The printed page consists of two text ĳields : one including the Yiddish translation, and the other comprising the original Hebrew text rendered according to the Masoretic tradition. Visually, the Hebrew text occupies a more 13 The ĳirst edition ( 1926 / 1927 ) was published in eight volumes. The ĳirst volume includes a page with the table of contents in Yiddish and a Hebrew and Yiddish list of the weekly portions. The 1938 edition ( also called the ‫אויסגאבע‬ ַ ‫אלקס ־‬ ָ , in ten volumes ) is identical to the ĳirst one. The 1941 edition includes both the original Hebrew text and the Yiddish translation of the Bible. It was printed twice : one edition was “ specially printed for ‫טאג‬ ָ ‫ דער‬, ” and the other is an edition of the ‫זשורנאל‬ ַ ‫מארגן ־‬ ָ ; both were Yiddish newspapers published in New York. 14 Yehoyesh 1949. 15 Yehoyesh 1910 a. 16 Yehoyesh 1910 b. 17 Noble 1943 ; Turniansky 2007. 18 See also discussion below. 626 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ dominant position on the printed page. As in many old Yiddish books, the Yiddish text surrounds the Hebrew and sends out the message that it is secondary to the Hebrew original. Of course one could argue that the page layout may be approached in two divergent ways, reflecting the producers’ and the envisaged reader ’ s points of view. While the ĳirst wished to demonstrate the primacy of this book ’ s connection to the Hebrew text and expose the translator ’ s knowledge of both Hebrew and Yiddish, so complete that he need not hesitate to submit his translation to the scrutiny of the expert reader,19 the text ’ s ordinary reader, on the other hand, may have ignored the Hebrew text altogether and concentrated on the rendition of the Bible in his/her vernacular.20 It can be conjectured that the editors of the 1941 volume did not necessarily think in religious terms, but hoped to promote modern scholarly and high-literary ambitions.21 To include the unĳinished text of the translator ’ s preface was, then, a desirable and justiĳied move. The ordinary reader may also have ignored Yehoyesh ’ s preface altogether. This text could be deemed irrelevant. Still, because he had purchased a bilingual edition, the ordinary Yiddish reader was nevertheless continuously reminded that the Yiddish text was a version of the Bible given to Moses on Mount Sinai and written down in ‫לשון ־ קודש‬. Therefore, the translator ’ s preface was worthwhile to read and study. Beginning with a defense justifying the reader ’ s wish for a long and well-argued preface which he is not going to get,22 Yehoyesh enumerates the arguments he is including in this short text : his motives ( ‫מא־‬ ָ ‫ ) טיוון‬for engaging in the project, the plan ( ‫פּלאן‬ ַ ) he devised for it, the work ’ s purpose ( ‫ ) צוועק‬and the methods ( ‫מעטאד‬ ָ ) he used. He declares that translating the Bible was always his major dream, and he fosters a 19 Indeed, in the printers’ preface ( Yehoyesh 1941 : II – iii ) they claim that Yehoyesh ’ s biggest dream was to publish his translation together with the Bible ’ s Hebrew original text ( ‫צוזאמען מיטן פּנים‬ ַ [ . . . ] ‫) תנ ” ך ־ איבערזעצונג‬. Moreover, they argue that the completion of this project also “ closes a cycle of more than ĳifty years of work on the Bible by Yehoyesh and those who were engaged with both existing Yiddish editions ( of 1926 and 1938 ) and the current edition. ” 20 Nevertheless, it is worthwhile to remember that the ĳirst two attempts to offer the Ashkenazi public an integral and straightforward Yiddish translation of the Bible ( the Amsterdam Yiddish Bible translations by Blitz [1678] and Witzenhausen [1679] ) were commercial flops. It is assumed that very few copies were sold because, among other things, neither edition included the original Hebrew text of the Bible ; thus both editions became undesirable artifacts. Apparently even when Ashkenazim could not really understand the Hebrew text, they were still emotionally attached to Hebrew and wanted their Yiddish Bible to include the original text as well. On both Bible translations, see Aptroot 1990 and 1993, Timm 1993. 21 Later the edition was also supported by the publication of ‫ ( הערות צום תּנ ” ך‬Yehoyesh 1949 ). 22 Although it is an unĳinished text, the opening already demonstrates the rhetorical approach the translator employed to win his potential reader ’ s good-will. Shlomo Berger : Religion, Culture, Literature 627 twofold love towards the project : love of the most beautiful and most human book of Jews and non-Jews alike,23 and a love for the Yiddish language. Yehoyesh contends that each language needs a backbone ( ‫ ) חוט ־ השדרה‬that binds it together. Each language is constantly changing and its backbone helps it keep the form that makes it what it is : it is “ eternity in the midst of temporality ” ( ‫צײטלעכקייט‬ ַ ‫) אייביקייט אין מיטן ון‬. Only a biblical style can serve as the Ashkenazi vernacular ’ s backbone. Indeed, Yehoyesh conĳirms that the language earns new treasures and loses fading ones one after another, but if the language wishes to keep its hereditary honor ( ‫ ) ייִ חוס‬and does not want to commence its own history anew each morning,24 its backbone serves as a safeguard. Still, if one aspires to turn the Bible into the authoritative text of Yiddish letters, it must be true to the original. The Yiddish Bible should neither add to the text nor remove the smallest fragment of the original. It is loyalty to the Hebrew text that creates the Yiddish biblical style. Moreover, a new Yiddish Bible is not and should not be shaped following present language usage only, but must include the treasures of all the old Yiddish books ( i. e., in Western and Old Yiddish ) : the idiomatic wealth of older translations ( i. e., the ‫טײטש‬ ַ ‫) חומש ־‬, ethical books ( ‫) מוסר ־ סרים‬, stories ( ‫) מעשׂיות‬, sayings, idioms, jokes and the like. Thus, although adhering to modern norms of linguistic accuracy within the translation processes, the text nevertheless should not lack the sharpness, homeliness and traditionalism of the ‫ צאנה וראנה‬language.25 A Yiddish Bible must help in ĳixing words and idioms that would otherwise disappear, words that the ‫ מלמד‬used in the ‫ חדר‬and which are now disappearing, along with the ‫ חדר‬itself. Yehoyesh envisaged his Yiddish rendition as performing the tasks of a glossary, a historical dictionary, and a thesaurus. Moreover, the Bible ’ s language should be a synthesis of all spoken dialects, with each dialect contributing its own treasure to the Yiddish Bible. Thus, this Yiddish Bible may serve as the basis of a new common Yiddish high language. And, besides being a wonderful story, the Bible also has its own rhythm and music. which should be preserved and transferred in the process of “ faryidishung ” ( ‫ארייִ דישונג‬ ַ ).26 23 Thus he is pulling the Bible out of any overt Jewish religious environment. 24 This is an echo of Aḥad Ha ‘ am ’ s criticism on the supposed emergence of a Yiddish nation in Eastern Europe ; see above. 25 Yehoyesh had no criticism of the book ’ s subject( s ) and intentions. Of course, he was interested in the book ’ s language and style, which he apparently idealized. Indeed, Yehoyesh refused to accept any barriers between high and popular culture, or between scholarly and high literary ambitions and a feeling of ‫היימישקייט‬. 26 Is ‫ארייִ דישונג‬ ַ ( ‘ yiddishizing ’ ) less than full-fledged translation and, thus, closer to the Hebrew original ? Evidently, Yehoyesh wished to stress the continuous Jewish character of his Yiddish Bible and, consequently, the necessary contacts between Yiddish culture and Judaism. 628 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ The Yiddish Bible should become a manual for composition in both poetry and prose. Several points in Yehoyesh ’ s manifesto deserve elaboration. In the ĳirst place, it should be noted that the Bible does not seem to possess any obvious religious intellections in the translator ’ s mind.27 The Yiddish rendition of the Torah is not offered in order to deepen an Ashkenazi reader ’ s knowledge of, let alone belief in, God ’ s universe. Yehoyesh certainly respects the old and traditional society in which a melamed ’ s lesson in the ‫ חדר‬was meaningful and consequently important to preserve. But it is the melamed ’ s speech itself – the words and expressions he uses – and not the religious content of his lesson that is signiĳicant for the purposes of translation. Yehoyesh is not advocating any Orthodox way of life, and he does not locate the synagogue in the center of Jewish life ; his approach is culturally oriented. The linguistic contacts between Hebrew and Yiddish, and between Old Yiddish and Modern Yiddish, are instruments that may safeguard Yiddish ’ s Jewish essence. Texts and their languages occupy a central position in Yehoyesh ’ s intellectual and mental system. Jewish culture is understood within its historical framework, and therefore the translator ’ s worldview is necessarily diasporic. Arnold Eisen claims that, outside the Land of Israel, the Torah in its broadest sense functioned as the Jewish territory, and mutatis mutandis this is also true for Jewish texts and books in Jewish languages.28 Indeed, Yehoyesh aims to achieve a cultural unity within spatial and temporal Jewish life. If the Hebrew Bible is basically associated with Erets Yisroel, it is rewarding ( even obligatory ? ) to strive to employ the biblical style in Yiddish as well and thus connect the center of Jewish consciousness with the peripheries of Jewish life in different Ashkenazi locations of dwelling. The Yiddish Bible may, then, earn a respectable position in the diasporic ( metaphorical ) territory. Therefore, Yiddish authors are also encouraged, and in fact compelled, to read and study old texts, become acquainted with their own language ’ s history and, consequently, enrich their own contemporary culture. Yehoyesh the man of letters followed in Ber Borokhov ’ s footsteps29 and demanded that Yiddish-speaking intellectuals study literature written and published before Eastern European Ashkenazim launched a revolution and introduced the Modern Yiddish that conquered the Jewish world from 27 Nevertheless, because it included the Hebrew text and was proofread by a rabbi, the editors did add a title page mentioning the rabbi ’ s name, thus insisting on the double nature ( Hebrew-Yiddish ) of the edition. This title page can be interpreted as a rabbinic approbation. 28 Eisen 1986 : 35 – 56. 29 Borokhov 1968. Shlomo Berger : Religion, Culture, Literature 629 the nineteenth century on.30 Seemingly, Yehoyesh ’ s mission was also to demonstrate the unity of Yiddish in diachronic terms. The language he used is the vernacular that emerged in the tenth century. The chasm introduced at the beginning of the nineteenth century between Old and Western Yiddish on the one hand and Eastern European and Modern Yiddish on the other represented a change, a development, a revolution within one and the same language. He wanted Yiddish to be based on biblical style. In fact, it is not easy to describe the sort of Yiddish Yehoyesh had in mind. We can only surmise that he wished Yiddish to be based on a linguistic foundation that he most probably would denote as ‘ classical ’ : grammatically correct, replete with idiomatic forms, using a rich vocabulary that may occasionally be archaic but nonetheless beĳits high-literary projects, leaning towards a poetical style or a reĳined prose that displays the erudition of authors and readers alike. Language, knowledge of one ’ s own history, employing literary gems of the past – all are essential for a literature ’ s life in any vernacular. The combination of the eternal existence of a literature ’ s backbone and the temporal circumstances that necessarily bring change to any literary system is valid for Modern Yiddish as well. Moreover, the bond between Hebrew and Yiddish within the Jewish polysystem enables Yiddish not only to legitimize its position but also to excel. Indeed, Yehoyesh echoes ideas which were voiced before and after him by Bal-Makhshoves, Shmuel Niger and Dov Sadan, who believed that one can identify a single Jewish literature in two or more languages.31 Dan Miron sees competition and antagonism between Yiddish and Hebrew ( and Jewish literature composed in other non-Jewish languages ), which drove both to higher levels of creativity. But even in this model of conflict, both languages cannot easily be separated from each other.32 Evidently, Yehoyesh is aspiring to come up with a Yiddish text that could serve as an example for high-literary projects in Modern Yiddish. He does not discard Old Yiddish forms that were ( and still are ) labeled as folkloristic, belonging to a low-cultural Ashkenazi sphere. He does not do away with religious writings or Yiddish dialects. He is advocating a synthesis of all the linguistic features of Yiddish throughout the ages as found in each and every genre of literature.33 And because the Bible 30 Here again Aḥad Ha ‘ am ’ s criticism surfaces, as well as Peretz ’ s chronology of modern Yiddish literature. 31 Bal-Makhshoves 1981 ( the article was ĳirstly published in ‫גבלאט‬ ַ ‫טא‬ ָ ‫גראדער‬ ַ ‫פּעטרא‬ ָ in 1918 ) ; Niger 1941 ; Sadan 1949. 32 Miron 2010. Miron also takes these critics to task, showing their inability to notice that there is a Jewish literature written in English, French, German and other ‘ non-Jewish ’ languages, and that this literature is not intended only for a Jewish reading public. 33 Whether he in fact followed his own advice is another question : see, for instance, Rozental 1950; Rozental 1971. 630 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ is the Jewish text par excellence, it should be the base text for modern secular Yiddish literature as well. 4. Yiddish : A Jewish Language ! In 1943 Isaac Bashevis Singer published two articles discussing the future of Yiddish literature. In one, he discussed Yiddish literature in Poland,34 and in the other Yiddish in America.35 The underlying message in both articles is pessimistic. For the future Nobel laureate, the possible divorce of Yiddish from Jewish culture could not but bring Modern Yiddish literature down. Discussing the Polish situation, Bashevis takes the innovators of Yiddish literature to task. They want to engage in highliterary experiments, but their readers come from elsewhere, from the shtetl and traditional life. Thus, if writers had operated within the Jewish tradition, they could have found a reading public. The language and subject matter should have been Jewish in essence. Bashevis has even greater difĳiculty foreseeing a future for a Yiddish literature in America, because the language does not possess a vocabulary capable of describing the new and modern world and giving it a meaning, a Jewish meaning. On the one hand, “ words assume other idiomatic connotations. Others are completely forgotten, or appear only in particular categories and in disharmony with the original lexicon. ” 36 Moreover, “ words and phrases are so tightly bound to the Old Country that, when used here, they appear not only to be imported from another land, but borrowed from a completely alien conceptual system. ” 37 Bashevis knows why this is happening : “ There is a split, a division in the mindset of Yiddish prose writers who try to write about America. The graceful words have too much [ sic ! ] tradition ; the new ones are somewhat strange and tawdry and ungainly to boot. ” 38 American Yiddish authors write about Eastern Europe, the Old World, “ not in order ‘to escape reality’ but because in these places and periods Jews spoke Yiddish, while here they speak either English or a jargon which no true writer can love – and where the word is not loved, it cannot be a source of creativity. ” 39 Bashevis is crude and blunt : “ The idea that Yiddish literature – and indeed Yiddish culture – can be cosmopolitan, an equal among equals, was from the 34 Bashevis Singer, 1943 b : 468 – 475, in English, Bashevis Singer 1995 : 113 – 127 ; on both of Singer ’ s essays, see Roskies 1995 : 279 – 282. 35 Bashevis Singer 1943a : 2 – 13, in English, Bashevis Singer 1989 : 5 – 11. 36 Bashevis Singer 1943a : 5. 37 Ibid. : 8. 38 Ibid. : 9. 39 Ibid. Shlomo Berger : Religion, Culture, Literature 631 beginning built upon misconceptions. The Jews who wanted to be one hundred percent cosmopolitan switched to other cultures and grew accustomed to foreign languages. ” 40 Thus, Bashevis concludes : “ Yiddish is not yet about to leave us. It will continue for many more years to serve as a means of understanding our past ( and occasionally our present ). However, any attempt to push our language into the future is in vain. ”41 Bashevis actually shared Yehoyesh ’ s vision about Yiddish language and letters. Both understood that Yiddish was alive and would continue as a Jewish language whose authors were well-versed in loshn-koydesh and Yiddish letters throughout the ages. Bashevis should have applauded Yehoyesh ’ s Herculean deed, but he would also point out that Yehoyesh ’ s preferred style of Yiddish would not ĳit a description of life in the New World, of modernity in general. Indeed, as Bashevis sums up in his article on Yiddish in America, a talented author relating the past is in fact telling a rewarding story about the present and maybe even the future. Yehoyesh is the optimistic poet translating the Bible for the beneĳit of the next generations ; Bashevis is the pessimist prose author who ultimately searched for ways to penetrate the hearts of readers in foreign languages. 5. Epilogue When launching his Bible-translation project, Yehoyesh was already a well-known poet and Yiddish already functioned as a language of high literature. Still, the poet aspired to establish ( or re-establish ) his position as a man of letters who had tackled the most profound text of Jewish culture ; and for Yiddish letters, this Yiddish Bible served as a reafĳirmation of its status as a Jewish language and its ability to be an instrument of Jewish high literature written in the Ashkenazi vernacular. The preface serves as a pamphlet that sets out Yehoyesh ’ s targets, and as a renewed acknowledgement of Yiddish as a legitimate Ashkenazi language of literature. It is a manifesto that clearly attempted to tie up the necessary connection between Hebrew and Yiddish, and between Yiddish and Jewish culture, including its religious manifestations. Evidently, the modern poet worked within a recognized ( even cherished ? ) sense of contradiction, wishing to be modern, secular, and progressive, and nevertheless feeling that Yiddish could not escape its religious Jewish past. Indeed, in translating the Bible and furnishing it 40 Ibid. : 10. 41 Ibid. : 11. 632 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ with a particular literary quality and essence, Yehoyesh performed an act of poetic betrayal that played its part in enhancing the level of Yiddish modern letters. Bibliography Aḥad Ha ‘ am, 1956 : “ Rīv ha-lěšōnōt. ” In : ’Aḥad Hā-‘ ām, ‘Al pārāšatděrākhīm. Vol. 2. Tel Aviv : Dvir, 296 – 306. Aptroot, Marion, 1990 : “ Blits un Vitznhoyzn : naye penemer fun an alter makhloykes. ” In : Oksforder yidish. A Yearbook of Yiddish Studies 1 : 3 – 38. – 1993 : “ In galkhes They Do Not Say So, but the taytsh Is As It Stands Here : Notes on the Amsterdam Yiddish Bibles Translations by Blitz and Witzenhausen. ” In : Studia Rosenthaliana 27 : 136 – 158. Bal-Makhshoves ( Israel Isidor Elyashev ), 1981 : “ Tsvey shprakhn – eyn eyntsike literature. ” In : Joshua, A. Fishman, ed., Never Say Die : A Thousand Years of Yiddish in Jewish Life and Letters. The Hague : Mouton : 463 – 478. Bartal, Israel, 1993 : “ From Traditional Bilingualism to National Monolingualism. ” In : Lewis Glinert, ed., Hebrew in Ashkenaz : a Language in Exile. Oxford : Oxford University Press. Bashevis Singer, Isaac, 1943a : “ Problemen fun der yidisher proze in Amerike. ” In : Svive 2 ( March – April 1943 ) : 2 – 13. – 1943 b : “ Arum der yidisher literatur in Poyln. ” In : Di tsukunft 28 ( August 1943 ) : 468 – 475. – 1989 : “ Problems of Yiddish Prose in America ( 1943 ). ” In : Prooftexts 9 : 5 – 12. – 1995 : “ Concerning Yiddish Literature in Poland ( 1943 ). ” Robert Wolf, trans. In : Prooftexts 15 : 113 – 127. Berger, Shlomo, 2007 : “ Interpreting Freud : The Yiddish Philosophical Journal Davke Investigates a Jewish Icon. ” In : Science in Context 20 : 303 – 316. – 2009 : “ Philosophy in a Yiddish Key : The Journal Davke ’ s Treatment of Nature. ” In : Aleph 9 : 113 – 140. Borokhov, Ber, 1968 : Shprakh-forshung un literatur-geshikhte. Tel Aviv : Y. L. Perets Farlag. Burke, Peter, 2004 : Languages and Communities in Early Modern Europe. Cambridge : Cambridge University Press. Caplan, Marc, 2010 : “ Y. L. Peretz and the Politics of Yiddish. ” In Kalman and Weiser and Joshua Fogel, eds. : Czernowitz at 100 : The First Yid- Shlomo Berger : Religion, Culture, Literature 633 dish Language Conference in Historical Perspective. Lanham, md : Lexington Books, 77 – 94. Eisen, Arnold, 1986 : Galut : Modern Jewish Reflections on Homelessness and Homecoming. Bloomington : Indiana University Press. Even-Zohar, Itamar, 1990 : Polysystem Studies ( = Poetics Today 11 : 9 – 265 ). Fishman, Joshua A., 1980 : “ Attracting a Following to High-Culture Functions for a Language of Everyday Life : The Role of the Tshernovits Language Conference in the ‘Rise of Yiddish.’ ” In : International Journal of the Sociology of Language 24 : 43 – 73. – 2008 : “ Czernowitz Conference. ” In : Gershon D. Hundert, ed., The yivo Encyclopedia of Jews in Eastern Europe. New Haven : Yale University Press, 384 – 385. Genette, Gérard, 1997 : Paratexts : Thresholds of Interpretation. Cambridge : Cambridge University Press. Kinser, Sam, 2004 : “ Paratextual Paradise and the Devilish Arts of Printing. ” In : C. Dauven et al., eds., Paratext : The Fuzzy Edges of Literature. Amsterdam : University of Amsterdam : 5 – 38. Meisel, Nakhmen, 1944 : Briv un redes fun Y. L. Perets. New York : Yidisher kultur-farband. Miron, Dan, 2010 : From Continuity to Contiguity : Toward a New Jewish Literary Thinking. Stanford : Stanford University Press. Myhill, John, 2004 : Language in Jewish Society : Towards a New Understanding. Clevedon : Multilingual Matters. Niger, Shmuel, 1941 : Di tsveyshprakhikayt fun undzer literatur. Detroit : Luis Lamed Fund. Peretz, Y. L., 1931 : “ Y. L. Peretses efenung-rede. ” In : Di ershte yidishe shprakh-konferents : barikhtn, dokumentn un opklangen fun der Tshernovitser konferents. Vilna : yivo, 74 – 77. Noble, Shlomo, 1943 : Khumesh-taytsh : an oysforshung vegn der traditsye fun taytshn khumesh in di khadorim. New York : yivo. Roskies, David, 1995, A Bridge of Longing : the Lost Art of Yiddish Storytelling. Cambridge, Harvard University Press. Rozental, Yehuda, 195 0: “ Yehoyeshes Tanakh-iberzetzung : an analitishe oysforshung. ” In : yivo-bleter 34 : 59 – 12 8. – 1971 : “ Naye heores tsu Yehoyeshes Tanakh-iberzetzung. ” In Goldene keyt 72 : 105 – 117. Sadan, Dov, 1949 : ‘Al sifrūtēnū : massat māvō’. Jerusalem : Reuven Mass Publishers. Schorsch, Ismar, 1994 : From Text to Context : the Turn to History in Modern Judaism. Hanover – London : Brandeis University Press. 634 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Schulte, Christoph, 2003 : Bě’āyat ha-dāt bě-maddā ’ ēy ha-yahadūt běgermanyāh ba-mē ’ ōt ha-těša‘-eśrēh wě-hā ’ eśrīm. Ramat-Gan : Bar-Ilan University Press. Schumacher-Brunhes, Marie, 2010 : “ Peretz ’ s Commitment to Yiddish. ” In : Kalman Weiser and Joshua Fogel, eds., Czernowitz at 100 : The First Yiddish Language Conference in Historical Perspective. Lanham, md : Lexington Books, 45 – 54. Suskovich, Shlomo, 1988 : “ ¿Esta una ĳilosoĳia Judia ? ” In : Judaismo laico 1 : 82 – 94. – 1992 : “ El rumbo ĳilosoĳico de Davke. ” In : Coloquio 24 : 27 f. – 1954 : “ Araynĳir in der yidisher ĳilosofye. ” In : Davke 21 : 289 – 308. – 1957 : “ Iz faran a yidishe ĳilosofye. ” In : Davke 31 : 202 – 222. – 1974 : “ Iz faran a yidishe ĳilosofye. ” In : Davke 77 / 78 : 1 – 17. Timm, Erika, 1993 : “ Blitz and Witzenhausen. ” In : Israel Bartal, Ezra Mendelsohn and Chava Turniansky, eds., Studies in Jewish Culture in Honour of Chone Shmeruk. Jerusalem : The Zalman Shazar Center for Jewish History, 39* – 66*. Turniansky, Chava, 1994 : Bēyn qōdeš lě-ḥōl : lāšōn, ḥinnūkh wě-haśkālāh běmizrāḥ ’ ēyrōpāh. Tel Aviv : Open University of Israel. – 2007 : “ Reception and Rejection of Yiddish Renderings of the Bible. ” In : Shlomo Berger, ed., The Bible in / and Yiddish. Amsterdam : Menasseh ben Israel Institute, 7 – 20. Yehoyesh ( Solomon Bloomgarden ), 1910 a : Yeshaye. New York : Farlag Yehoyesh. – 1910b : Iyev, Shir hashirim, Rus, Koyheles. New York : Farlag Yehoyesh. – 1949 : Heores tsum Tanakh. New York : Yehoyesh farlag-gezelshaft. Weiser, Kalman [Keith Ian Weiser] and Fogel, Joshua, eds., 2010 : Czernowitz at 100 : The First Yiddish Language Conference in Historical Perspective. Lanham, md : Lexington Books. Aleksandra Geller Auseinandersetzung über die jiddische Orthographie in der Kulturzeitschrift Literarishe bleter Bekanntlich wird das Jiddische, wie alle anderen sog. › jüdischen Sprachen ‹ mit hebräischen Buchstaben geschrieben. Heute, da man in alltäglichen wie in wissenschaftlichen Veröffentlichungen gewöhnlich Transkription verwendet, ist diese Feststellung keine Selbstverständlichkeit mehr.1 Es werden Ausgaben jiddischer Klassiker, ja sogar Wörterbücher in Transkription publiziert. Man kann auch T-Shirts erwerben, auf denen Redewendungen jiddischer Herkunft mit zwar ins Hebräische stilisierten, aber doch lateinischen Buchstaben gedruckt stehen. In diesem Zusammenhang könnte es von Interesse sein, sich die Argumente vor Augen zu führen, die bereits im vorigen Jahrhundert von den Befürwortern einer Latinisierung der jiddischen Sprache angeführt wurden. Im Folgenden wird ein kleiner Ausschnitt aus der Debatte um die jiddische Orthographie beleuchtet, die um das Jahr 1926 in der Zeitschrift ‫ליטערארישע בלעטער‬ ַ , dem führenden Kulturjournal im Polen der Zwischenkriegszeit, geführt wurde. In den damals publizierten Artikeln wurden neben der Idee einer phonetischen Schreibung der aus dem Hebräisch-Aramäischen ( loshn-koydesh ) stammenden Wörter auch die radikalen Projekte einer Latinisierung des Jiddischen diskutiert.2 Sie entstanden vor dem Hintergrund einer allgemeinen Auseinandersetzung um die Rolle des Jiddischen als einer Nationalsprache wie auch um dessen Stellung im Rahmen der traditionellen inneren jüdischen Zweisprachigkeit. Somit spiegeln sie den Prozess der Verselbständigung der jiddischen Sprache gegenüber dem Hebräischen wider. Der vor mehr als achtzig Jahren geführte Diskurs der Jiddischisten über die Frage der Orthographie sowie über die Wahl des Alphabets zeigt exemplarisch, wie undurchschaubar Schrift als Medium eigentlich ist. Die gruppeninternen Überlegungen der Jiddischisten und jiddischen Schriftsteller berührten Probleme, mit denen sich einige Jahrzehnte später Medientheoretiker und Kulturanthropologen aus1 Für das Jiddische wird gegenwärtig zumeist die yivo-Transkription gebraucht, welche der speziĳischen Graphemik des Englischen folgt und sich daher nicht für jedes Zielpublikum eignet. 2 Ausführlich zur Entwicklungsgeschichte der jiddischen Orthographie s. Schaechter 1999 sowie Katz 1993 : 71 – 128. 636 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ einandergesetzt haben, unter anderem die Frage des Einflusses von Verschriftung und Schriftlichkeit im Allgemeinen auf die Denkweise der Sprecher.3 Unter dem Gesichtspunkt ethnischer Selbst-Identiĳizierung erscheint die Wahl der Schriftzeichen des hebräischen Alphabets zur Aufzeichnung der jiddischen Sprache als die einzig mögliche. In hebräischen Buchstaben ist die Torah geschrieben, und mit der Begründung der rabbinischen Tradition wurden die Buchstaben selbst zu einem integralen Element der biblischen Überlieferung. Sie wurden also im kollektiven wie im individuellen Bewusstsein der Sprecher ein kulturelles Symbol und Merkmal jüdischer Identität.4 Das hebräische Alphabet erfüllte die Funktion eines Universalwerkzeuges bei der Aufzeichnung aller Sprachen, deren sich die Juden in der Diaspora bedienten. Hinsichtlich der Strukturen des Hebräischen und des Jiddischen war diese Wahl jedoch recht umständlich. Das auf die Morphologie semitischer Sprachen zugeschnittene hebräische Alphabet, das auf den konsonantischen Wurzeln der Verben aufbaut, die festgelegte semantische Felder markieren, lässt sich nicht ohne Weiteres auf die jiddische Sprache übertragen. Besondere Schwierigkeiten bietet die Wiedergabe der verschiedenen Vokale. Insgesamt musste das hebräische Alphabet den Anforderungen einer indoeuropäischen Sprache angepasst werden. Das Jiddische besaß von Anfang an zwei getrennte Aufzeichnungssysteme – eines für die hebräische und eines für die indoeuropäischen Komponenten – im Rahmen eines einzigen Zeichensystems. Diese Tatsache spiegelt die tief verwurzelte innere jüdische Diglossie wider.5 Der besondere Status der hebräisch-aramäischen Komponente im Jiddischen beschränkte sich nicht auf die Koexistenz zweier Aufzeichnungssysteme, sondern hinterließ auch Spuren in der Form der Schrifttype, in der diese Sprache geschrieben wurde. Die Buchstaben des hebräischen Alphabets waren gewissermaßen durchtränkt von der Heiligkeit des Inhalts, den sie vermittelten, und gingen damit selbst in den Bereich des Heiligen ein. In einer Kultur, in der eines der Hauptprinzipien › lehavdl ‹ ist, also die Trennung des Heiligen vom Profanen, hätte der Gebrauch der hebräischen Quadratschrift, die den heiligen 3 Vgl. zur Frage von Oralität vs. Schriftlichkeit Eric Havelock, Walter Ong und Jack Goody ; neuere Arbeiten u. a. Olson 1994. 4 Die Identiĳizierung des Alphabets mit der Religion haben die Juden auf die nichtjüdische Welt übertragen. Ein Beweis dafür ist die Verwendung des Terminus ‫ גלחות‬für › christliche ‹ Alphabete, also sowohl das lateinische wie das kyrillische. Beide wurden im Jiddischen traditionell mit diesem Begriff bezeichnet, der vom Wort ‫ › גלח‬Geistlicher ‹ abgeleitet ist, wahrscheinlich weil zu jener Zeit Geistliche die Schriftkundigen waren. 5 Zu der oft thematisierten funktionalen Mehrsprachigkeit in jüdischen Kulturgemeinschaften, vgl u. a. Shmeruk 1989 ; Even Zohar 1990. Aleksandra Geller : Die Literarishe bleter und die jiddische Orthographie 637 Texten vorbehalten war, zur Aufzeichnung einer profanen Alltagssprache, die Jiddisch ja war, zu einer Verletzung der streng funktionalen Zweisprachigkeit geführt. Als in der zweiten Hälfte des 19. Jahrhunderts die Zahl der jiddischsprachigen Veröffentlichungen auf dem Gebiet der weltlichen schöngeistigen Literatur bedeutend anstieg und erste Periodika auf Jiddisch erschienen, gewann die Frage der schriftlichen Wiedergabe und insbesondere der Rechtschreibung an Bedeutung. Zuvor war gegen Ende des 18. Jahrhunderts unter dem Einfluss der Haskala erstmals eine auf das moderne Schriftdeutsch gestützte Rechtschreibung gebraucht worden. Dahinter stand ohne Zweifel auch die nicht gerade schmeichelhafte Ansicht, das Jiddische sei ein › verdorbenes Deutsch ‹. Der Status des Jiddischen als eine in erster Linie gesprochenen Sprache manifestiert sich auch im Fehlen eines normierten Schreibsystems. Das moderne Ostjiddisch besitzt bekanntlich drei Hauptdialekte ( Nordost-, Zentral-, und Südostjiddisch ), die sich untereinander nicht nur durch Aussprache und Wortschatz, sondern z. T. auch in der Grammatik unterscheiden. Die Frage einer Normierung der jiddischen Sprache gewann mit dem Ende des Ersten Weltkriegs höchste Aktualität, als sich in der Sowjetunion und in den Ländern Mitteleuropas die Möglichkeit eröffnete, unter jüdischer Leitung jiddischsprachige Schulen einzurichten. Eine der Prioritäten des 1925 gegründeten Jüdischen Wissenschaftlichen Instituts yivo war die Standardisierung der geschriebenen Sprache. Nach dem erklärten Ziel ihrer Gründer sollte die Warschauer Wochenschrift ‫ליטערארישע בלעטער‬ ַ unter anderem auch zur Normierung der jiddischen Sprache beitragen und auf diese Weise helfen, eine reife wissenschaftliche und literarische Ausdrucksform zu schaffen. In den Spalten der Zeitschrift erschienen Artikelserien, die sich der Verbesserung des sprachlichen Bewusstseins unter den Jiddischsprechenden widmeten.6 Nach dem Willen der Redaktion gebrauchten die ‫ליטערארישע‬ ַ ‫ בלעטער‬von Beginn an die bereits im Jahr 1913 von dem Philologen Ber Borokhov, einem der Begründer der Jiddistik, vorgeschlagene Rechtschreibung.7 Das schloss jedoch nicht die Diskussion von solchen Fragen wie dem Übergang zum lateinischen Alphabet ( Latinisierung ) oder der Übernahme der sogenannten sowjetischen Orthographie aus. Die daraus entstandenen Debatten führten zu interessanten Überlegungen über den Einfluss der Schriftzeichen oder der Rechtschreibregeln auf die Mentalität und sogar die soziale Stellung der Jiddisch-Sprecher. Die Auseinandersetzung über die Orthographie betraf vor allem das Problem der Schreibweise hebräischer Wörter im Jiddischen. In 6 7 Vgl. Kalmanovitsh 1925 : 3 f, 21 f, 41 f, 53, 55 ; Lerer 1925 : 94 ; Niger 1925 : 98 – 100, 137 – 139. Vgl. Borokhov 1913. 638 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ einer im Frühjahr 1926 in ‫ליטערארישע בלעטער‬ ַ publizierten Artikelserie äußerten sich die drei beteiligen Autoren – Israel Joschua Singer, Alter Kacyzne, Falk Halpern – zu der 1920 von der Evsekcija, der Jüdischen Sektion der Kommunistischen Partei, eingeführten orthographischen Reform.8 Sie befürworteten die sowjetische Lösung und wiesen dabei auf die Berechtigung eines derartigen Schrittes sowie auf seine zu erwartenden weitreichenden Folgen hin. Eröffnet wurde die Diskussion von dem bekannten Schriftsteller Israel Joschua Singer, der feststellte, dass die Existenz zweier Schreibsysteme die wachsende Aufteilung der jiddischen Kultur in zwei Lager – das sowjetische und den › Rest der Welt ‹ – vertiefen würde. Die jiddischen Schulen in der UdSSR zögen eine vollständig neue Generation von Hunderttausenden jungen Lesern heran. Die sowjetische jüdische Jugend würde aber aufgrund von Leseschwierigkeiten nur ungern nach Büchern greifen, in denen hebräische Wörter in der klassischen Schreibweise erschienen. In ähnlicher Weise dürften Leser, die mit der klassischen Orthographie ausgebildet worden seien, einen erschwerten Zugang zur sowjetischen Literatur haben. Es entstehe somit eine Kluft, die den freien Transfer von Ideen zwischen den Zentren der jiddischen Kultur behindere. Die Befürchtungen Singers betrafen vor allem die junge Generation, für die ” ‫רײנגעקריצלט אין מוח ווי ַא געזעץ‬ ַ ‫ווארט איז ַא‬ ָ ‫דאס‬ ָ „ ,9 während es den Älteren, die an häuĳige Änderungen einer uneinheitlichen jiddischen Orthographie gewöhnt waren, leichter fallen würde, sich von einem System auf ein anderes umzustellen. Diese Feststellung Singers ist mehr als nur ein Hinweis auf die Macht der Gewohnheit. Meines Erachtens deutet sie darauf hin, dass die Oralität des Jiddischen gegenüber der Schriftlichkeit des Hebräischen erst durch eine formalisierte säkulare Schulbildung ( z. B. in den tsisho-Schulen ) an Einfluss verliert. Wie es scheint, war Singer und den Menschen seiner Generation, die eine traditionelle, auf die hebräischen Grundtexte des Judentums ausgerichtete Ausbildung erhalten hatten ( kheyder, Religionsschule ) oder aber in einer nicht-jüdischen Sprache ( etwa auf einem russischen oder österreichischen Gymnasium ) unterrichtet worden waren, das Schriftbild des Jiddischen nicht durch schulische Alphabetisierung eingeprägt worden. Das Schriftbild war etwas Sekundäres, denn der Hauptträger der Bedeutung war der Klang der gesprochenen Sprache. Anders verhielt es sich bei denjenigen, die von Anfang an Lesen und Schreiben im jiddischen Unterricht lernten. Für sie war das Wort 8 Die radikalsten Änderungen betrafen die Schreibweise der hebräischen Wörter. Ausführliches zur sowjetischen Sprachplannung, vgl. Estraikh 1999. 9 Singer 1926 : 261. Aleksandra Geller : Die Literarishe bleter und die jiddische Orthographie 639 in erster Linie ein von oben festgelegtes, unveränderliches visuelles Zeichen, das Geschriebene stand über dem Gesprochenen. Zwei Wochen nach Singers Artikel entwickelt der Schriftsteller Alter Kacyzne diesen Gedanken weiter. Sich auf die hörbar-sichtbare Zwiegestalt des Wortes beziehend, sagte er : ‫לעבאטעוועט‬ ַ ‫געבא‬ ַ ‫דא‬ ָ ‫האבן‬ ָ ‫„ צו יל‬ ‫מוזיקאלישער‬ ַ ‫אר דער‬ ַ ‫נטווארטלעכקײט‬ ָ ‫רא‬ ַ ‫א‬ ַ ‫ ָאן שום‬,‫הארטע אויערן‬ ַ ‫לאגן מיט‬ ָ ‫ילא‬ ָ ” ‫ווארט‬ ָ ‫ סטרוקטור ון‬.10 In einem weiteren Teil des Artikels verwies Kacyzne auf die jahrhundertealte Tradition der zwei unterschiedlichen Ausspracheweisen des Hebräischen – die aschkenasische und die sephardische. Kacyzne hob die verhängnisvollen Folgen hervor, die eine phonetische Veränderung der Sprache mit sich bringen könnte : 11 ‫אנעטישע ענדערונגען צוליב דער סרדישער ה!רה נישט מער‬ ָ ‫זענען דען די‬ ‫האבן דען די‬ ָ ? ‫ווארט‬ ָ ‫דאס ָאפּטישע אויסזען ון‬ ָ ‫ ווי‬,‫לוציאנער‬ ָ ‫רעווא‬ ָ ‫ריזיקאליש און‬ ַ ‫גאנצע העברעיִ שע‬ ַ ‫צעקאליעטשעט די‬ ַ ‫ נישט‬,‫צעבראכן‬ ָ ‫דאזיקע ענדערונגען נישט‬ ָ ? ‫אר הילכיקן געברויך‬ ַ ‫געמאכט זי אוממעגלעך‬ ַ ‫ריטמישע דיכטונג און נישט‬ Sodann warf er die Frage auf, ob visuelle Veränderungen eines Wortes tatsächlich qualitativ anders zu bewerten seien als Unterschiede in der Aussprache. Als Anhänger der phonetischen Orthographie verneinte er das : ‫ווארט — זײער‬ ָ ‫„ איז די ָאפּטישע צוגעבונדנקײט צו דער ַאלטער געבײדע ון‬ ” ‫נארישער עטישיזם‬ ַ ‫ ַא‬. Für ihn waren hebräische Wörter in klassischer Rechtschreibung wie ‫נגעאסט אין די ווענט ון‬ ַ ‫אײ‬ ַ ‫ וועלכע זענען‬,‫„ ַאלטע מצ!ות‬ ” ‫נײער געבײדע‬ ַ ‫ ַא‬, sie versteinerten die Sprache. Die sowjetische, phonetische Orthographie hingegen stärke die hebräische Komponente im Jiddischen. ‫ עס‬.‫ארייִ דישט‬ ַ ‫ווארט‬ ָ ‫דאס העברעיִ שע‬ ָ ‫אנעטיש ווערט‬ ָ ‫סײ‬ ַ ,‫סײ ָאפּטיש‬ ַ ‫ארמערט‬ ַ ‫רשטארטק זיך און‬ ַ ‫א‬ ַ ‫ עס‬,‫שפּראך‬ ַ ‫ארגרעסערט זיך די שע ון דער‬ ַ ‫שפּראך דעם נויטיקן‬ ַ ‫זיך דער העברעיִ שער עלעמענט אין ייִ דיש און גיט צו דער‬ .‫גערמאניזמען‬ ַ ‫ היט זי ָאפּ ון‬,‫שפּראך‬ ַ ‫קאנסערווירט די‬ ָ ‫ עס‬.‫לאריט‬ ָ ‫קא‬ ָ ‫ייִ דישלעכן‬ Mit Bezug auf Singers Hauptthese behauptete Kacyzne, die wahre Gefahr der Existenz zweier Schreibweisen stecke nicht in den Schwierigkeiten beim Leseakt selbst, sondern im Unvermögen, den semantischen Gehalt des gelesenen Textes angemessen zu verstehen. Er argumentierte, dass infolge der Vereinheitlichung der Orthographie bei gleichzeitiger enormer Zunahme der jiddischen Bildungsinstitutionen die sowjetischen Juden der jiddischen Sprache den Anstoß zu einer gewaltigen semantischen Entwicklung gäben. » Der umgepflügte Boden der 10 Kacyzne 1926 : 302. 11 Ibid. 640 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Sprache « bringe neue Wörter, neue Konzeptionen und ein neues Verständnis der Welt hervor, so Kacyzne. Es entstünden tatsächlich zwei getrennte, undurchdringliche sprachliche Wirklichkeiten, die gegenseitige Verständigung werde unmöglich. Kacyzne sprach sich für die Übernahme der phonetischen Orthographie aus, da der › freie ‹ Gebrauch der hebräischen Komponente die Elastizität des Jiddischen vergrößere und eine dynamische Entwicklung der Sprache ermögliche. Die Übernahme des sowjetischen Systems befürwortet auch der Verfasser des dritten und letzten Artikels in dieser Diskussion, der Wilnaer Sozialaktivist und Lehrer Falk Halpern.12 Bereits vor der Sprachkonferenz in Czernowitz 1908 hatte er das Projekt einer phonetischen Schreibreform entworfen. Jedoch weder das Warschauer Blatt ‫דער‬ ‫טאג‬ ָ noch das progressive Presseorgan des » Bund « ‫לקסצײטונג‬ ַ ‫א‬ ָ waren im Jahre 1907 bereit, seine Ideen zu publizieren. Die Redaktion der ‫לקסצײטונג‬ ַ ‫א‬ ָ äußerte Halpern gegenüber sogar die Befürchtung, die Reform könnte als eine zu radikale Abkehr von mit der jüdischen Tradition verstanden und der Zeitung der Vorwurf gemacht werden, sie leiste der Ignoranz Vorschub.13 Halpern behauptete dagegen, dass der Gebrauch phonetischer Schreibweisen hebräischer Wörter in der jüdischen Bevölkerung weit verbreitet sei. Die Sanktionierung dieser allgemeinen Praxis würde die einfachen Schichten des jüdischen Volks von der ungerechten Stigmatisierung als › ungebildete Masse ‹ befreien. Er schreibt : 14 ‫לאגישער וויסנ־‬ ָ ‫ילא‬ ָ ‫ראגע ון דער‬ ַ ‫רעארם איז נישט קײן‬ ָ ‫ראגע ון דער‬ ַ ‫די‬ ‫נסטאטירן און דער־‬ ַ ‫קא‬ ָ ‫נאר‬ ָ ,‫רשרײבן געזעצן‬ ַ ‫א‬ ַ ‫זאך איז נישט‬ ַ ‫וואס איר‬ ָ ,‫שאט‬ ַ ‫טראנסקריפּציע וועלכע איז ון ָאנהײב‬ ַ ‫ ַאז די ייִ דישע‬,‫אקט איז‬ ַ ‫ ַא‬.‫אקטן‬ ַ ‫קלערן‬ ‫ווײטערדיקער ַאנטוויקלונג‬ ַ ‫ איז אין איר‬,‫סילאבישע‬ ַ ‫ ַא‬,‫ָאן געווען ַא העברעיִ שע‬ ‫זאלן די העברעיִ שע עלעמענטן‬ ָ ‫וואס‬ ָ ‫אר‬ ַ .‫קלאנגסיסטעם‬ ַ ‫אינגאנצן ַאוועק צום‬ ַ ‫נטוויקלונגס־גאנג – איז‬ ַ ‫דאזיקן ַא‬ ָ ‫זײן ון דעם‬ ַ ‫אויסגעשלאסן‬ ָ ‫שפּראך‬ ַ ‫ון אונדזער‬ .‫נישטא‬ ָ ‫קײן פּרינציפּיעלער טעם‬ 12 Falk Halpern ( Neshvizh 1876 – Tel Aviv 1945 ) – Schriftsteller, Publizist, Übersetzer ; erhielt eine traditionelle jüdische Erziehung ; weltliches Wissen erwarb er durch Selbststudium ; ab 1904 arbeitete er als Lehrer in Minsk, Wilna, Sankt Petersburg. Während des Ersten Weltkriegs gründete er in der russischen Stadt Tambow eine Bibliothek für Flüchtlingskinder. Im Jahre 1918 wurde er zum Leiter des jiddischen Schulwesens in der Ukraine ernannt ; daneben gründete er in Jekaterinoslaw ( heute Dnipropetrowsk ) einen jiddischen Verlag, der vor allem Kinderliteratur veröffentlichte. 1921 wurde er als Ausbilder am Wilnaer jiddischen Lehrerseminar angestellt ; in Zusammenarbeit mit Shloyme Bastomski gründete er die Kinderzeitschrift ‫גרינינקע ביימעלעך‬. 1937 zog er nach Tel Aviv, wo er bis zu seinem Tode als Schriftsteller und Publizist tätig war. Außerdem übersetzte er u. a. Werke von Nikolai Gogol, Jakob Grimm, Friedrich Schiller, Mark Twain, Oscar Wilde und August Strindberg ins Jiddische und Hebräische. 13 Halpern 1926 : 333. 14 Ibid. Aleksandra Geller : Die Literarishe bleter und die jiddische Orthographie 641 Das Kernargument in Halperns Ausführungen gründet in der Annahme einer gegenseitigen Abhängigkeit von Schreibweise und sozialer Gleichheit. Dem ist zuzustimmen, denn die Fähigkeit zum korrekten Schreiben von Wörtern hebräischer Herkunft setzt eine entsprechende religiöse Bildung voraus, und damit die Kenntnis ( der Grundlagen ) des Hebräischen und den Erwerb einer gewissen Routine im Gebrauch dieser Sprache. Obwohl im Prinzip alle Jungen den kheyder besuchten, lernten die meisten von ihnen kaum mehr als die wichtigsten Segenssprüche und Gebete zu lesen und zu sprechen.15 Demnach konnte sich nur eine Minderheit frei und korrekt der jiddischen Sprache schriftlich bedienen, die in ihrer literarischen und publizistischen Version – gemäß der Stilistik des 19. Jahrhunderts – reich geschmückt sein sollte mit Ausdrücken und Wendungen hebräischer Herkunft. Daher waren die Zielgruppen der zu jener Zeit durchaus attraktiven sozialistischen und kommunistischen Bewegungen – Gruppen wie Arbeiter, oder Handwerker, ( sog. einfache Leute [ ‫לײט‬ ַ ‫פּראסטע‬ ָ ] und arbeitende Massen [ ‫מאסן‬ ַ ‫ – ) ] ַארבעטנדיקע‬durch ihre mangelnde Sprachkompetenz von der aktiven Teilnahme an der öffentlichen Debatte ausgeschlossen. Keine Zeitung würde einen Text voller Fehler drucken – argumentierte Halpern. Obwohl der Autor das nicht geradeheraus sagte, lässt sich aus seinen Worten schließen, dass die Einführung einfacher Orthographieregeln, vor allem die Aufhebung der besonderen Rechtschreibung der hebräischen Wörter seiner Meinung nach zur Emanzipation der unteren Gesellschaftsschichten beitragen könnte. Auf diese Weise könnten die Stimmen aller Gesellschaftsgruppen auf einem öffentlichen Forum als gleichberechtigt anerkannt werden. Eine völlige Gleichbehandlung aller Wörter des Jiddischen, ihre Unterordnung unter eine einheitliche Rechtschreibung würde letztlich die Aufhebung der privilegierten Stellung der gebildeten Schichten bedeuten. Man könnte also auf diesem Wege völlige gesellschaftliche Gleichheit erreichen, so Halperns utopische Vorstellung. Solche Überlegungen stehen auch im Zusammenhang mit der von allen drei Autoren berührten Frage der gewandelten Stellung des Hebräischen im gesellschaftlichen Bewusstsein. Die im 19. Jahrhundert schnell fortschreitende Säkularisierung des jüdischen Lebens einerseits und das Aufkommen einer Bewegung zur Wiederbelebung des Hebräischen als gesprochener Sprache andererseits trugen zur › Entheiligung ‹ der hebräischen Sprache bei. Auch in der Sowjetunion, wo die Behörden gemäß der neuen Ideologie alle Anzeichen von Religiosität bekämpften, wurde der Übergang zur phonetischen Orthographie be15 Vgl. Stampfer 1993. 642 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ trieben. Traditionell geschriebene Wörter aus dem Hebräischen – d. h. gewöhnlich in der in der hebräischen Bibel und dem Talmud gebrauchten Schreibweise – waren ja unmittelbar mit der religiösen Sphäre verbunden. Sie waren der augenfällige Ausdruck des lehavdl-Prinzips und verwiesen auf die Einzigartigkeit und Nichtalltäglichkeit, kurz die Sonderstellung des Hebräischen in einer neuen Weltordnung, in der Gleichheit die Parole war. Eine so tiefe Verwurzelung des Religiösen in der Sprache war aus ideologischen Gründen nicht nur unerwünscht, sie war mit den neuen politischen Verhältnissen schlicht nicht vereinbar. Wie sollte man denn aus dem Leben der Menschen die Religion und die mit ihr verbundene speziĳische Lebensweise eliminieren, wenn in fast jedem Satz ihrer Sprache ein Wort erschien, das ihnen die Religion vergegenwärtigte ? Die Lösung lag auf der Hand : Die phonetische Schreibweise der hebräischstämmigen Wörter würde diese mit einem Schlag ihrer Sonderstellung und damit umso leichter auch ihrer religiösen Konnotation berauben. Einige Monate nach der Serie zum Thema › phonetische Orthographie ‹ erschien in der Zeitschrift ‫ליטערארישע בלעטער‬ ַ ein Artikel des in London wohnenden Publizisten Leo Kenig unter dem vielsagenden Titel ‫לאגיק‬ ָ ‫סענטימענט און‬. Gegenstand des Beitrags waren diesmal nicht die real vorhandenen Unterschiede in der Schreibweise von Wörtern hebräischer Herkunft, sondern eher hypothetische Überlegungen über die Möglichkeit, die hebräischen Schriftzeichen überhaupt aufzugeben und zum lateinischen Alphabet überzugehen. Kenig reagierte mit seinem Artikel auf den Vorschlag einer Latinisierung des jiddischen Alphabets, die Chaim Zhitlowsky einige Wochen zuvor in der New Yorker Zeitung ‫טאג‬ ָ ‫ דער‬veröffentlicht hatte. Ideen einer radikalen Reform der jiddischen Orthographie wurden nicht allein in der Sowjetunion entwickelt, sondern auch jenseits des Atlantiks.16 Nach Einschätzung Kenigs war der Vorschlag einer Latinisierung der jiddischen Schrift im Jahre 1926 keine Ungeheuerlichkeit mehr wie noch ein Jahrzehnt zuvor, als der Schriftsteller Dovid Pinski einen ähnlichen Gedanken vorbrachte. Kenig gab zwar zu, dass die im Titel seines Beitrags erwähnte emotionale Anhänglichkeit ( ‫ ) סענטימענט‬an das hebräische Alphabet verständlich sei, dennoch führte er eine Reihe rati16 Zhitlowsky war, nebenbei bemerkt, nicht der erste, der mit der Idee einer Latinisierung jiddischen Schrift hervortrat. Dies war der Esperantogründer Ludwig Zamenhof. Im Jahre 1909 veröffentlichte Zamenhof unter einem Pseudonym in der jiddischen elitären Monatsschrift ‫וויסנשאט‬ ַ ‫ לעבן און‬sein Projekt einer Schreibreform des Jiddischen, welches heftige Ablehnung unter den Lesern auslöste. Mehr dazu vgl. Katz 1994. Aleksandra Geller : Die Literarishe bleter und die jiddische Orthographie 643 onaler ( › logischer ‹ ) Argumente zugunsten von Zhitlowskys Vorschlag an. Zum ersten, schrieb Kenig,17 ‫אײראפּעיִ שע‬ ָ ‫ ַאז ייִ דיש איז אין תּוך גענומען ַאן‬,‫ארגעסן איז‬ ַ ‫טארן נישט‬ ָ ‫וואס מיר‬ ָ ‫שטארקן העברעיִ שן עלעמענט‬ ַ ‫האט ַא‬ ָ ‫ זי‬,‫ אמת‬.‫זיאטישע‬ ַ ‫שפּראך און נישט קײן ַא‬ ַ ‫ ווען ער טוט‬,‫אײראפּעיִ ש געקלײדטן ייִ דן‬ ָ ‫מאדערנעם‬ ָ ‫דערמאנט ָאן דעם‬ ָ ‫אין זיך און‬ ‫ ָאבער דער העברעיִ שער עלע־‬.‫ריענטאלישן טליתל‬ ַ ‫מאל אין ַא יום־טו! ַאן ָא‬ ָ ‫ָאן ַא‬ ‫ פּונקט ווי ָאט דער על־‬,‫מאדערנעם ייִ דיש‬ ָ ‫מענט וועפּט זיך ַאלץ מער אויס ונעם‬ .( ‫פּאלעסטינע‬ ַ ‫הײנטיקן ייִ דישן לעבן ) אויסער‬ ַ ‫עמענט ווערט ַאלץ קלענער אינעם‬ — ‫לאטיניזירט — ריכטיקער‬ ַ ‫דאס ייִ דישע לעבן ווערט ַאלץ מער און מער‬ ָ ‫ די‬,‫אײראפּעיִ שן מלבוש‬ ָ ‫לאנג דעם‬ ַ ‫טראגט שוין‬ ָ ‫דאס ייִ דישע לעבן‬ ָ ; ‫אײראפּעיִ זירט‬ ָ ‫מאדערנע‬ ָ ‫ די‬,‫שפּראך‬ ַ ‫זאל די ייִ דישע‬ ָ ‫רוואס‬ ָ ‫א‬ ַ — ‫אײראפּעיִ שע אויסערלעכקײט‬ ָ ‫נאך ַאלץ צירן מיט די שײנע‬ ָ ‫ליטעראטור זיך‬ ַ ‫אײראפּעיִ זירטע ייִ דישע‬ ָ ‫גאר‬ ָ ‫גאנץ און‬ ַ ‫ וועלכע קלײדט איר שוין‬,‫עקזאטישער עטרה‬ ָ ‫גאלדענער‬ ָ ‫ מיט דער‬,‫ראבעסקן‬ ַ ‫ַא‬ ? ‫נישט‬ Wenn Kenig Jiddisch als eine europäische Sprache bezeichnet, spielt er nicht einfach darauf an, dass es zur indoeuropäischen Sprachfamilie gehörte. Es ging ihm eher darum, orientalische Konnotationen aus der jiddischen Sprache und Kultur zu entfernen. Daher ĳinden wir im zitierten Fragment eine ganze Sammlung orientalisierender Bezeichnungen für die jüdische Kultur – › asiatisch ‹, › orientalisch ‹, › exotisch ‹, › Arabeske ‹ und › goldene Gewänder ‹. Ihnen stehen zwei Begriffe gegenüber, die nach Meinung des Autors den Rahmen der jiddischen Kultur markieren – › europäisch ‹ und › modern ‹. Kenig behauptet weiter, die hebräischen Schriftzeichen stellten – historisch betrachtet – die national-religiöse Form dar, die es erlaubte, die Umgebungssprachen sowie die von ihnen getragenen Inhalte aufzusaugen und der jüdischen Kultur gemäß umzugestalten. Er fügt jedoch hinzu, dass man gegenwärtig keine › Autonomie des Alphabets ‹ brauche. Er argumentierte damit, dass in Europa und Amerika das jüdische Alphabet bedeutend schneller absterbe als die jiddische Sprache selbst. Dabei dachte er offenbar an die fortschreitende Assimilation, sei es bei den Nachfahren der jüdischen Einwanderer in Amerika oder den jüdischen Gemeinschaften in Westeuropa ( darunter auch in seinem Wohnort London ), sei es bei den akkulturierten Juden in Osteuropa. Aus dem Argument, dass die Kenntnis des hebräischen Alphabets zurückgehe, postuliert er im Fall einer Latinisierung einen Zuwachs an Lesern jiddischer Literatur. Mehr über diese Frage wird, wie im Weiteren auszuführen ist, Alter Kacyzne in seiner Antwort auf Kenigs Artikel zu sagen haben. 17 Kenig 1926 : 765 f. 644 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Das nächste von Kenig vorgebrachte Argument hat mit Pädagogik zu tun. Er schreibt : 18 ‫ מוזן עס‬,‫זײן קינד ייִ דיש‬ ַ ‫וואס וויל לערנען‬ ָ ,‫אטער‬ ָ ‫זאל דער‬ ָ ‫וואס‬ ָ ‫אר‬ ַ ‫נאטירלעכער‬ ַ ‫ס’וואלט יל‬ ָ ‫ ווען‬,‫צײט‬ ַ ‫ אין דער‬,‫לאבעטן‬ ַ ‫מאטערן מיט צווײ ַא‬ ַ ‫טײנישע‬ ַ ‫לא‬ ַ ‫ ווען זי ווערט געשריבן אין‬,‫און יל גרינגער זיך אויסלערנען ייִ דיש‬ .‫בוכשטאבן‬ ַ Diese Bemerkung ist sehr interessant, denn sie zeigt, dass sich nach Kenigs Auffassung der Status des Jiddischen innerhalb der jiddischen Sprachgemeinschaft verändert hat : Zum einen ist das Erlernen des hebräischen Alphabets und damit der Fähigkeit, Jiddisch zu schreiben, nach Kenigs Auffassung nicht ( mehr ) institutionalisiert. Es ĳindet zu Hause statt, nicht in der Schule oder einer anderen Lehranstalt, was ein Bruch mit der aschkenasischen kheyder-Tradition zu sein scheint. Zum anderen scheint es nach Kenigs Darstellung gegenüber der Aneignung des lateinischen Alphabets zweitrangig geworden zu sein. Eine solche Auffassung verwundert nicht angesichts der Tatsache, dass jüdische Kinder in Amerika und Westeuropa überwiegend Schulen besuchten, in denen die Unterrichtssprache eine europäische Landessprache war. Für Osteuropa, einschließlich der Sowjetunion, trifft diese Behauptung nur teilweise zu. In den 1920er Jahren besuchten ca. hunderttausend Kinder die sowjetischen jiddischsprachigen Schulen. In Polen besuchte trotz der Einführung der staatlichen weltlichen Erziehung weiterhin ein beträchtlicher Teil der jüdischen Kinder Religionsschulen.19 Eine gravierende Folge der Latinisierung des Jiddischen, die Kenig allerdings nicht ausdrücklich hervorhebt, ist der Verlust der Fähigkeit, sich verschiedener Zeichensysteme zu bedienen, und somit das Herausreißen des jüdischen Kindes aus der Mehrsprachigkeit – auch in graphemischer Hinsicht, also der Verlust einer Fähigkeit, deren Erwerb für die Generationen seiner Vorfahren eine Selbstverständlichkeit war. Von Interesse ist überdies, dass Kenig dem Jiddischen den ehemaligen Status des Hebräischen zuschreibt, indem er den Vater, der bislang allein dafür verantwortlich war, seinen Söhnen die hebräische Bibel weiterzugeben, zum Jiddischlehrer ernennt. Das letzte von Kenig angeführte Argument nimmt Bezug auf den Kampf zwischen Jiddischisten und Hebraisten um kulturelle Vorherrschaft.20 18 Kenig 1926 : 766. 19 Pinkus 1988 : 108 ; Mendelssohn 1987 : 66. 20 Ibid. Aleksandra Geller : Die Literarishe bleter und die jiddische Orthographie 645 ‫כראנישע מחלוקת צווישן‬ ָ ‫קאנקורענץ און די‬ ָ ‫וואלט ָאפּגעשטעלט די‬ ָ ‫רעארם‬ ָ ‫די‬ ‫ ַאז‬,‫קלאר‬ ָ ‫געווארן‬ ָ ‫מאל‬ ָ ‫אר ַאלע‬ ַ ‫מאל‬ ָ ‫וואלט אונדז אײן‬ ָ ‫ עס‬.‫ייִ דיש און העברעיִ ש‬ ‫אײראפּעיִ שע ייִ דנטום‬ ָ ‫דאס‬ ָ ‫ פּונקט ווי‬,‫באזונדערע לשונות‬ ַ ‫די צווײ לשונות זענען‬ .‫פּאלעסטינער — העברעיִ ש‬ ַ ‫דאס‬ ָ ‫אײראפּעיִ ש און‬ ָ ‫וועט מוזן מער און מער ווערן‬ ‫טראכטן ווי ַא מין‬ ַ ‫בא‬ ַ ‫ אויהערן זי‬,‫וואס גלויבן אין ייִ דיש‬ ָ ,‫דאך די‬ ָ ‫סוף ־ כּל ־ סוף מוזן‬ .‫רגאנגענהײט און אונדזער צוקונט‬ ַ ‫א‬ ַ ‫בריק צווישן אונדזער‬ Die Feststellung, dass Jiddisch und Hebräisch zwei getrennte Sprachen seien, erscheint aus linguistischer Sicht selbstverständlich. Sie erhält jedoch eine besondere Bedeutung im Kontext der aschkenasischen Kultur, deren drei jüdische Sprachen – Hebräisch, Aramäisch und Jiddisch – einander jahrhundertelang durchdrangen und ergänzten und so eine im wesentlichen untrennbare Ganzheit schufen. Das Jiddische hatte nicht nur viele hebräische Wörter in sich aufgenommen, es wurde auch in Morphologie und Syntax vom Hebräischen geprägt. Auf diese Weise bildeten sich innerhalb des Jiddischen verschiedene Sprachregister heraus. Damit stand dem Sprecher des Jiddischen eine reiche Palette von Synonymen und Ausdrucksmöglichkeiten mit fein nuancierten Bedeutungen zur Verfügung – ein Zeichen der linguistischen Reife und Selbständigkeit dieser Sprache. Die seit dem Ende des 19. Jahrhunderts fortschreitende Politisierung des Sprachgebrauchs innerhalb der jüdischen Welt wies die beiden Sprachen gegensätzlichen ideologischen Lagern zu und führte zum Zerreißen des sprachlichen Gewebes der aschkenasischen Kultur. Für Kenig bestand bereits eine scharfe Trennungslinie zwischen europäischen und palästinensischen Juden. Damit sagte er gewissermaßen das Ende der jahrhundertealten aschkenasischen Kultur voraus, deren konstituierender Zug das Miteinander von drei jüdischen Sprachen war. Kenigs Ausführungen lassen jedoch die entscheidenden Fragen offen : Was soll – jenseits von Muttersprache und Raum – das › europäische ‹ Judentum zu einem › europäischen ‹ und das › palästinische ‹ Judentum zu einem › hebräischen ‹ machen ? Welche Autorität oder welche Merkmale sollten über die Zugehörigkeit zu einer der beiden Gruppen entscheiden ? Kenig führt den Gedanken einer grundlegenden Trennung von › europäischem ‹ und › palästinischem ‹ Judentum nicht zu Ende. Vielmehr operiert er mit der Gegenüberstellung von › modernem ‹ Jiddisch und › orientalischem ‹ Hebräisch in einer Weise, die unterstellt, dass die von ihm postulierte Entwicklung nicht aufzuhalten sei. Indem der Autor die › Europäisierung ‹, d. h. die Akkulturation und letzten Endes auch die Assimilation an die von der nicht-jüdischen Mehrheit getragenen Nationalkultur, auf der einen Seite und die Ver- 646 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ wirklichung des zionistischen Ideals auf der anderen Seite einander dichotom gegenüberstellte, blendete er im Grunde die Vielschichtigkeit der jiddischen Kultur aus. Und er sprach ihr mit seiner Forderung, sie müsse aufhören, sich als Bindeglied zwischen Vergangenheit und Gegenwart zu verstehen, das Recht ab, die Erbin der in Auflösung begriffenen aschkenasischen Tradition zu sein. In auffälliger Konsequenz verwendet Kenig in seinem Artikel für die beiden Schriftsysteme unterschiedliche Bezeichnungen. Im Zusammenhang mit der lateinischen Schrift gebraucht er die aus dem Deutschen stammenden Ausdrücke ‫ שריט‬und ‫בוכשטאבן‬ ַ , während er in Bezug auf die hebräische Schrift nur von ‫ ַאלף ־ בית‬und ‫ אותיות‬spricht, also die hebräischen Ausdrücke verwendet. Wenn von beiden Schriftarten die Rede ist, gebraucht Kenig die › neutrale ‹ Bezeichnung ‫לאבעט‬ ַ ‫ ַא‬, die in den meisten europäischen Sprachen als Internationalismus vorkommt, letzten Endes jedoch auf semitische ( phönikische ) Wortstämme zurückgeht. Das ist ein Beispiel für den im Jiddischen häuĳig anzutreffenden semantischen Parallelismus, bei dem zur Bezeichnung ein- und derselben Erscheinung verschiedene Wörter benutzt werden, je nachdem, ob der betreffende Gegenstand zur jüdischen Kultur und Lebenswelt gehört oder zur Welt der Nicht-Juden. Es stellt sich die Frage, inwieweit Kenig die beiden Schriftsysteme auseinanderhaltende Terminologie von einem tief empfundenen Gefühl der Fremdheit gegenüber der lateinischen Schrift zeugt, das er trotz des rationalen Strebens nach Reform in der Sprache und somit auch im Denken seiner Glaubensgenossen, nicht zu überwinden vermag. Eine solche Zwiespältigkeit scheint Alter Kacyzne nicht zu belasten. In seiner Antwort auf Kenig führte er keine semantische Trennung von › eigenen ‹ und › fremden ‹ Buchstaben ein. Bereits mit der Überschrift seines Artikels ” ? ‫טײנישע אותיות‬ ַ ‫לא‬ ַ ‫ „ ייִ דישע צי‬verlieh er beiden Alphabeten den Status potentiell gleichberechtigter Träger der jiddischen Sprache. Kacyzne eröffnet seine Erwiderung mit dem Argument, dass im Grunde die Juden bereits im Altertum ihre Schrift von den sie umgebenden Völkern übernommen hätten. Das hebräische Alphabet sei nämlich die umgeformte assyrische Schrift und das mittelalterliche vaybertaytsh ( die aschkenasische semikursive Druckschrift, die vor allem für das Jiddische Verwendung fand ) sei unter dem starken Einfluss der gotischen Schrift geformt worden. Bei dieser Argumentation übersieht Kacyzne, dass die Änderungen der Schrifttype in Altertum und Mittelalter keine einfache Übernahme einer fremden Schrift waren, sondern Umformungen des eigenen Alphabets ( möglicherweise unter dem Einfluss von Mustern von außerhalb ). Das Ergebnis solcher Änderungen war immer ein ausschließlich jüdisches Alphabet. Daher Aleksandra Geller : Die Literarishe bleter und die jiddische Orthographie 647 ist die Behauptung, Latinisierung sei einfach ein weiteres Glied in der jahrhundertelangen Kette von Veränderungen in der jüdischen Schrift, unüberlegt. Schon überzeugender ist sein Argument hinsichtlich der Frage, was mit einer Latinisierung erreicht werden könne. Kacyzne schreibt nämlich,21 ‫נײערע ענדערונג ון ַאלף־בית זענען נישט געווען‬ ַ ‫נישט די עלטסטע און נישט די‬ .‫טעארעטישן פּועל־יוצא‬ ָ ‫ ָאדער צוליב ַא‬,‫קאפּריז‬ ַ ‫רײנגעירט צוליב עמעצנס‬ ַ ‫ַא‬ ‫דאס גע־‬ ָ ‫ארברײטערן‬ ַ ‫געווארן ווי ַא מיטל צום‬ ָ ‫טראכט‬ ַ ‫בא‬ ַ ‫די ענדערונגען זענען‬ .‫ווארט‬ ָ ‫שריבענע ייִ דישע‬ Ob die Einführung des lateinischen Alphabets zu einer Erhöhung der Zahl jüdischer Leser von jiddischer Literatur führen würde, fragt Kacyzne weiter, um auf eine potentielle Zielgruppe transliterierter jiddischer Bücher hinzuweisen : die jüdischen Leserinnen aus der Mittelklasse. Der Gedanke, assimilierte polnische Jüdinnen an die jiddische Literatur heranzuführen, taucht in der Zeitschrift ‫ליטערארישע בלעטער‬ ַ bereits vor der Orthographiedebatte auf.22 Schon im ausgehenden 19. Jahrhundert erhielten Mädchen, die ja nicht zu einer religiösen Ausbildung verpflichtet waren, in wohlhabenden Häusern eine weltliche Bildung, die die Kenntnis nicht-jüdischer Sprachen sowie die Kenntnis der klassischen europäischen Literatur einschloss.23 Solche Frauen mit moderner weltlicher Bildung wurden in vielen jüdischen Familien zu Vorreiterinnen der Assimilation. Nach Ansicht der Publizisten, die über das Leseverhalten der jüdischen Bevölkerung schrieben, gehörten gerade die Frauen der Mittelschicht zu den Hauptlesern von schöner Literatur und von Kulturzeitschriften, zumeist jedoch solchen in nicht-jüdischen Sprachen.24 Daher machte Kacyzne den Vorschlag, versuchsweise beliebte jiddische Romane in zwei Versionen drucken zu lassen – einmal in hebräischen und einmal in lateinischen Buchstaben. Die Geschichte 21 Kacyzne 1926a : 786. Es ist schwer zu beurteilen, ob bei ” ‫ווארט‬ ָ ‫דאס געשריבענע ייִ דישע‬ ָ „ im Original das Adjektiv ‫ ייִ דישע‬im engen › jiddischen ‹ oder im weiteren › jüdischen ‹ Sinn zu verstehen ist. Natürlich kann in Bezug auf das Altertum nicht vom Jiddischen die Rede sein, dagegen war im Mittelalter die Einführung einer neuen Schriftart eng verbunden mit der Entstehung der jiddischen Literatur. Ebenso sollte die Latinisierung der Verbreitung gerade der jiddischen Sprache dienen. 22 Vgl. Alperin 1926 : 81 f. 23 Mehr dazu z. B. Parush 2004. 24 Alperin beklagte, dass im Warschauer Verlag » Orient« eine Serie » Kleine Bibliothek der Klassiker der jiddischen Literatur « auf Polnisch erschien. Diese sollte zwar die assimilierte Jugend mit der jiddischen Literatur bekannt machen, aber die Qualität der dort vorgestellten Texte sei so fatal, dass sie gerade das Gegenteil bewirke. Deshalb sollte man die Jugend ermuntern, nach den Originalen in jiddischer Sprache zu greifen. 648 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ des Themas › Frauen und die jiddische Literatur ‹ beschreibt einen eigentümlichen Kreis : In den frühen Anfängen erzwang die Existenz der jiddischen Literatur, geschrieben – zumindest nominell – für Frauen, die Entstehung einer speziellen Drucktype, jetzt wollte man umgekehrt durch Abschaffung der jüdischen Schrift die jiddische Literatur ihren ersten Abnehmerinnen, den Frauen, zugänglich machen. Im Gegensatz zu Kenig, der glaubte, man könne die Latinisierung der Orthographie nur › von oben ‹ einführen, allerdings mit Zustimmung von Vertretern aller mit der jiddischen Kultur verbundenen Kreise, behauptet Kacyzne, eine solche Reform habe ausschließlich als eine › von unten ‹ kommende Bewegung Aussicht auf Erfolg. Für Kaczyzne stand im Vordergrund, potenziellen Lesern den Zugang zu jiddischer Literatur und Presse zu erleichtern, und nicht das hebräische Alphabet vollständig durch das lateinische zu ersetzen. Er übersah jedoch nicht die Gefahren einer Latinisierung, zu denen er eine fortlaufende Zersplitterung der jiddischen Kultur zählte. In der Sowjetunion, wo viele der nicht-jüdischen Sprachen kyrillisch geschrieben würden, würde ein Übergang zum lateinischen Alphabet den dortigen Juden keinerlei Vorteile bringen.25 In den Ländern mit lateinischer Schrift erhebt sich jedoch die – übrigens bis heute ungelöste – Frage nach der Art der Transkription. Es wäre unmöglich, die jiddische Orthographie in jedem Land jeweils der Phonetik bzw. Graphemik und den diakritischen Zeichen der nicht-jüdischen Landessprache anzupassen.26 Genauso wenig lassen sich Kriterien aufstellen, anhand derer die Überlegenheit der polnischen, englischen, rumänischen, ungarischen oder deutschen Schreibweise des Jiddischen gegenüber den jeweils anderen festzustellen wäre. Die hier vorgestellten Texte geben nur einen knappen Ausschnitt aus der vielseitigen und tiefschürfenden Diskussion, die in den Spalten der Zeitschrift ‫ליטערארישע בלעטער‬ ַ über die Sprache und ihre Rolle bei der Gestaltung jiddischer Kultur und Identität geführt wurde. Die vorgebrachten Überlegungen sind nicht zuletzt deswegen von Interesse, weil die grundlegende Erfahrung der jüdischen Gesellschaft in Osteuropa die andauernde innere Mehrsprachigkeit war. Darüber hinaus kamen die aschkenasischen Juden mit verschiedenen nicht-jüdischen Umgebungssprachen in Kontakt – mit den lokalen Mundarten, volkstümlichen Sprachvarietäten z. B. der Bauern und Kleinstädter, ebenso wie mit den gepflegten sprachlichen Formen der Hochkultur. In den 25 In der Sowjetunion wurde das Projekt einer Latinisierung des Jiddischen wiederholt diskutiert, jedoch ohne ernsthafte Realisierungsversuche ; mehr dazu s. Shneer 2004 : 81 – 87, Estraikh 1999. 26 Kacyzne 1926 a : 787. Aleksandra Geller : Die Literarishe bleter und die jiddische Orthographie 649 Verschiebungen dieser soziolinguistischen Strukturen haben, wie sich zusammenfassend feststellen lässt, alle wesentlichen gesellschaftlichen Änderungen im Kontext einer als umfassend verstandenen Modernisierung der osteuropäischen Juden ihren Anfang genommen. Zitierte Literatur Alperin, Aron, 1926 : » Der kamf far a yidisher lezerin. « In : Literarishe bleter 91 : 81 f. Borokhov, Ber, 1913 : » Di ufgabn fun der yidisher ĳilologye. « In : Shmuel Niger, Hg., Der Pinkes. Yorbukh far der geshikhte fun der yidisher literatur un shprakh, far folklor un bibliografye. Wilna : B. Kletskin. Estraikh, Genndy, 1999 : Soviet Yiddish : Language Planning and Linguistic Development. Oxford : Oxford University Press. Even Zohar, Itamar, 1990 : » Aspects of the Hebrew-Yiddish Polysystem : A Case of a Multilingual Polysystem. « In : Poetics Today 11 ( 1 ) : 121 – 130. Halpern, Falk, 1926 : » Vegn hebreishn oysleyg in yidish. « In : Literarishe bleter 107 : 333. Kacyzne, Alter, 1926 : » Tsi darf men endern di yidishe ortografye ? « In : Literarishe bleter 105 : 302. – 1926a : » Yidishe tsi lataynishe oysyes. « In : Literarishe bleter 134 : 786 f. Kalmanovitsh, Zelig, 1925 : » Nay-yidish. « In : Literarishe bleter 66 : 3 f ; 67 : 21 f ; 68 : 41 f ; 69 : 53, 55. Katz, Dovid, 1993 : Tikney takones. Fragn fun yidisher stilistik. Oxford : Oksforder yidish. Katz, ( Hirshe- ) Dovid, 1994 : » Yidish un Esperanto. Di yidishe gramatik fun dr. Ludwik ( Leyzer ) Zamenhof. « In : Forverts, 28. Januar : 13, 23 ; 11. Februar : 13, 20. Kenig, Leo, 1926 : » Sentiment un logik. « In : Literarishe bleter 133 : 765 f. Lerer, Moyshe, 1925 : » Efsher azoy arumert ? Tsu Z. Kalmanovitshs artikl › Nay yidish ‹. « In : Literarishe bleter 71 : 94. Mendelssohn, Ezra, 1987 : The Jews of East Central Europe Between the World Wars. Bloomington : Indiana University Press. Neuberg, Simon, 1999 : Pragmatische Aspekte der jiddischen Sprachgeschichte am Beispiel der Zenerene. Hamburg : Buske. Niger, Shmuel, 1925 : » Dos geredte un geshribene vort. « In : Literarishe bleter 72 : 98 – 100 ; 74 : 137 – 139. Olson, David, 1994 : The World on Paper. The Conceptual and Cognitive Implications of Writing and Reading. Cambridge : Cambridge University Press. 650 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Parush, Iris, 2004 : Reading Jewish Women. Marginality and Modernization in Nineteenth-Century Eastern European Jewish Society. Waltham, ma. : Brandeis University Press. Pinkus, Benjamin, 1988 : The Jews of the Soviet Union. The History of a National Minority. Cambridge : Cambridge University Press. Schaechter, Mordkhe, 1999 : Der eynhaytlekher yidisher oysleyg. New York : yivo. Shmeruk, Chone, 1989 : » Hebrew – Yiddish – Polish : A Trilingual Jewish Culture. « In : Israel gutman, Ezra mendelsohn, Jehuda reinharz und Chone shmeruk, Hg., The Jews of Poland Between Two World Wars. Hanover – London : University Press of New England, 285 – 311. Shneer, David, 2004 : Yiddish and the Creation of Soviet Jewish Culture, 1918 – 1930. Cambridge : Cambridge University Press. Singer, Israel Yoshua, 1926 : » A vikhtike frage. « In : Literarishe bleter 103 : 260 f. Stampfer, Shaul , 1993 : » What did › knowing Hebrew ‹ mean in Eastern Europe ? « In : Lewis Glinert, Hg., Hebrew in Ashkenaz : A Language in Exile. New York : Oxford University Press, 129 – 140. Asya Vaisman “ A is for the Almighty ” Transmitting Values through Contemporary Hasidic Children ’ s Literature ,‫לאמיר לײענען‬ ָ ,‫קינדערלעך‬ ,‫וואס די מעשׂה טוט מײנען‬ ָ ‫ארשטײן‬ ַ ,‫לאמיר הערן‬ ָ ,‫קינדערלעך‬ ! ‫ווי ַאזוי גוטע ייִ דן צו ווערן‬ Children, let ’ s read, Let ’ s understand what the stories mean, Children, let ’ s hear How to become good Jews ! Thus reads the ĳirst stanza of the introductory poem in books from the ‫ ( לײענען און לערנען‬Reading and Learning ) series distributed by Kinder Shpiel ( Children ’ s Games ) of Monsey, New York. These brightly-illustrated Yiddish books, sold in stores throughout Williamsburg and Borough Park, Brooklyn, serve the Hasidic communities in these neighborhoods. Yiddish is the vernacular for most of the Hasidic groups that live in these areas, and this series, along with several others, provides entertaining didactic materials for children growing up in an insular society. Because of their desire to protect themselves from potentially harmful outside influences, Hasidim reject texts ( in the broad sense of the word ) written by non-religious Jews. Most communities disallow these works not only because they may communicate, as sociologist George Kranzler notes, “ values, conduct and trends of the outside world, many of which are seen to contradict or violate the spirit or laws of the Torah and the Hasidic tradition, ” but also because of the contemporary Hasidic belief that an author ’ s religious outlook is conveyed through any product of his or her creative expression, even if it is not overtly expressed in the composition itself.1 Thus, as other scholars, such as Miriam Isaacs and Ayala Fader, have noted, only culturally sanctioned, usually culture-internal sources are allowed, particularly for the younger generation, in order to protect them against unwanted influences.2 With the rapid growth of Hasidic communities – many families have as many as twelve children – the need for these permitted materials is ever greater, and the quantity and variety of Hasidic children ’ s books is correspondingly increasing. 1 Kranzler 1994 : 73. 2 Isaacs 1998 : 169 f and Fader 2001 : 262. Fader writes, “ Especially in children ’ s socialization contexts, secular texts are monitored and controlled by parents, rabbis, and teachers. ” 652 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ In addition to producing new works in Yiddish for children, book publishers also issue book series by non-Hasidic religious Jewish authors, translated into Yiddish from English or Hebrew, in order to keep up with demand. These translated works, while almost identical to Hasidic ones in content and subject matter, differ in their writing style, often incorporating more detail and complexity than the Hasidic works, and in their graphic portrayal of religious Jews. A possible reason for the former difference is that the non-Hasidic authors are likely to have a higher level of education and more exposure to secular literature than Hasidic authors, improving their literary abilities. Because of the religious proscription against wasting time, or ‫ביטול ־‬ ‫זמן‬, the ultra-Orthodox children ’ s books are never purely entertaining – each book contains a moral message, a lesson about performing ‫מיצוות‬ ( commandments ), obeying societal regulations, and trusting in God. These messages are reinforced throughout the text of the book and often spelled out in a poem at the end, a feature also common in fables. Hasidic children ’ s books are thus different from secular ones not only in their ‘ kosher ’ content, such as the portrayal of only modestly-dressed females and the observant behavior of the characters, but also in their didactic intent. A chapter from a recently published book of interviews with Hasidic women educators in Israel elaborates on the question of content, relating it to ‫מוש" ־ לצים‬, a concept found in Psalms 1 : 1 that has been interpreted to signify an unproductive activity, one not related to Torah learning or performing commandments.3 The educator links this concept to the idea of using materials only by religious authors, who would never create a work empty of content : 4 Moreinu HaGaon HaRav Nissim Karelitz, shlita, was asked if it is permitted to sing a song that is reik mitochen ( lacking substantial content ) and has nothing posul ( forbidden ) in it. Is this in the realm of moshav leitzim ( a gathering of scoffers ) ? HaGaon, HaRav Nissim, shlita, answered that for boys this is certainly moshav leitzim. For girls, even if it isn ’ t moshav leitzim, it is nevertheless not from our mekoros ( sources ), our chareidi sources. If it ’ s not from our mekoros, then it is certainly not for us. We want to emphasize the point that writers must be chareidim ( meticulously Torah-observant Jews ) with pure hashkofos [ perspectives ]. What we bring to the students must be full of yiras Shomayim [ fear of Heaven ]. 3 Among many other sources, see Šulȟān ‘ ārūkh, hilkhōt šabbāt 307 : 16, which states that non-Jewish literature is prohibited under ‫מוש" ־ לצים‬. 4 “ An Educator Involved in Yiddish Language Programs ” 2006 : 147. Asya Vaisman : “ A is for the Almighty ” 653 In this essay, I would like to look at a number of Yiddish books ( both those written in Yiddish and those translated into Yiddish ) for young Hasidic children aged two to seven. I will categorize these books by series, genre, and theme and analyze their content and style. The study of children ’ s literature in Hasidic communities provides valuable insight into the means used to shape the worldview of the next generation of Hasidic Jews. As the Hasidim are becoming an increasingly signiĳicant component of the Jewish population in their respective countries, a process helped by the low birth and high intermarriage rate among less-observant Jews, it is important to consider their cultural products, particularly within the ĳield of Yiddish, since Hasidic works constitute the majority of Yiddish language material being created today. This essay will examine the way books are used as a didactic tool to instill religious values such as faith and trust in God, to solidify traditional roles and ideals such as unconditionally obeying one ’ s parents, and to create a self-contained world that provides a shield against the threatening influences of the outside secular society. i. Stories of Tsadikim The ĳirst genre explored in this essay, stories of tsadikim ( righteous men ), is somewhat different from the rest : it is the only genre that does not depict the contemporary everyday world of the children, and is instead set in an imagined pre-war Eastern Europe. There are countless books in this genre ; in fact, there are entire series of books dedicated to this topic, such as ‫ ( אור עולם‬Eternal Light ), which includes, in addition to the Ba’al Shem Tov book mentioned below, books on the Seer of Lublin, on Elimelech of Lizhensk, and on the Ruzhiner Rebbe, among a total of sixty-four books. Books in this category follow in the tradition of Hasidic hagiography, which has been a popular genre since the early 19th century. Each book presents a moralistic story in which a Jew runs into trouble, generally with non-Jews, and is ultimately saved, directly or indirectly, by the tsadik. In addition to providing the children with entertaining lessons, as the other genres do, the tsadik books also serve to set Hasidic religious practices in a historical context, legitimizing the authority of contemporary Rebbes by depicting their miracle-working predecessors. As the children read about great wonders worked by the founding fathers of Hasidism, they learn to take pride in their tradition and its roots. 654 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ The books are furthermore linked to the Hasidic past in their structure – most employ the traditional Hasidic form of telling a story within a story, a device used extensively by Rabbi Nahman of Bratslav, among others. The book ‫ ( דער בעל שם טוב‬The Ba ’ al Shem Tov ), for example, starts out by describing the hardships of one impoverished but righteous man as he tries to arrange a marriage for his daughter with no money for her dowry or the wedding feast.5 The Besht ( short for Ba’al Shem Tov ), to whom he goes for advice, tells him a story about a wealthy merchant who forgets his promise to God to give charity and suffers terrible consequences. The merchant happens to be present at this story-telling, recognizes himself as the protagonist, and instantly repents and gives charity in the form of funding the wedding of the poor man ’ s daughter. This plot structure of using one story as the framework for another, with both linked in a common ending, appears both in traditional Hasidic storytelling from Eastern Europe and in Hasidic children ’ s books today. Another noteworthy feature of the tsadikim stories is their overly simpliĳied depiction of Jewish life in Eastern Europe, which often represents the relationship between Jews and non-Jews through the use of stock characters. In these stories, the non-Jews are either dangerous villains out to do Jews harm or neutral law-enforcers who are responsible for removing the villains once God has intervened on the Jews’ behalf, often through the medium of the tsadik. In The Ba’al Shem Tov, for instance, the aforementioned merchant encounters a thief in the forest who threatens to rob and kill him. Only after the merchant prays to God to save his life, promising to give ten percent of his earnings to charity if the prayer is answered, does the forest watchman make an appearance to drag the thief off to jail. The portrayal of Eastern European Jews follows a similar binary delineation. There are the poverty-stricken Jews, who generally seem to be innately righteous and focused only on serving and trusting God, and the more wealthy Jews, who, while they are primarily honorable, are occasionally led astray by their riches. These simplistic portrayals reflect the way Hasidim have re-imagined their Eastern European past : the non-Jewish world is depicted as threatening and perilous to the Jews, and a life of poverty is romanticized as a vehicle for emphasizing the spiritual over the material. This latter lesson is particularly stressed by Hasidic educators to warn children against becoming too habituated to the relative comforts afforded Hasidim in America and thereby losing a more intense spirituality. 5 Hopkowitz n. d. Asya Vaisman : “ A is for the Almighty ” 655 ii. Hasidic Fundamentals As mentioned above, all of the following categories of books portray the everyday reality of life for Hasidic children today, teaching them how best to function in their own society. These books include instructions on appropriate modes of behavior and practical examples of how to incorporate Jewish observance into everyday life. This essay will examine two books in particular : one that teaches children how to prepare for bedtime, and another that outlines the daily routine of ‫די‬ ‫טאכטער‬ ָ ‫אידישע‬, the Jewish daughter. ‫נאכט‬ ַ ‫ ( ַא גוטע‬Good Night ) begins with a step-by-step manual on getting ready for bed.6 Each page is composed of a rhyming couplet describing a stage of preparation and an illustration of the activity. Regular bed-time routines that any American child would engage in, such as changing into pajamas and brushing teeth, are interspersed with religious rituals, such as kissing the mezuzah and reciting the shema prayer, with both these categories given seemingly equal weight. Furthermore, some of the neutral activities, such as washing hands, are rendered religious by the illustrations, in this case depicting a girl using a ritual washing cup at the sink. A common thread that appears throughout all of these activities is the agency of the children : they are told that it is bedtime, and they immediately begin to clean up their toys and put away their clothes all on their own. In none of the illustrations in this section of the book is there a parental ĳigure helping the children with their bedtime chores, tucking them in, or giving them a glass of warm milk, as parents in secular bedtime stories often do. In fact, the Hasidic mother is seen only once, washing dishes in the kitchen, as the children run up to her to wish her a good night before going back to their room to climb under the covers. These illustrations teach Hasidic children a very practical sort of responsibility : with an average of ten children per family, it would simply be physically impossible for the mother to help each of them at bedtime and clean up after all of them ; thus they must learn to do as they are told quickly and independently. Perhaps the most salient characteristic of The Jewish Daughter coloring book is the presence of speciĳically gendered activities that Hasidic girls are taught to engage in as part of their daily routine.7 Much like ‫נאכט‬ ַ ‫ ַא גוטע‬, ‫טאכטער‬ ָ ‫ די אידישע‬illustrates step-by-step the daily actions, both religious and mundane, of an ideal Hasidic child – this time, speciĳically a girl. From morning to night, many of the activities 6 7 ‫נאכט‬ ַ ‫ ַא גוטע‬: 2007. ‫טאכטער‬ ָ ‫ די אידישע‬n. d. 656 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ depicted are generic to any Hasidic youngster, such as saying a blessing before eating, going to school, and giving charity. This book takes particular care to demonstrate religious Jewish versions of habitual activities, for instance clearly marking the food products shown at meal times as kosher and ‫ ( חל" ־ ישׂראל‬conforming to a particularly stringent set of regulations regarding the preparation and consumption of kosher dairy products ). A number of the tasks portrayed, however, are exclusive to girls, such as learning to sew and helping the mother by playing with the younger children and cleaning the house. These instructions again serve the dual purpose of being practical for large families in which the mother needs her older children ’ s help and of preparing girls for their future roles as mothers. The Jewish Daughter book is part of a series that includes a corresponding guide to being a Jewish boy, books about Jewish holidays, and stories from the Torah. iii. The Holy Sabbath While the books mentioned in the previous section offer guidelines for going about one ’ s weekday, the next category, shabes ( Sabbath ) books, teaches Hasidic children about the great signiĳicance of preparing for and observing the Sabbath. The shabes stories typically portray a family at various stages of preparation and celebration, such as cooking and cleaning, making challah, setting the table, lighting candles, and sitting down to the Sabbath meal. One such book is ‫ אונדזער חשו"ער‬,‫שבת‬ ‫גאסט‬ ַ , ( Shabes, Our Honored Guest ).8 This work uses an element found in other genres – telling a story within a story – to teach children not only how to prepare for shabes, but also why it is important to do so. After all the work had been done and the candles lit, one little girl asks the mother why it is necessary to work so hard to make everything look nice for the holy Sabbath. In response, the mother tells an allegorical story about a king who goes to visit two villages in his kingdom. The residents of one of the villages worked very hard to get ready for the king ’ s arrival, planting beautiful flowers, baking a large cake, and sweeping the streets, while residents of the other village did nothing. Upon arrival in the ĳirst village, the king was greatly pleased and bestowed generous gifts on the residents, while the second village was scorned and punished. It is the same with the Sabbath, the mother concludes : Jews who prepare for it suitably are rewarded with blessings in the coming week. 8 Sh. Kh. D. 2007. Asya Vaisman : “ A is for the Almighty ” 657 One notable feature of this book is the style of the illustrations. The ĳirst, practical part of the book uses composite drawings, superimposing photographed images onto a painted background. For instance, in a drawing of a mother lighting Sabbath candles, the mother and children are hand-drawn, but the candlesticks and candles are photographs. The second part of the book, however – the allegory about the king – is entirely hand-drawn. It can be posited that these different styles are employed to indicate to the children an element of reality in the portrayal of the Hasidic family, so that they can apply the actions of the children in the book to their own lives, whereas the story about the king is merely an allegory and is thus illustrated with no true-to-life elements. The agency of the Hasidic children is once again apparent on every page, as the kids volunteer to help and do certain aspects of the cleaning all on their own, and the composite pictures emphasize the importance of these duties in real life. iv. A Clean Body Is a Clean Soul Another theme that recurs in children ’ s literature is the importance of cleanliness. Books on this topic draw on the paradigms of agency and practicality already discussed with relation to other genres. ‫נײער‬ ַ ‫דער‬ ‫ ( חיימל‬The New Khayim [ Chaim ] ), for example, is a story of a boy who is initially very dirty and messy, but who learns that a Jewish soul cannot function properly and perform the commandments when the body is dirty.9 As soon as Khayim ’ s mother explains this concept to him, he instantly reforms, taking care to wash himself and to keep his things clean and tidy from that day forth. In addition to emphasizing the concept that it is important to keep oneself clean and be responsible for one ’ s things ( since the mother is busy with running the house ), this book also reveals that until children learn better, their bad behavior is not a cause for concern, but as soon as a lesson is taught, they are expected to integrate it fully. Geared towards a younger audience, the books in the cleanliness genre do not teach the same commandment-oriented lessons that stories for older children do. With the parental suggestion that the book is suitable for children “ ‫ און העכער‬2 „ ( 2 years and up ), the story provides its young readers with a fundamental principle – in this case, cleanliness – upon which to build before undertaking the more speciĳic tasks detailed in other genres. 9 Sh. Kh. D. 2005. 658 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ v. Faith in God While the last book that will be discussed, ‫ ( אין זכות ון תּהלים‬Merited by the Psalms ), brings together within it many of the elements previously mentioned, its primary theme is the signiĳicance of trust in God.10 At the beginning of the book, a Hasidic family is preparing for the Sabbath, and the children help with the cleaning without being asked. The mother goes off to the grocery store with the youngest child to shop for shabes essentials. While at the store, the small child asks for a certain kind of candy, but the mother refuses, saying that the brand has an unsuitable kosher certiĳication. When the mother has her back turned, the child reaches for the candy anyway and falls face-down onto the ground, taking the shopping cart down with him. Already at this early stage of the story, a lesson is taught : honoring one ’ s father and mother is extremely important, and not obeying this commandment can lead to grave negative consequences. This, however, is not the main lesson of the story, as the child is still too young to have known better, much like Khayim, who didn ’ t know to wash his face until his mother explained it to him. When the other siblings hear ambulance sirens, they immediately start to say psalms to pray for the health of the injured person, even though they do not know for whom the ambulances were called. Because of this great good deed, God answers their prayers, and their brother returns home in time for shabes with only a scratch on his forehead. A song at the end of the story provides the moral and the lesson : Jews must thank God profoundly for giving them the great gift of prayer. Merited by the Psalms stands out in comparison to the other texts for the level of conflict and distress it portrays. Yet for all of the duress of an outside world portrayed as random and violent, the book ’ s ultimate lesson is that Jews, no matter their age, can influence the outcome of events through their faith and special relationship with the Divine. The power of prayer is directed at an anonymous victim, demonstrating the selfless and altruistic nature to which children should aspire and which is valued in Hasidic society. This act of charitableness does have its limits, however, as the ambulances that the children see are clearly marked, in Yiddish, as vehicles from the ‫ הצלה‬service, an internal Jewish rescue and relief organization. This detail maintains the strict borders around their insular community. 10 R. B. I. 2007. Asya Vaisman : “ A is for the Almighty ” 659 vi. Conclusion To conclude, it appears that there are two main categories of Hasidic children ’ s books : those that teach children about the history of their group and their people, which include both stories from the Torah and stories of Tsadikim, and those that teach children practical lessons about how best to get along in their society, both ritually and practically. In the latter category, children learn by example how to be good Jews, which includes taking responsibility from an early age, both taking care of themselves and helping their mothers, whether in cleaning up their room or cooking for shabes. The children in the stories are portrayed as distinctly different from adults – before they learn the appropriate way to behave, they are ĳirst allowed to make mistakes, to follow their ‫ יצר ־ הרע‬, their evil inclination, by reaching for a non-kosher candy or playing in the mud, since they do not yet know any better. Once a parent teaches them their lesson, however, they are expected to obey and promptly learn to act properly. The books are meant to teach children how to follow speciĳic commandments and the value of following commandments in general, as the “ Reading and Learning ” series mentioned above demonstrates in the ĳirst stanza of its concluding poem : ,‫לאמיר הערן‬ ָ ,‫ קינדערלעך‬,‫קינדערלעך‬ ‫האט איר זיך געלערנט‬ ָ ‫וועלכע מיצוות‬ ? ‫אויצוירן אויף ַא שײנעם און‬ Children, children, let ’ s hear, Which commandments have you learned To perform in a nice manner ? Works Cited : “ An Educator Involved in Yiddish Language Programs, ” 2006. In : B. C. Glaberson, ed., Educating Our Daughters, Why ? : Extraordinary Interviews with Women Educators. Jerusalem : Feldheim Publishers, 145 – 150. Fader, Ayala, 2001 : “ Literacy, Bilingualism and Gender in a Hasidic Community. ” In : Linguistics and Education 12 ( 3 ) : 261 – 283. A gute nakht, 2007. Monroe, ny : Kinder Shpiel usa. Hopkowitz, Yaakov, n. d. : Der Bal Shem-Tov. Trans. Kh. Hirshman. Or olam 6. Jerusalem : Veshinantam Levanecha. Isaacs, Miriam, 1998 : “ Creativity in Contemporary Hasidic Yiddish. ” In : Leonard J. Greenspoon, ed., Yiddish Language and Culture Then and Now. Proceedings of the Ninth Annual Symposium of the Philip M. and 660 ‫הײנט‬ ַ ‫ייִ דישע שטודיעס‬ ‫לקט‬ Ethel Klutznick Chair in Jewish Civilization. Omaha, ne : Creighton University Press, 165 – 188. Kranzler, George, 1994 : “ The Women of Williamsburg : A Contemporary Hasidic Community in Brooklyn, New York. ” In : Vasilikie Demos, ed., Ethnic Women : A Multiple Status Reality. Dix Hills, ny : General Hall. R. B. I., 2007 : In zkhus fun tilim. Leyenen un lernen 12. Monroe, ny : Kinder Shpiel. Sh. Kh. D., 2005 : Der nayer Khayiml. Leyenen un lernen 7. Monroe, ny : Kinder Shpiel. Sh. Kh. D., 2007 : Shabes undzer khoshever gast. Leyenen un lernen 15. Monroe, ny : Kinder Shpiel. Di yidishe tokhter : Coloring Book, n. d. Monsey, ny : Brandvayn. Transliteration des Hebräischen Hebrew Transliteration ‫א‬ ‫בּ‬ ‫ב‬ ‫ג‬ ‫ד‬ ‫ה‬ ‫ו‬ ‫ז‬ ‫ח‬ ‫ט‬ ‫י‬ ‫כּ‬ ‫ ך‬,‫כ‬ ‫ל‬ ‫ ם‬,‫מ‬ ‫ ן‬,‫נ‬ ‫ס‬ ‫ע‬ ‫פּ‬ ‫ ף‬,‫פ‬ ‫צ‬ ‫ק‬ ‫ר‬ ‫שׁ‬ ‫שׂ‬ ‫ת‬ ’ b v g d h w z ḥ ṭ y k kh l m n s ‘ p f ẓ q r š ś t Lange Vokale Long vowels Kurze u. sehr kurze Vokale Short and very short vowels Diphthonge Diphthongs -ָ -ֵ ‫י‬-ִ ֹ- ,‫וֹ‬ ‫וּ‬- -ֲ ,-ַ -ֱ ,-ֶ -ְ (na‘ ) -ִ -ֳ ,-ָ -ֻ ‫י‬-ַ ,‫אי‬ ‫י‬-ֵ ‫וֹי‬ ‫וּי‬ ā ē ī ō ū a e ě i o u ay ey oy uy Die Transliteration basiert auf den Regeln der ej Scientiĳic. The transcription is based on the rules of the ej Scientiĳic. Vokalqualität wird vereinfacht wiedergegeben. A simpliĳied representation of vowel length is used. Dāgēš ḥāzāq wird durch Dopplung des Buchstaben wiedergegeben. Dāgēš ḥāzāq is represented by a doubling of the letter. Die Präĳixe ‫ ש‬,‫ מ‬,‫ ל‬,‫ כ‬,‫ ב‬,‫ ו‬,‫ ה‬werden mit Bindestrich vom Hauptwort getrennt. The preĳixes ‫ ש‬,‫ מ‬,‫ ל‬,‫ כ‬,‫ ב‬,‫ ו‬,‫ ה‬are seperated from the main word by a hyphen. Danksagung Acknowledgements Für die ĳinanzielle Unterstützung danken wir Freunden des Lehrstuhls für Jiddische Kultur, Sprache und Literatur an der Heinrich-HeineUniversität Düsseldorf. We thank friends of the Chair for Yiddish Studies at the Heinrich Heine University Düsseldorf for their ĳinancial support. Für Mitarbeit und Unterstützung danken wir For help and support we thank Rachel Boertjen, Hans Rudolf Bosshard, Günther Flake, Hajo Kemper, Annelen Kranefuss, Sigrid Lethen, Ute Müller, Jochen Riks, Lawrence Rosenwald, Corinne Sauder, Emile Schrijver, Sonja Seippel, Hans Süssmuth, Ittai J. Tamari, Alison Tickner, Monika Walden, Nancy Workman, Julia Wünschmann. Liste der Autoren und Herausgeber List of Authors and Editors Marion Aptroot Abteilung für Jiddische Kultur, Sprache und Literatur, Institut für Jüdische Studien Heinrich-Heine-Universität Düsseldorf Alexander Beider Paris Shlomo Berger Department of Semitic Languages and Cultures & Program in Hebrew and Jewish Studies University of Amsterdam Nathan Cohen Rena Costa Center for Yiddish Studies Bar-Ilan University Wulf-Otto Dreessen Institut für Literaturwissenschaft Universität Stuttgart Aya Elyada Department of History The Hebrew University of Jerusalem Gennady Estraikh Skirball Department of Hebrew and Judaic Studies, New York University Jordan Finkin Department of Near Eastern Languages and Civilizations, Harvard University Jürg Fleischer Institut für Germanistische Sprachwissenschaft Philipps-Universität Marburg Ken Frieden B. G. Rudolph Chair of Judaic Studies Syracuse University Efrat Gal-Ed Abteilung für Jiddische Kultur, Sprache und Literatur, Institut für Jüdische Studien Heinrich-Heine-Universität Düsseldorf Aleksandra Geller Institut für Polnische Kultur Universität Warschau Ewa Geller Institut für Germanistik, Universität Warschau Jeffrey A. Grossman Department of Germanic Languages and Literatures, University of Virginia Roland Gruschka Lehrstuhl für Jüdische Literaturen Hochschule für Jüdische Studien Heidelberg Kathryn Hellerstein Department of Germanic Languages and Literatures, University of Pennsylvania 664 ‫הײנט‬ ַ ‫לקט ייִ דישע שטודיעס‬ Sabine Koller Steffen Krogh Institut für Slavistik, Universität Regensburg Department of Aesthetics and Communication – German, Aarhus University Tamar Lewinsky Zentrum für Jüdische Studien, Universität Basel Barbara E. Mann Department of Jewish Literature The Jewish Theological Seminary of America Rebecca Margolis Vered Jewish Canadian Studies Program University of Ottawa Diana Matut Seminar für Judaistik / Jüdische Studien Martin-Luther-Universität Halle-Wittenberg Harriet Murav Department of Slavic Languages and Literatures University of Illinois at Urbana-Champaign Simon Neuberg FB II Jiddistik, Universität Trier Alyssa Pia Quint Institute for Israel and Jewish Studies Columbia University Rachel Rojanski Program in Judaic Studies, Brown University Lawrence Rosenwald Department of English, Wellesley College Lea Schäfer Institut für Germanistische Sprachwissenschaft Philipps-Universität Marburg Jan Schwarz Center for Languages and Literatures Lund University Moshe Taube Tamara and Saveli Grinberg Chair in Russian Studies, Department of Linguistics & Department of German, Russian and East European Studies, The Hebrew University of Jerusalem Erika Timm FB II Jiddistik, Universität Trier Barry Trachtenberg Department of History & Program in Judaic Studies, University at Albany State University of New York Heather Valencia School of Arts and Humanities University of Stirling Asya Vaisman Yiddish Language Institute Yiddish Book Center & Hampshire College

RELATED PAPERS

RELATED TOPICS

Log In

Leket : Yidishe shtudyes haynt. Jiddistik heute. Yiddish Studies Today

Leket : Yidishe shtudyes haynt. Jiddistik heute. Yiddish Studies Today

Related Papers

RELATED PAPERS

RELATED TOPICS